Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2508
Gene name
LocationContig_16:68348..70705
Strand+
Gene length (bp)2357
Transcript length (bp)2292
Coding sequence length (bp)2292
Protein length (aa) 764

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 5.5E-93 248 587

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94323|YGK5_SCHPO Uncharacterized pyrophosphatase/phosphodiesterase C725.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.05c PE=3 SV=1 191 644 7.0E-118
sp|J3SEZ3|PDE1_CROAD Venom phosphodiesterase 1 OS=Crotalus adamanteus PE=1 SV=2 249 638 8.0E-73
sp|J3SBP3|PDE2_CROAD Venom phosphodiesterase 2 OS=Crotalus adamanteus PE=1 SV=1 249 638 1.0E-72
sp|P15396|ENPP3_BOVIN Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Bos taurus GN=ENPP3 PE=1 SV=2 246 638 1.0E-70
sp|P25353|NPP1_YEAST Ectonucleotide pyrophosphatase/phosphodiesterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPP1 PE=1 SV=2 200 657 3.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94323|YGK5_SCHPO Uncharacterized pyrophosphatase/phosphodiesterase C725.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.05c PE=3 SV=1 191 644 7.0E-118
sp|J3SEZ3|PDE1_CROAD Venom phosphodiesterase 1 OS=Crotalus adamanteus PE=1 SV=2 249 638 8.0E-73
sp|J3SBP3|PDE2_CROAD Venom phosphodiesterase 2 OS=Crotalus adamanteus PE=1 SV=1 249 638 1.0E-72
sp|P15396|ENPP3_BOVIN Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Bos taurus GN=ENPP3 PE=1 SV=2 246 638 1.0E-70
sp|P25353|NPP1_YEAST Ectonucleotide pyrophosphatase/phosphodiesterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPP1 PE=1 SV=2 200 657 3.0E-69
sp|P22413|ENPP1_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Homo sapiens GN=ENPP1 PE=1 SV=2 245 638 3.0E-67
sp|Q924C3|ENPP1_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Rattus norvegicus GN=Enpp1 PE=1 SV=2 245 636 8.0E-66
sp|Q6DYE8|ENPP3_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Mus musculus GN=Enpp3 PE=1 SV=2 246 638 4.0E-65
sp|Q5R5M5|ENPP3_PONAB Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Pongo abelii GN=ENPP3 PE=2 SV=1 246 638 4.0E-65
sp|O14638|ENPP3_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Homo sapiens GN=ENPP3 PE=1 SV=2 246 638 6.0E-65
sp|P06802|ENPP1_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Mus musculus GN=Enpp1 PE=1 SV=4 245 638 7.0E-65
sp|P97675|ENPP3_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Rattus norvegicus GN=Enpp3 PE=1 SV=2 246 638 1.0E-64
sp|Q6AX80|ENPP4_XENLA Bis(5'-adenosyl)-triphosphatase enpp4 OS=Xenopus laevis GN=enpp4 PE=2 SV=1 245 639 2.0E-64
sp|Q566N0|ENPP4_DANRE Bis(5'-adenosyl)-triphosphatase enpp4 OS=Danio rerio GN=enpp4 PE=2 SV=1 228 639 1.0E-62
sp|Q9R1E6|ENPP2_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Mus musculus GN=Enpp2 PE=1 SV=3 246 638 1.0E-61
sp|Q64610|ENPP2_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Rattus norvegicus GN=Enpp2 PE=1 SV=2 246 638 3.0E-60
sp|Q6DDP3|ENPP6_XENLA Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 OS=Xenopus laevis GN=enpp6 PE=2 SV=1 246 638 5.0E-60
sp|Q8BTJ4|ENPP4_MOUSE Bis(5'-adenosyl)-triphosphatase enpp4 OS=Mus musculus GN=Enpp4 PE=1 SV=1 245 639 5.0E-60
sp|A1A4K5|ENPP2_BOVIN Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Bos taurus GN=ENPP2 PE=1 SV=1 246 638 7.0E-60
sp|Q5BKW7|ENPP6_DANRE Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 OS=Danio rerio GN=enpp6 PE=2 SV=1 249 638 7.0E-60
sp|Q9Y6X5|ENPP4_HUMAN Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Homo sapiens GN=ENPP4 PE=1 SV=3 238 639 2.0E-59
sp|Q13822|ENPP2_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Homo sapiens GN=ENPP2 PE=1 SV=3 246 638 3.0E-59
sp|Q0VA77|ENPP4_XENTR Bis(5'-adenosyl)-triphosphatase enpp4 OS=Xenopus tropicalis GN=enpp4 PE=2 SV=1 245 640 4.0E-58
sp|Q5RAC0|ENPP4_PONAB Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Pongo abelii GN=ENPP4 PE=2 SV=1 238 639 8.0E-58
sp|Q6UWR7|ENPP6_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 OS=Homo sapiens GN=ENPP6 PE=1 SV=2 249 638 1.0E-57
sp|F1N5C8|ENPP6_BOVIN Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 OS=Bos taurus GN=ENPP6 PE=1 SV=2 249 638 1.0E-57
sp|Q5RB45|ENPP6_PONAB Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 OS=Pongo abelii GN=ENPP6 PE=2 SV=2 249 638 1.0E-57
sp|Q8BGN3|ENPP6_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 OS=Mus musculus GN=Enpp6 PE=1 SV=1 249 638 1.0E-56
sp|B0BND0|ENPP6_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 OS=Rattus norvegicus GN=Enpp6 PE=1 SV=1 249 638 3.0E-56
sp|Q58D68|ENPP6_PIG Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 OS=Sus scrofa GN=ENPP6 PE=2 SV=2 249 638 3.0E-56
sp|A2VDP5|ENPP4_BOVIN Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Bos taurus GN=ENPP4 PE=2 SV=1 239 639 7.0E-56
sp|Q9UJA9|ENPP5_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Homo sapiens GN=ENPP5 PE=2 SV=1 248 639 1.0E-53
sp|P39997|NPP2_YEAST Ectonucleotide pyrophosphatase/phosphodiesterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPP2 PE=1 SV=1 200 624 7.0E-52
sp|Q5EZ72|ENPP7_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Rattus norvegicus GN=Enpp7 PE=1 SV=1 249 637 7.0E-51
sp|Q9EQG7|ENPP5_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Mus musculus GN=Enpp5 PE=1 SV=3 248 639 2.0E-50
sp|P84039|ENPP5_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Rattus norvegicus GN=Enpp5 PE=1 SV=2 248 666 9.0E-50
sp|Q6UWV6|ENPP7_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Homo sapiens GN=ENPP7 PE=1 SV=3 249 639 8.0E-49
sp|P90755|ENPP2_CAEEL Ectonucleotide pyrophosphatase/phosphodiesterase C27A7.3 OS=Caenorhabditis elegans GN=C27A7.3 PE=3 SV=3 245 639 4.0E-43
sp|P90754|ENPP1_CAEEL Ectonucleotide pyrophosphatase/phosphodiesterase C27A7.1 OS=Caenorhabditis elegans GN=C27A7.1 PE=1 SV=1 246 639 1.0E-40
sp|Q51782|PHNHY_PSEFL Phosphonoacetate hydrolase OS=Pseudomonas fluorescens GN=phnA PE=1 SV=1 248 475 2.0E-07
sp|Q50HR5|PHNHY_PSECE Phosphonoacetate hydrolase OS=Pseudomonas cedrina GN=phnA PE=3 SV=1 248 475 2.0E-07
sp|Q50HR6|PHNHY_PSEPU Phosphonoacetate hydrolase OS=Pseudomonas putida GN=phnA PE=3 SV=1 248 475 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 201 220 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2508
MPHKRLDPPNPADRDERLLLSPVICDDDDASLHSRSDQDTDSDDDQLQQRARNSRELRAHDRIVLMEEEEMDRLV
TNSREEQARQRRGSGLAVPNPFKMFGRQPSLSDLSAAGSSTEDLVLEKRKARRARRKQKRNRLMREARHGEDGEL
MYEMEEGGMKQGSSTGDSTPRDDSGEDERRRLSLMPAASAKAHRRSGCRRSFFIHLLITIGFAILVLVAWKLSKN
RNAGKGHERPLVSNGTALFAPTTILISLDGFRADFLQRGLTPRLNAFIQEGVSPKYMLPSFPSVTFPNHYTLATG
LYPESHGVVGNSFWDPDLRAEFFYTDPKRSLDPKWWGGEPFWVTAERQGIRTAVHMWPGSEAHILRVEPSFVDKY
NGKETLANKVTRILGLLDMPGKEDASADVGRMRPQLIAAYVPNVDADGHKYGPNSTEIRSTIKDVDTMLDQLFQG
LDQRNLTGIVNVIVVSDHGMATTDSSRLIQLEDVVNTSRIEHNDGWPLFGLRPKDGRDLQDLYRGLKEKSRTTPG
FDVYLRDVDMPERYHFSNNRRIAPLWIVPKTGWAIVKRDDFDVEKGKKDRLVYHPRGLHGYDHEHPLMRAIFVAR
GPAFPHPANSQVKHFQNIEVYNILADSIGMDPKPNNGTLRLPLQPIGKHDPEDVPAEPADPPPQTSEALSQPSEE
PPKRPTIFEGPLVPERPSRPPRPSQEAAEAEAAPGPPEVGANERYQAQKRAGEHPFNVMVGQLFQTVQNWFNKTI
KPPLTRALKKLTE*
Coding >Hirsu2|2508
ATGCCTCATAAAAGACTCGACCCCCCCAACCCGGCCGATCGTGACGAGAGGCTCCTGCTGTCACCCGTCATCTGC
GACGACGACGACGCGTCCCTCCACAGCCGAAGCGACCAAGATACCGACAGCGACGACGACCAGCTGCAGCAGCGA
GCCCGCAACAGCCGAGAGCTGCGCGCCCACGACCGCATCGTTCTCATGGAGGAGGAAGAGATGGACCGCCTGGTG
ACCAACTCCCGAGAGGAACAGGCCCGGCAGAGGCGCGGCTCGGGCCTGGCCGTCCCCAATCCCTTCAAGATGTTT
GGCCGTCAGCCGAGCCTGTCGGACCTCTCCGCCGCCGGAAGCTCCACCGAGGACTTGGTGTTGGAGAAGCGCAAG
GCGCGCCGGGCTAGGCGCAAGCAGAAGCGGAACCGGCTGATGCGCGAGGCCCGTCACGGCGAGGATGGCGAGCTG
ATGTACGAGATGGAGGAGGGCGGCATGAAACAGGGCAGCTCGACCGGCGACAGCACGCCACGCGACGACAGCGGC
GAGGACGAGCGCCGTCGTCTCAGCCTCATGCCGGCCGCCTCCGCCAAGGCACACCGCCGCTCCGGCTGCCGACGC
TCCTTCTTCATCCACCTACTCATCACCATCGGCTTCGCAATCCTCGTCCTCGTCGCCTGGAAGCTCTCAAAGAAC
CGCAACGCCGGCAAGGGCCATGAGCGTCCTCTCGTCAGCAACGGAACGGCCTTGTTTGCACCCACCACCATCCTC
ATCAGCCTCGACGGCTTCCGCGCCGACTTCCTGCAGCGCGGCCTCACCCCGAGGCTGAACGCCTTCATTCAAGAG
GGCGTCTCGCCCAAGTACATGCTGCCCTCCTTCCCGTCCGTCACCTTTCCGAACCACTACACTCTGGCGACGGGC
CTGTATCCCGAGAGCCACGGTGTCGTCGGAAACTCGTTCTGGGACCCGGACCTGCGCGCCGAGTTCTTCTACACC
GACCCTAAGCGAAGCCTGGACCCCAAGTGGTGGGGGGGCGAGCCGTTCTGGGTCACGGCCGAGCGGCAGGGGATC
CGGACCGCAGTCCACATGTGGCCCGGCAGCGAGGCGCACATTCTGAGGGTCGAGCCGAGCTTCGTCGACAAGTAC
AACGGCAAGGAGACGCTCGCCAACAAGGTGACCAGGATCCTCGGCCTTCTCGACATGCCGGGCAAGGAAGACGCA
TCGGCCGACGTCGGCCGGATGCGCCCCCAGCTCATCGCGGCTTACGTGCCCAACGTCGACGCCGACGGCCACAAG
TACGGGCCGAACAGCACCGAGATCCGGTCCACCATCAAGGACGTCGACACGATGCTGGACCAGCTGTTCCAGGGG
CTGGACCAGCGCAATCTCACCGGCATCGTCAACGTCATCGTCGTCTCGGACCATGGCATGGCCACGACGGACAGC
TCGAGGCTGATCCAGCTGGAAGACGTGGTGAACACGTCCAGGATTGAACACAACGATGGCTGGCCGCTCTTCGGT
CTCCGGCCCAAGGACGGCCGGGACCTGCAAGATCTCTACCGGGGGCTGAAGGAAAAGTCCCGGACCACGCCCGGC
TTCGACGTCTATCTCCGCGACGTCGACATGCCCGAGCGCTATCATTTCTCCAACAACCGGCGCATCGCGCCCCTG
TGGATCGTCCCCAAGACGGGCTGGGCCATTGTGAAAAGGGACGACTTCGACGTGGAAAAGGGCAAGAAGGACAGG
CTCGTGTACCACCCTCGTGGACTACACGGGTACGACCACGAACATCCCTTGATGAGGGCCATCTTCGTGGCCCGT
GGTCCGGCGTTCCCACATCCGGCCAACAGCCAGGTCAAGCATTTCCAGAACATTGAAGTGTACAACATCCTGGCC
GATTCGATAGGGATGGACCCAAAGCCCAACAATGGGACGCTCCGGCTGCCCCTGCAGCCCATCGGTAAGCACGAC
CCTGAAGACGTACCGGCCGAGCCGGCCGATCCGCCGCCTCAAACTTCGGAGGCACTGTCACAACCGTCCGAGGAG
CCGCCGAAGCGTCCCACTATTTTCGAAGGCCCGCTGGTGCCGGAGCGGCCCAGCCGTCCGCCACGTCCGTCCCAA
GAGGCGGCCGAGGCCGAAGCCGCTCCGGGCCCCCCGGAAGTGGGCGCGAATGAAAGATACCAAGCACAAAAGAGG
GCGGGGGAGCATCCCTTCAATGTGATGGTCGGACAGTTGTTTCAAACGGTCCAAAACTGGTTCAACAAGACAATC
AAGCCCCCCTTGACGCGCGCCCTCAAGAAATTGACGGAATAA
Transcript >Hirsu2|2508
ATGCCTCATAAAAGACTCGACCCCCCCAACCCGGCCGATCGTGACGAGAGGCTCCTGCTGTCACCCGTCATCTGC
GACGACGACGACGCGTCCCTCCACAGCCGAAGCGACCAAGATACCGACAGCGACGACGACCAGCTGCAGCAGCGA
GCCCGCAACAGCCGAGAGCTGCGCGCCCACGACCGCATCGTTCTCATGGAGGAGGAAGAGATGGACCGCCTGGTG
ACCAACTCCCGAGAGGAACAGGCCCGGCAGAGGCGCGGCTCGGGCCTGGCCGTCCCCAATCCCTTCAAGATGTTT
GGCCGTCAGCCGAGCCTGTCGGACCTCTCCGCCGCCGGAAGCTCCACCGAGGACTTGGTGTTGGAGAAGCGCAAG
GCGCGCCGGGCTAGGCGCAAGCAGAAGCGGAACCGGCTGATGCGCGAGGCCCGTCACGGCGAGGATGGCGAGCTG
ATGTACGAGATGGAGGAGGGCGGCATGAAACAGGGCAGCTCGACCGGCGACAGCACGCCACGCGACGACAGCGGC
GAGGACGAGCGCCGTCGTCTCAGCCTCATGCCGGCCGCCTCCGCCAAGGCACACCGCCGCTCCGGCTGCCGACGC
TCCTTCTTCATCCACCTACTCATCACCATCGGCTTCGCAATCCTCGTCCTCGTCGCCTGGAAGCTCTCAAAGAAC
CGCAACGCCGGCAAGGGCCATGAGCGTCCTCTCGTCAGCAACGGAACGGCCTTGTTTGCACCCACCACCATCCTC
ATCAGCCTCGACGGCTTCCGCGCCGACTTCCTGCAGCGCGGCCTCACCCCGAGGCTGAACGCCTTCATTCAAGAG
GGCGTCTCGCCCAAGTACATGCTGCCCTCCTTCCCGTCCGTCACCTTTCCGAACCACTACACTCTGGCGACGGGC
CTGTATCCCGAGAGCCACGGTGTCGTCGGAAACTCGTTCTGGGACCCGGACCTGCGCGCCGAGTTCTTCTACACC
GACCCTAAGCGAAGCCTGGACCCCAAGTGGTGGGGGGGCGAGCCGTTCTGGGTCACGGCCGAGCGGCAGGGGATC
CGGACCGCAGTCCACATGTGGCCCGGCAGCGAGGCGCACATTCTGAGGGTCGAGCCGAGCTTCGTCGACAAGTAC
AACGGCAAGGAGACGCTCGCCAACAAGGTGACCAGGATCCTCGGCCTTCTCGACATGCCGGGCAAGGAAGACGCA
TCGGCCGACGTCGGCCGGATGCGCCCCCAGCTCATCGCGGCTTACGTGCCCAACGTCGACGCCGACGGCCACAAG
TACGGGCCGAACAGCACCGAGATCCGGTCCACCATCAAGGACGTCGACACGATGCTGGACCAGCTGTTCCAGGGG
CTGGACCAGCGCAATCTCACCGGCATCGTCAACGTCATCGTCGTCTCGGACCATGGCATGGCCACGACGGACAGC
TCGAGGCTGATCCAGCTGGAAGACGTGGTGAACACGTCCAGGATTGAACACAACGATGGCTGGCCGCTCTTCGGT
CTCCGGCCCAAGGACGGCCGGGACCTGCAAGATCTCTACCGGGGGCTGAAGGAAAAGTCCCGGACCACGCCCGGC
TTCGACGTCTATCTCCGCGACGTCGACATGCCCGAGCGCTATCATTTCTCCAACAACCGGCGCATCGCGCCCCTG
TGGATCGTCCCCAAGACGGGCTGGGCCATTGTGAAAAGGGACGACTTCGACGTGGAAAAGGGCAAGAAGGACAGG
CTCGTGTACCACCCTCGTGGACTACACGGGTACGACCACGAACATCCCTTGATGAGGGCCATCTTCGTGGCCCGT
GGTCCGGCGTTCCCACATCCGGCCAACAGCCAGGTCAAGCATTTCCAGAACATTGAAGTGTACAACATCCTGGCC
GATTCGATAGGGATGGACCCAAAGCCCAACAATGGGACGCTCCGGCTGCCCCTGCAGCCCATCGGTAAGCACGAC
CCTGAAGACGTACCGGCCGAGCCGGCCGATCCGCCGCCTCAAACTTCGGAGGCACTGTCACAACCGTCCGAGGAG
CCGCCGAAGCGTCCCACTATTTTCGAAGGCCCGCTGGTGCCGGAGCGGCCCAGCCGTCCGCCACGTCCGTCCCAA
GAGGCGGCCGAGGCCGAAGCCGCTCCGGGCCCCCCGGAAGTGGGCGCGAATGAAAGATACCAAGCACAAAAGAGG
GCGGGGGAGCATCCCTTCAATGTGATGGTCGGACAGTTGTTTCAAACGGTCCAAAACTGGTTCAACAAGACAATC
AAGCCCCCCTTGACGCGCGCCCTCAAGAAATTGACGGAATAA
Gene >Hirsu2|2508
ATGCCTCATAAAAGACTCGACCCCCCCAACCCGGCCGATCGTGACGAGAGGCTCCTGCTGTCACCCGTCATCTGC
GACGACGACGACGCGTCCCTCCACAGCCGAAGCGACCAAGATACCGACAGCGACGACGACCAGCTGCAGCAGCGA
GCCCGCAACAGCCGAGAGCTGCGCGCCCACGACCGCATCGTTCTCATGGAGGAGGAAGAGATGGACCGCCTGGTG
ACCAACTCCCGAGAGGAACAGGCCCGGCAGAGGCGCGGCTCGGGCCTGGCCGTCCCCAATCCCTTCAAGATGTTT
GGCCGTCAGCCGAGCCTGTCGGACCTCTCCGCCGCCGGAAGCTCCACCGAGGACTTGGTGTTGGAGAAGCGCAAG
GCGCGCCGGGCTAGGCGCAAGCAGAAGCGGAACCGGCTGATGCGCGAGGCCCGTCACGGCGAGGATGGCGAGCTG
ATGTACGAGATGGAGGAGGGCGGCATGAAACAGGGCAGCTCGACCGGCGACAGCACGCCACGCGACGACAGCGGC
GAGGACGAGCGCCGTCGTCTCAGCCTCATGCCGGCCGCCTCCGCCAAGGCACACCGCCGCTCCGGCTGCCGACGC
TCCTTCTTCATCCACCTACTCATCACCATCGGCTTCGCAATCCTCGTCCTCGTCGCCTGGAAGCTCTCAAAGAAC
CGCAACGCCGGCAAGGGCCATGAGCGTCCTCTCGTCAGCAACGGAACGGCCTTGTTTGCACCCACCACCATCCTC
ATCAGCCTCGACGGCTTCCGCGCCGACTTCCTGCAGCGCGGCCTCACCCCGAGGCTGAACGCCTTCATTCAAGAG
GGCGTCTCGCCCAAGTACATGCTGCCCTCCTTCCCGTCCGTCACCTTTCCGAACCACTACACTCTGGCGACGGGC
CTGTATCCCGAGAGCCACGGTGTCGTCGGAAACTCGTTCTGGGACCCGGACCTGCGCGCCGAGTTCTTCTACACC
GACCCTAAGCGAAGCCTGGACCCCAAGTGGTGGGGGGGCGAGCCGTTCTGGGTCACGGCCGAGCGGCAGGGGATC
CGGACCGCAGTCCACATGTGGCCCGGCAGCGAGGCGCACATTCTGAGGGTCGAGCCGAGCTTCGTCGACAAGTAC
AACGGCAAGGAGACGCTCGCCAACAAGGTGACCAGGATCCTCGGCCTTCTCGACATGCCGGGCAAGGAAGACGCA
TCGGCCGACGTCGGCCGGATGCGCCCCCAGCTCATCGCGGCTTACGTGCCCAACGTCGACGCCGACGGCCACAAG
TACGGGCCGAACAGCACCGAGATCCGGTCCACCATCAAGGACGTCGACACGATGCTGGACCAGCTGTTCCAGGGG
CTGGACCAGCGCAATCTCACCGGCATCGTCAACGTCATCGTCGTCTCGGACCATGGCATGGCCACGACGGACAGC
TCGAGGCTGATCCAGCTGGAAGACGTGGTGAACACGTCCAGGATTGAACACAACGATGGCTGGCCGCTCTTCGGT
CTCCGGCCCAAGGACGGCCGGGACCTGCAAGATCTCTACCGGGGGCTGAAGGAAAAGTCCCGGACCACGCCCGGC
TTCGACGTCTATCTCCGCGACGTCGACATGCCCGAGCGCTATCATTTCTCCAACAACCGGCGCATCGCGCCCCTG
TGGATCGTCCCCAAGACGGGCTGGGCCATTGTGAAAAGGGACGACTTCGACGTGGAAAAGGGCAAGAAGGACAGG
CTCGTGTACCACCCTCGTGGACTACACGGGTACGACCACGAACATCCCTTGATGAGGGCCATCTTCGTGGCCCGT
GGTCCGGCGTTCCCACATCCGGCCAACAGCCAGGTCAAGCATTTCCGTGAGTCCCCAGGCCCTTTCTGTACCAAC
CGAGGGGCGACGCGACTGATTCGAGTCGGAATGCAGAGAACATTGAAGTGTACAACATCCTGGCCGATTCGATAG
GGATGGACCCAAAGCCCAACAATGGGACGCTCCGGCTGCCCCTGCAGCCCATCGGTAAGCACGACCCTGAAGACG
TACCGGCCGAGCCGGCCGATCCGCCGCCTCAAACTTCGGAGGCACTGTCACAACCGTCCGAGGAGCCGCCGAAGC
GTCCCACTATTTTCGAAGGCCCGCTGGTGCCGGAGCGGCCCAGCCGTCCGCCACGTCCGTCCCAAGAGGCGGCCG
AGGCCGAAGCCGCTCCGGGCCCCCCGGAAGTGGGCGCGAATGAAAGATACCAAGCACAAAAGAGGGCGGGGGAGC
ATCCCTTCAATGTGATGGTCGGACAGTTGTTTCAAACGGTCCAAAACTGGTTCAACAAGACAATCAAGCCCCCCT
TGACGCGCGCCCTCAAGAAATTGACGGAATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail