Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|251
Gene name
LocationContig_1045:6405..8641
Strand+
Gene length (bp)2236
Transcript length (bp)2070
Coding sequence length (bp)2070
Protein length (aa) 690

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00474 SSF Sodium:solute symporter family 6.8E-22 49 459

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94469|DUR31_SCHPO Probable urea active transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-1 PE=3 SV=1 6 689 0.0E+00
sp|P33413|DUR3_YEAST Urea active transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR3 PE=1 SV=2 1 643 0.0E+00
sp|F4KD71|DUR3_ARATH Urea-proton symporter DUR3 OS=Arabidopsis thaliana GN=DUR3 PE=1 SV=1 8 655 3.0E-166
sp|Q9URY6|DUR33_SCHPO Probable urea active transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-3 PE=3 SV=1 8 689 6.0E-159
sp|Q7XBS0|DUR3_ORYSJ Urea-proton symporter DUR3 OS=Oryza sativa subsp. japonica GN=DUR3 PE=1 SV=1 6 655 4.0E-158
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94469|DUR31_SCHPO Probable urea active transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-1 PE=3 SV=1 6 689 0.0E+00
sp|P33413|DUR3_YEAST Urea active transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR3 PE=1 SV=2 1 643 0.0E+00
sp|F4KD71|DUR3_ARATH Urea-proton symporter DUR3 OS=Arabidopsis thaliana GN=DUR3 PE=1 SV=1 8 655 3.0E-166
sp|Q9URY6|DUR33_SCHPO Probable urea active transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-3 PE=3 SV=1 8 689 6.0E-159
sp|Q7XBS0|DUR3_ORYSJ Urea-proton symporter DUR3 OS=Oryza sativa subsp. japonica GN=DUR3 PE=1 SV=1 6 655 4.0E-158
sp|Q8TFG0|DUR32_SCHPO Probable urea active transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-2 PE=3 SV=1 6 657 4.0E-125
sp|P96169|SGLT_VIBPH Sodium/glucose cotransporter OS=Vibrio parahaemolyticus GN=sglT PE=1 SV=2 43 431 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 55 73 18
3 88 110 22
4 131 153 22
5 163 185 22
6 198 220 22
7 254 271 17
8 284 306 22
9 342 364 22
10 397 419 22
11 429 451 22
12 458 477 19
13 497 519 22
14 581 603 22
15 618 640 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|251
MGSPGPALSQGFGYGIILGLGFAFAVLMISLTYILKRFNNEVQTSEMFNTAGRTVKSGLVASAVVSSWTWAATLL
QSSGVCYRYGVSGPFWYASGATVQILLFATLAITLKKRAPNAHTFLEVIKARYGTAAHLTFIVFGLMTNVLVSLM
LIAGGSATVNALTGVHPVAAIFIMPIPVVAYTFIGGLKATFITDYIHGVAVLIIVMVFALNAYATSDVLGSPSAV
YDRLVEAARAHPVAGNRDGSYLTMRSQGGVTFFIINIVGGFGTVFLDNGYYNKAIAAHPVHALPGYIMGGAAWFA
IPWLTATTLGLAALALESSPRFPTFPDRMSEAEVSAGLALPYAAVALLGKGGAAATLVMIFLAVTSSFNSELVAT
SSIFTYDVYRTYVRPDASGRRLILMSHACMVLYAAVICCVSVGLLYNGISMGYLYLLMGVLISAAVIPATLTLLW
SRQNRVAAALTPVLGTACAIVAWLVTASRTCGRLDVECTGSNDPMLAGNVTALLSPLVFVPALCLGFGFDRYDWR
SMMDIRKADDADAAAAPAASSDPGAATREGAGVAEAEVREEDDDAFAAEQRKLKRAFRLACIVTTIMVLSLLVLW
PMPLYGTGYIFSKKFFTGWVTVGIIWIFCSFIAVGLYPAWESRATLTRLARAVVTGKTRPTSPAETVRADEDSSG
TVTPSEQVSAGKKE*
Coding >Hirsu2|251
ATGGGCAGCCCCGGCCCGGCATTGAGCCAAGGCTTTGGCTACGGCATCATCCTCGGCTTGGGCTTCGCCTTTGCC
GTCTTGATGATCTCCCTGACGTACATCCTCAAGCGGTTCAACAATGAGGTGCAGACGTCCGAGATGTTCAACACG
GCCGGCCGGACCGTCAAGTCCGGGCTGGTGGCCTCGGCGGTAGTGTCGTCGTGGACGTGGGCGGCGACGCTGCTG
CAGAGCTCGGGCGTCTGCTACCGCTACGGCGTGTCGGGCCCGTTCTGGTACGCGTCCGGGGCGACGGTGCAGATC
CTGCTGTTCGCGACGCTGGCCATCACGCTCAAGAAGCGGGCGCCCAACGCGCACACCTTCCTCGAGGTCATCAAG
GCGCGGTACGGCACGGCGGCGCACCTGACCTTCATCGTCTTCGGGCTCATGACCAACGTGCTGGTGTCGCTGATG
CTCATCGCCGGCGGCTCGGCCACGGTCAACGCGCTGACGGGGGTGCACCCGGTGGCGGCCATCTTCATCATGCCC
ATCCCCGTCGTGGCCTACACCTTCATCGGCGGGCTCAAGGCGACCTTCATCACCGACTACATCCACGGGGTGGCG
GTGCTCATCATCGTCATGGTCTTCGCGCTCAACGCGTACGCCACGTCGGACGTGCTCGGCAGCCCGTCGGCCGTC
TACGACCGGCTGGTGGAGGCGGCGCGGGCGCACCCCGTGGCCGGCAACCGCGACGGCAGCTACCTGACGATGCGG
TCGCAGGGCGGCGTCACCTTCTTCATCATCAACATCGTCGGCGGCTTCGGCACCGTCTTCCTCGACAACGGCTAC
TACAACAAGGCCATCGCGGCGCACCCGGTGCACGCGCTGCCGGGCTACATCATGGGCGGCGCCGCCTGGTTCGCC
ATCCCGTGGCTGACGGCGACGACGCTCGGCCTGGCGGCGCTGGCGCTCGAGTCGAGCCCGCGCTTCCCGACCTTC
CCGGACCGCATGAGCGAGGCCGAGGTGTCGGCCGGGCTGGCCCTGCCGTACGCCGCCGTCGCGCTGCTGGGCAAG
GGCGGCGCGGCGGCGACGCTCGTCATGATCTTCCTGGCCGTCACCTCGTCCTTCAACTCGGAGCTGGTGGCGACG
TCGTCCATCTTCACCTACGACGTCTACCGCACCTACGTCCGGCCCGACGCCAGCGGCCGCCGCCTGATCCTCATG
TCGCACGCGTGCATGGTGCTGTACGCGGCCGTCATCTGCTGCGTCTCGGTCGGCCTGCTGTACAACGGCATCTCG
ATGGGCTACCTGTACCTGCTGATGGGCGTCCTCATCTCGGCCGCCGTCATCCCGGCCACGCTGACGCTGCTGTGG
AGCCGGCAGAACCGCGTGGCGGCGGCGCTGACGCCCGTGCTGGGCACGGCCTGCGCCATCGTCGCCTGGCTCGTC
ACGGCCAGCCGGACGTGCGGCCGGCTCGACGTCGAGTGCACCGGCTCCAACGACCCGATGCTCGCCGGCAACGTC
ACGGCCCTGCTGTCGCCGCTCGTCTTCGTGCCGGCCCTCTGCCTCGGCTTCGGCTTCGACCGGTACGACTGGCGG
TCCATGATGGACATTCGCAAGGCCGACGACGCCGATGCCGCTGCCGCGCCCGCCGCCTCGTCCGACCCCGGCGCC
GCCACGCGGGAGGGCGCCGGGGTGGCGGAGGCCGAGGTGCGGGAAGAAGACGACGACGCGTTCGCGGCGGAGCAG
CGGAAGCTGAAGCGGGCCTTTAGGCTGGCCTGCATCGTCACCACCATCATGGTGCTATCGCTCCTGGTGCTGTGG
CCGATGCCGCTGTACGGGACCGGCTACATCTTCTCCAAGAAGTTCTTCACCGGGTGGGTGACGGTCGGCATCATC
TGGATCTTCTGCTCCTTCATCGCCGTCGGGCTGTACCCGGCGTGGGAGAGCCGGGCGACGCTGACGCGGCTCGCG
AGGGCGGTGGTGACGGGCAAGACGCGGCCGACGTCGCCGGCGGAGACGGTGCGGGCGGACGAGGACTCGAGCGGG
ACGGTGACACCGTCGGAACAGGTTTCGGCGGGCAAGAAGGAGTAG
Transcript >Hirsu2|251
ATGGGCAGCCCCGGCCCGGCATTGAGCCAAGGCTTTGGCTACGGCATCATCCTCGGCTTGGGCTTCGCCTTTGCC
GTCTTGATGATCTCCCTGACGTACATCCTCAAGCGGTTCAACAATGAGGTGCAGACGTCCGAGATGTTCAACACG
GCCGGCCGGACCGTCAAGTCCGGGCTGGTGGCCTCGGCGGTAGTGTCGTCGTGGACGTGGGCGGCGACGCTGCTG
CAGAGCTCGGGCGTCTGCTACCGCTACGGCGTGTCGGGCCCGTTCTGGTACGCGTCCGGGGCGACGGTGCAGATC
CTGCTGTTCGCGACGCTGGCCATCACGCTCAAGAAGCGGGCGCCCAACGCGCACACCTTCCTCGAGGTCATCAAG
GCGCGGTACGGCACGGCGGCGCACCTGACCTTCATCGTCTTCGGGCTCATGACCAACGTGCTGGTGTCGCTGATG
CTCATCGCCGGCGGCTCGGCCACGGTCAACGCGCTGACGGGGGTGCACCCGGTGGCGGCCATCTTCATCATGCCC
ATCCCCGTCGTGGCCTACACCTTCATCGGCGGGCTCAAGGCGACCTTCATCACCGACTACATCCACGGGGTGGCG
GTGCTCATCATCGTCATGGTCTTCGCGCTCAACGCGTACGCCACGTCGGACGTGCTCGGCAGCCCGTCGGCCGTC
TACGACCGGCTGGTGGAGGCGGCGCGGGCGCACCCCGTGGCCGGCAACCGCGACGGCAGCTACCTGACGATGCGG
TCGCAGGGCGGCGTCACCTTCTTCATCATCAACATCGTCGGCGGCTTCGGCACCGTCTTCCTCGACAACGGCTAC
TACAACAAGGCCATCGCGGCGCACCCGGTGCACGCGCTGCCGGGCTACATCATGGGCGGCGCCGCCTGGTTCGCC
ATCCCGTGGCTGACGGCGACGACGCTCGGCCTGGCGGCGCTGGCGCTCGAGTCGAGCCCGCGCTTCCCGACCTTC
CCGGACCGCATGAGCGAGGCCGAGGTGTCGGCCGGGCTGGCCCTGCCGTACGCCGCCGTCGCGCTGCTGGGCAAG
GGCGGCGCGGCGGCGACGCTCGTCATGATCTTCCTGGCCGTCACCTCGTCCTTCAACTCGGAGCTGGTGGCGACG
TCGTCCATCTTCACCTACGACGTCTACCGCACCTACGTCCGGCCCGACGCCAGCGGCCGCCGCCTGATCCTCATG
TCGCACGCGTGCATGGTGCTGTACGCGGCCGTCATCTGCTGCGTCTCGGTCGGCCTGCTGTACAACGGCATCTCG
ATGGGCTACCTGTACCTGCTGATGGGCGTCCTCATCTCGGCCGCCGTCATCCCGGCCACGCTGACGCTGCTGTGG
AGCCGGCAGAACCGCGTGGCGGCGGCGCTGACGCCCGTGCTGGGCACGGCCTGCGCCATCGTCGCCTGGCTCGTC
ACGGCCAGCCGGACGTGCGGCCGGCTCGACGTCGAGTGCACCGGCTCCAACGACCCGATGCTCGCCGGCAACGTC
ACGGCCCTGCTGTCGCCGCTCGTCTTCGTGCCGGCCCTCTGCCTCGGCTTCGGCTTCGACCGGTACGACTGGCGG
TCCATGATGGACATTCGCAAGGCCGACGACGCCGATGCCGCTGCCGCGCCCGCCGCCTCGTCCGACCCCGGCGCC
GCCACGCGGGAGGGCGCCGGGGTGGCGGAGGCCGAGGTGCGGGAAGAAGACGACGACGCGTTCGCGGCGGAGCAG
CGGAAGCTGAAGCGGGCCTTTAGGCTGGCCTGCATCGTCACCACCATCATGGTGCTATCGCTCCTGGTGCTGTGG
CCGATGCCGCTGTACGGGACCGGCTACATCTTCTCCAAGAAGTTCTTCACCGGGTGGGTGACGGTCGGCATCATC
TGGATCTTCTGCTCCTTCATCGCCGTCGGGCTGTACCCGGCGTGGGAGAGCCGGGCGACGCTGACGCGGCTCGCG
AGGGCGGTGGTGACGGGCAAGACGCGGCCGACGTCGCCGGCGGAGACGGTGCGGGCGGACGAGGACTCGAGCGGG
ACGGTGACACCGTCGGAACAGGTTTCGGCGGGCAAGAAGGAGTAG
Gene >Hirsu2|251
ATGGGCAGCCCCGGCCCGGCATTGAGCCAAGGCTTTGGCTACGGCATCATCCTCGGCTTGGGCTTCGCCTTTGCC
GTCTTGATGGTATGGCGAACAGGAACCCAAGCATCCGAGCTCTCCCCTTCTCCCGCTCGGGACCCGACACCCGAA
GGCTGACGCCTCTGGCTTGGTCCCGGATAGATCTCCCTGACGTACATCCTCAAGCGGTTCAACAATGAGGTGCAG
ACGTCCGAGATGTTCAACACGGCCGGCCGGACCGTCAAGTCCGGGCTGGTGGCCTCGGCGGTAGTGTCGTCGTGG
ACGTGGGCGGCGACGCTGCTGCAGAGCTCGGGCGTCTGCTACCGCTACGGCGTGTCGGGCCCGTTCTGGTACGCG
TCCGGGGCGACGGTGCAGATCCTGCTGTTCGCGACGCTGGCCATCACGCTCAAGAAGCGGGCGCCCAACGCGCAC
ACCTTCCTCGAGGTCATCAAGGCGCGGTACGGCACGGCGGCGCACCTGACCTTCATCGTCTTCGGGCTCATGACC
AACGTGCTGGTGTCGCTGATGCTCATCGCCGGCGGCTCGGCCACGGTCAACGCGCTGACGGGGGTGCACCCGGTG
GCGGCCATCTTCATCATGCCCATCCCCGTCGTGGCCTACACCTTCATCGGCGGGCTCAAGGCGACCTTCATCACC
GACTACATCCACGGGGTGGCGGTGCTCATCATCGTCATGGTCTTCGCGCTCAACGCGTACGCCACGTCGGACGTG
CTCGGCAGCCCGTCGGCCGTCTACGACCGGCTGGTGGAGGCGGCGCGGGCGCACCCCGTGGCCGGCAACCGCGAC
GGCAGCTACCTGACGATGCGGTCGCAGGGCGGCGTCACCTTCTTCATCATCAACATCGTCGGCGGCTTCGGCACC
GTCTTCCTCGACAACGGCTACTACAACAAGGCCATCGCGGCGCACCCGGTGCACGCGCTGCCGGGCTACATCATG
GGCGGCGCCGCCTGGTTCGCCATCCCGTGGCTGACGGCGACGACGCTCGGCCTGGCGGCGCTGGCGCTCGAGTCG
AGCCCGCGCTTCCCGACCTTCCCGGACCGCATGAGCGAGGCCGAGGTGTCGGCCGGGCTGGCCCTGCCGTACGCC
GCCGTCGCGCTGCTGGGCAAGGGCGGCGCGGCGGCGACGCTCGTCATGATCTTCCTGGCCGTCACCTCGTCCTTC
AACTCGGAGCTGGTGGCGACGTCGTCCATCTTCACCTACGACGTCTACCGCACCTACGTCCGGCCCGACGCCAGC
GGCCGCCGCCTGATCCTCATGTCGCACGCGTGCATGGTGCTGTACGCGGCCGTCATCTGCTGCGTCTCGGTCGGC
CTGCTGTACAACGGCATCTCGATGGGCTACCTGTACCTGCTGATGGGCGTCCTCATCTCGGCCGCCGTCATCCCG
GCCACGCTGACGCTGCTGTGGAGCCGGCAGAACCGCGTGGCGGCGGCGCTGACGCCCGTGCTGGGCACGGCCTGC
GCCATCGTCGCCTGGCTCGTCACGGCCAGCCGGACGTGCGGCCGGCTCGACGTCGAGTGCACCGGCTCCAACGAC
CCGATGCTCGCCGGCAACGTCACGGCCCTGCTGTCGCCGCTCGTCTTCGTGCCGGCCCTCTGCCTCGGCTTCGGC
TTCGACCGGTACGACTGGCGGTCCATGATGGACATTCGCAAGGCCGACGACGCCGATGCCGCTGCCGCGCCCGCC
GCCTCGTCCGACCCCGGCGCCGCCACGCGGGAGGGCGCCGGGGTGGCGGAGGCCGAGGTGCGGGAAGAAGACGAC
GACGCGTTCGCGGCGGAGCAGCGGAAGCTGAAGCGGGCCTTTAGGCTGGCCTGCATCGTCACCACCATCATGTAC
GTGTTTTTTTTTTTCGAGCCTTTCCTCTCGCCTCTCCCCCTTGCCCGCCGCTAACCCGGCCGGCAGGGTGCTATC
GCTCCTGGTGCTGTGGCCGATGCCGCTGTACGGGACCGGCTACATCTTCTCCAAGAAGTTCTTCACCGGGTGGGT
GACGGTCGGCATCATCTGGATCTTCTGCTCCTTCATCGCCGTCGGGCTGTACCCGGCGTGGGAGAGCCGGGCGAC
GCTGACGCGGCTCGCGAGGGCGGTGGTGACGGGCAAGACGCGGCCGACGTCGCCGGCGGAGACGGTGCGGGCGGA
CGAGGACTCGAGCGGGACGGTGACACCGTCGGAACAGGTTTCGGCGGGCAAGAAGGAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail