Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2503
Gene name
LocationContig_16:52093..54253
Strand-
Gene length (bp)2160
Transcript length (bp)2160
Coding sequence length (bp)2160
Protein length (aa) 720

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.2011 0.1523 0.6659 0.1585 0.5752 0.1408 0.07 0.1362 0.2165 0.1101

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup319
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|2443
Ophiocordyceps australis map64 (Brazil) OphauB2|5230
Ophiocordyceps australis map64 (Brazil) OphauB2|5625
Ophiocordyceps camponoti-rufipedis Ophun1|2420
Ophiocordyceps kimflemingae Ophio5|5926
Ophiocordyceps subramaniannii Hirsu2|2503 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5702
Ophiocordyceps subramaniannii Hirsu2|6937
Ophiocordyceps subramaniannii Hirsu2|775
Ophiocordyceps subramaniannii Hirsu2|9312

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2503
MPTDLGPAKQANPKLAALAESMSDKEFARLARNNGLASIAEKRWKMALPDVRAVALSHKKLSTASAKLSPKGVAL
KVGGGGLNVAGVGLWIKGVVDVFTTESSDWDKAAAVTAIIPFVGCGTNAAAQAEHKGGVDALLVLDTSLCLLADA
LLLGTATAPLGIVLHLVRFLIQLFEPPKALPSFGEIKAMRDKPWQSFLDQHLTDFLASKAWRDKLEGAIAVEALG
ILSQAAETIGLLEAGGQFAINASAQDTEAAPGQLQKQVGGQSAVYPSAEAIEAAPGRRDSSRLQNKVQAAVAQVR
AKMTAEIVRRQRQYLLTLPTLLRDDFGASMRETARRYNEDFIQKLQSDEMIERYPSHPQISAWAVSDDSLYKPAR
TLMIDAGNRLRLSPPELPSLFTLSYFVGVAAGVDDPPPRRIVRPNQPGYAKYRHTRPKDWKSAVNPIVIDPRRYY
REKAGGKEGWKAILQHTQYVARLLQGKIKESDLPKAAPGLSDVREFHMLLAMHIGNRFADWKQIRGSKVGYIHED
FEKDEDALLDALYSLPEPGEEEEEGEEEEEEEGVAEDEPMAKDLPQFQGGDCHQGDKAIECGGGLTVKAYHEAEK
ACSGFWDPEAGKCRAKASDLPEFEGHECRKGDKVIECGGGLDVMAFVNAQSHCRGFWDPESGTCREKAKDLPEFE
GRECRRDDVVVDCGGGLELMDYIDKQKACTGAWNPDLAVCGEEK*
Coding >Hirsu2|2503
ATGCCGACGGATCTGGGGCCGGCCAAGCAAGCGAACCCCAAACTAGCGGCCCTGGCCGAGAGCATGTCGGACAAA
GAATTCGCAAGGCTCGCGCGCAACAACGGACTGGCTTCCATCGCCGAGAAGAGGTGGAAGATGGCCCTTCCCGAC
GTGCGCGCCGTGGCCCTGAGCCACAAGAAACTCTCGACCGCGTCGGCCAAGCTGAGCCCGAAAGGCGTGGCGCTC
AAGGTAGGCGGCGGCGGCCTGAACGTGGCCGGCGTCGGCCTCTGGATCAAGGGCGTAGTGGACGTCTTCACGACC
GAGTCGAGCGACTGGGACAAGGCGGCCGCCGTTACGGCCATCATCCCCTTCGTAGGCTGTGGCACGAACGCGGCG
GCGCAGGCCGAGCACAAGGGCGGCGTCGATGCATTGCTCGTGCTGGACACGAGCCTGTGCCTCTTGGCCGATGCG
CTGTTACTCGGTACCGCTACTGCTCCGCTGGGCATCGTCTTGCACCTCGTCCGATTTCTAATCCAGCTCTTCGAG
CCGCCCAAGGCCCTACCTTCGTTCGGCGAAATCAAAGCCATGCGCGATAAGCCCTGGCAGAGCTTCCTCGACCAG
CACCTGACCGACTTCCTCGCCTCCAAGGCCTGGCGCGACAAGCTCGAGGGCGCCATCGCCGTGGAGGCCCTGGGC
ATCCTGTCCCAAGCCGCCGAGACGATAGGTCTACTGGAGGCGGGTGGCCAGTTTGCCATCAACGCGTCCGCCCAA
GATACGGAGGCTGCCCCTGGCCAGCTTCAGAAGCAGGTCGGTGGCCAGTCTGCCGTATACCCGTCCGCCGAAGCG
ATAGAGGCCGCCCCTGGCCGGCGGGACTCGAGCCGGCTCCAGAACAAGGTCCAGGCGGCCGTTGCTCAGGTCCGA
GCAAAGATGACGGCCGAGATAGTACGGCGGCAACGCCAGTACCTACTGACGCTCCCTACCTTACTACGCGACGAC
TTCGGCGCTTCGATGAGGGAGACAGCCCGACGATATAATGAGGATTTTATCCAGAAGCTCCAGTCGGACGAAATG
ATTGAGAGATACCCGTCTCACCCGCAGATTTCAGCCTGGGCCGTCTCCGATGATTCGCTATATAAGCCTGCCCGT
ACGCTGATGATCGATGCCGGCAACAGACTACGGCTTAGTCCGCCAGAACTGCCTAGCCTCTTCACCCTCTCCTAC
TTCGTAGGCGTCGCGGCCGGAGTCGACGATCCACCGCCGCGGAGGATCGTCCGGCCCAACCAGCCGGGATATGCA
AAGTACCGACACACCAGACCAAAAGATTGGAAATCCGCCGTCAACCCTATCGTAATCGATCCGCGGCGGTATTAC
CGAGAAAAGGCGGGAGGCAAGGAAGGCTGGAAGGCAATCCTTCAACATACTCAGTATGTCGCACGCCTACTTCAG
GGCAAGATCAAAGAGTCCGACCTACCCAAAGCTGCGCCGGGGCTATCTGACGTTCGGGAGTTCCACATGCTTCTC
GCGATGCACATCGGCAACAGATTTGCCGACTGGAAACAGATCCGCGGATCCAAGGTTGGCTACATCCACGAGGAC
TTTGAAAAAGACGAGGACGCCCTCCTCGACGCCCTCTATAGCCTTCCGGAACCCGGGGAAGAGGAGGAAGAGGGG
GAAGAGGAGGAGGAGGAGGAGGGCGTGGCGGAGGATGAGCCGATGGCCAAAGACCTCCCCCAATTCCAGGGCGGC
GACTGTCACCAGGGGGACAAGGCCATCGAGTGCGGAGGCGGACTGACGGTCAAGGCCTATCACGAAGCGGAAAAG
GCCTGCTCCGGCTTCTGGGACCCGGAAGCCGGCAAGTGCCGGGCCAAGGCCAGCGACCTGCCGGAATTCGAGGGC
CACGAGTGCCGCAAGGGCGACAAGGTCATCGAGTGCGGCGGCGGGCTCGACGTCATGGCCTTCGTCAACGCGCAG
AGTCACTGCCGCGGCTTCTGGGACCCCGAGAGCGGCACGTGTCGCGAGAAGGCCAAGGACCTCCCCGAGTTCGAG
GGCAGGGAGTGCCGTCGGGACGACGTCGTCGTCGACTGCGGCGGCGGCCTCGAGCTGATGGACTACATTGACAAG
CAGAAGGCGTGCACCGGTGCCTGGAACCCGGATCTGGCCGTGTGTGGGGAAGAGAAGTGA
Transcript >Hirsu2|2503
ATGCCGACGGATCTGGGGCCGGCCAAGCAAGCGAACCCCAAACTAGCGGCCCTGGCCGAGAGCATGTCGGACAAA
GAATTCGCAAGGCTCGCGCGCAACAACGGACTGGCTTCCATCGCCGAGAAGAGGTGGAAGATGGCCCTTCCCGAC
GTGCGCGCCGTGGCCCTGAGCCACAAGAAACTCTCGACCGCGTCGGCCAAGCTGAGCCCGAAAGGCGTGGCGCTC
AAGGTAGGCGGCGGCGGCCTGAACGTGGCCGGCGTCGGCCTCTGGATCAAGGGCGTAGTGGACGTCTTCACGACC
GAGTCGAGCGACTGGGACAAGGCGGCCGCCGTTACGGCCATCATCCCCTTCGTAGGCTGTGGCACGAACGCGGCG
GCGCAGGCCGAGCACAAGGGCGGCGTCGATGCATTGCTCGTGCTGGACACGAGCCTGTGCCTCTTGGCCGATGCG
CTGTTACTCGGTACCGCTACTGCTCCGCTGGGCATCGTCTTGCACCTCGTCCGATTTCTAATCCAGCTCTTCGAG
CCGCCCAAGGCCCTACCTTCGTTCGGCGAAATCAAAGCCATGCGCGATAAGCCCTGGCAGAGCTTCCTCGACCAG
CACCTGACCGACTTCCTCGCCTCCAAGGCCTGGCGCGACAAGCTCGAGGGCGCCATCGCCGTGGAGGCCCTGGGC
ATCCTGTCCCAAGCCGCCGAGACGATAGGTCTACTGGAGGCGGGTGGCCAGTTTGCCATCAACGCGTCCGCCCAA
GATACGGAGGCTGCCCCTGGCCAGCTTCAGAAGCAGGTCGGTGGCCAGTCTGCCGTATACCCGTCCGCCGAAGCG
ATAGAGGCCGCCCCTGGCCGGCGGGACTCGAGCCGGCTCCAGAACAAGGTCCAGGCGGCCGTTGCTCAGGTCCGA
GCAAAGATGACGGCCGAGATAGTACGGCGGCAACGCCAGTACCTACTGACGCTCCCTACCTTACTACGCGACGAC
TTCGGCGCTTCGATGAGGGAGACAGCCCGACGATATAATGAGGATTTTATCCAGAAGCTCCAGTCGGACGAAATG
ATTGAGAGATACCCGTCTCACCCGCAGATTTCAGCCTGGGCCGTCTCCGATGATTCGCTATATAAGCCTGCCCGT
ACGCTGATGATCGATGCCGGCAACAGACTACGGCTTAGTCCGCCAGAACTGCCTAGCCTCTTCACCCTCTCCTAC
TTCGTAGGCGTCGCGGCCGGAGTCGACGATCCACCGCCGCGGAGGATCGTCCGGCCCAACCAGCCGGGATATGCA
AAGTACCGACACACCAGACCAAAAGATTGGAAATCCGCCGTCAACCCTATCGTAATCGATCCGCGGCGGTATTAC
CGAGAAAAGGCGGGAGGCAAGGAAGGCTGGAAGGCAATCCTTCAACATACTCAGTATGTCGCACGCCTACTTCAG
GGCAAGATCAAAGAGTCCGACCTACCCAAAGCTGCGCCGGGGCTATCTGACGTTCGGGAGTTCCACATGCTTCTC
GCGATGCACATCGGCAACAGATTTGCCGACTGGAAACAGATCCGCGGATCCAAGGTTGGCTACATCCACGAGGAC
TTTGAAAAAGACGAGGACGCCCTCCTCGACGCCCTCTATAGCCTTCCGGAACCCGGGGAAGAGGAGGAAGAGGGG
GAAGAGGAGGAGGAGGAGGAGGGCGTGGCGGAGGATGAGCCGATGGCCAAAGACCTCCCCCAATTCCAGGGCGGC
GACTGTCACCAGGGGGACAAGGCCATCGAGTGCGGAGGCGGACTGACGGTCAAGGCCTATCACGAAGCGGAAAAG
GCCTGCTCCGGCTTCTGGGACCCGGAAGCCGGCAAGTGCCGGGCCAAGGCCAGCGACCTGCCGGAATTCGAGGGC
CACGAGTGCCGCAAGGGCGACAAGGTCATCGAGTGCGGCGGCGGGCTCGACGTCATGGCCTTCGTCAACGCGCAG
AGTCACTGCCGCGGCTTCTGGGACCCCGAGAGCGGCACGTGTCGCGAGAAGGCCAAGGACCTCCCCGAGTTCGAG
GGCAGGGAGTGCCGTCGGGACGACGTCGTCGTCGACTGCGGCGGCGGCCTCGAGCTGATGGACTACATTGACAAG
CAGAAGGCGTGCACCGGTGCCTGGAACCCGGATCTGGCCGTGTGTGGGGAAGAGAAGTGA
Gene >Hirsu2|2503
ATGCCGACGGATCTGGGGCCGGCCAAGCAAGCGAACCCCAAACTAGCGGCCCTGGCCGAGAGCATGTCGGACAAA
GAATTCGCAAGGCTCGCGCGCAACAACGGACTGGCTTCCATCGCCGAGAAGAGGTGGAAGATGGCCCTTCCCGAC
GTGCGCGCCGTGGCCCTGAGCCACAAGAAACTCTCGACCGCGTCGGCCAAGCTGAGCCCGAAAGGCGTGGCGCTC
AAGGTAGGCGGCGGCGGCCTGAACGTGGCCGGCGTCGGCCTCTGGATCAAGGGCGTAGTGGACGTCTTCACGACC
GAGTCGAGCGACTGGGACAAGGCGGCCGCCGTTACGGCCATCATCCCCTTCGTAGGCTGTGGCACGAACGCGGCG
GCGCAGGCCGAGCACAAGGGCGGCGTCGATGCATTGCTCGTGCTGGACACGAGCCTGTGCCTCTTGGCCGATGCG
CTGTTACTCGGTACCGCTACTGCTCCGCTGGGCATCGTCTTGCACCTCGTCCGATTTCTAATCCAGCTCTTCGAG
CCGCCCAAGGCCCTACCTTCGTTCGGCGAAATCAAAGCCATGCGCGATAAGCCCTGGCAGAGCTTCCTCGACCAG
CACCTGACCGACTTCCTCGCCTCCAAGGCCTGGCGCGACAAGCTCGAGGGCGCCATCGCCGTGGAGGCCCTGGGC
ATCCTGTCCCAAGCCGCCGAGACGATAGGTCTACTGGAGGCGGGTGGCCAGTTTGCCATCAACGCGTCCGCCCAA
GATACGGAGGCTGCCCCTGGCCAGCTTCAGAAGCAGGTCGGTGGCCAGTCTGCCGTATACCCGTCCGCCGAAGCG
ATAGAGGCCGCCCCTGGCCGGCGGGACTCGAGCCGGCTCCAGAACAAGGTCCAGGCGGCCGTTGCTCAGGTCCGA
GCAAAGATGACGGCCGAGATAGTACGGCGGCAACGCCAGTACCTACTGACGCTCCCTACCTTACTACGCGACGAC
TTCGGCGCTTCGATGAGGGAGACAGCCCGACGATATAATGAGGATTTTATCCAGAAGCTCCAGTCGGACGAAATG
ATTGAGAGATACCCGTCTCACCCGCAGATTTCAGCCTGGGCCGTCTCCGATGATTCGCTATATAAGCCTGCCCGT
ACGCTGATGATCGATGCCGGCAACAGACTACGGCTTAGTCCGCCAGAACTGCCTAGCCTCTTCACCCTCTCCTAC
TTCGTAGGCGTCGCGGCCGGAGTCGACGATCCACCGCCGCGGAGGATCGTCCGGCCCAACCAGCCGGGATATGCA
AAGTACCGACACACCAGACCAAAAGATTGGAAATCCGCCGTCAACCCTATCGTAATCGATCCGCGGCGGTATTAC
CGAGAAAAGGCGGGAGGCAAGGAAGGCTGGAAGGCAATCCTTCAACATACTCAGTATGTCGCACGCCTACTTCAG
GGCAAGATCAAAGAGTCCGACCTACCCAAAGCTGCGCCGGGGCTATCTGACGTTCGGGAGTTCCACATGCTTCTC
GCGATGCACATCGGCAACAGATTTGCCGACTGGAAACAGATCCGCGGATCCAAGGTTGGCTACATCCACGAGGAC
TTTGAAAAAGACGAGGACGCCCTCCTCGACGCCCTCTATAGCCTTCCGGAACCCGGGGAAGAGGAGGAAGAGGGG
GAAGAGGAGGAGGAGGAGGAGGGCGTGGCGGAGGATGAGCCGATGGCCAAAGACCTCCCCCAATTCCAGGGCGGC
GACTGTCACCAGGGGGACAAGGCCATCGAGTGCGGAGGCGGACTGACGGTCAAGGCCTATCACGAAGCGGAAAAG
GCCTGCTCCGGCTTCTGGGACCCGGAAGCCGGCAAGTGCCGGGCCAAGGCCAGCGACCTGCCGGAATTCGAGGGC
CACGAGTGCCGCAAGGGCGACAAGGTCATCGAGTGCGGCGGCGGGCTCGACGTCATGGCCTTCGTCAACGCGCAG
AGTCACTGCCGCGGCTTCTGGGACCCCGAGAGCGGCACGTGTCGCGAGAAGGCCAAGGACCTCCCCGAGTTCGAG
GGCAGGGAGTGCCGTCGGGACGACGTCGTCGTCGACTGCGGCGGCGGCCTCGAGCTGATGGACTACATTGACAAG
CAGAAGGCGTGCACCGGTGCCTGGAACCCGGATCTGGCCGTGTGTGGGGAAGAGAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail