Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2500
Gene name
LocationContig_16:45239..46104
Strand-
Gene length (bp)865
Transcript length (bp)351
Coding sequence length (bp)351
Protein length (aa) 117

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00957 Synaptobrevin Synaptobrevin 3.4E-33 26 111

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33328|SNC2_YEAST Synaptobrevin homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNC2 PE=1 SV=2 7 97 1.0E-41
sp|Q92356|SYB1_SCHPO Synaptobrevin homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syb1 PE=3 SV=1 7 93 4.0E-40
sp|P31109|SNC1_YEAST Synaptobrevin homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNC1 PE=1 SV=1 7 95 4.0E-37
sp|O70480|VAMP4_MOUSE Vesicle-associated membrane protein 4 OS=Mus musculus GN=Vamp4 PE=1 SV=1 11 93 2.0E-14
sp|O75379|VAMP4_HUMAN Vesicle-associated membrane protein 4 OS=Homo sapiens GN=VAMP4 PE=1 SV=2 11 93 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33328|SNC2_YEAST Synaptobrevin homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNC2 PE=1 SV=2 7 97 1.0E-41
sp|Q92356|SYB1_SCHPO Synaptobrevin homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syb1 PE=3 SV=1 7 93 4.0E-40
sp|P31109|SNC1_YEAST Synaptobrevin homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNC1 PE=1 SV=1 7 95 4.0E-37
sp|O70480|VAMP4_MOUSE Vesicle-associated membrane protein 4 OS=Mus musculus GN=Vamp4 PE=1 SV=1 11 93 2.0E-14
sp|O75379|VAMP4_HUMAN Vesicle-associated membrane protein 4 OS=Homo sapiens GN=VAMP4 PE=1 SV=2 11 93 2.0E-14
sp|Q32L97|VAMP4_BOVIN Vesicle-associated membrane protein 4 OS=Bos taurus GN=VAMP4 PE=2 SV=1 11 96 2.0E-14
sp|P18489|SYB_DROME Synaptobrevin OS=Drosophila melanogaster GN=Syb PE=2 SV=3 5 112 3.0E-14
sp|Q9M376|VA727_ARATH Vesicle-associated membrane protein 727 OS=Arabidopsis thaliana GN=VAMP727 PE=2 SV=1 27 108 3.0E-14
sp|Q60WU2|SYB1_CAEBR Synaptobrevin-1 OS=Caenorhabditis briggsae GN=snb-1 PE=3 SV=1 15 98 4.0E-14
sp|P13701|SYB_TORCA Synaptobrevin OS=Torpedo californica PE=2 SV=1 10 96 2.0E-13
sp|P63025|VAMP3_RAT Vesicle-associated membrane protein 3 OS=Rattus norvegicus GN=Vamp3 PE=1 SV=1 12 92 5.0E-13
sp|P63024|VAMP3_MOUSE Vesicle-associated membrane protein 3 OS=Mus musculus GN=Vamp3 PE=1 SV=1 12 92 5.0E-13
sp|O70404|VAMP8_MOUSE Vesicle-associated membrane protein 8 OS=Mus musculus GN=Vamp8 PE=1 SV=1 22 92 9.0E-13
sp|Q9WUF4|VAMP8_RAT Vesicle-associated membrane protein 8 OS=Rattus norvegicus GN=Vamp8 PE=1 SV=1 22 92 1.0E-12
sp|Q54GB3|SYBB_DICDI Synaptobrevin-B OS=Dictyostelium discoideum GN=sybB PE=3 SV=1 22 113 2.0E-12
sp|P63026|VAMP2_BOVIN Vesicle-associated membrane protein 2 OS=Bos taurus GN=VAMP2 PE=1 SV=2 25 96 3.0E-12
sp|P63045|VAMP2_RAT Vesicle-associated membrane protein 2 OS=Rattus norvegicus GN=Vamp2 PE=1 SV=2 25 96 3.0E-12
sp|P63044|VAMP2_MOUSE Vesicle-associated membrane protein 2 OS=Mus musculus GN=Vamp2 PE=1 SV=2 25 96 3.0E-12
sp|Q9N0Y0|VAMP2_MACMU Vesicle-associated membrane protein 2 OS=Macaca mulatta GN=VAMP2 PE=3 SV=3 25 96 3.0E-12
sp|P63027|VAMP2_HUMAN Vesicle-associated membrane protein 2 OS=Homo sapiens GN=VAMP2 PE=1 SV=3 25 96 3.0E-12
sp|P47193|VAMP2_XENLA Vesicle-associated membrane protein 2 OS=Xenopus laevis GN=vamp2 PE=3 SV=3 25 100 3.0E-12
sp|Q12255|NYV1_YEAST Vacuolar v-SNARE NYV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NYV1 PE=1 SV=2 14 105 4.0E-12
sp|O02495|SYB1_CAEEL Synaptobrevin-1 OS=Caenorhabditis elegans GN=snb-1 PE=1 SV=1 25 98 4.0E-12
sp|O48850|VA725_ARATH Vesicle-associated membrane protein 725 OS=Arabidopsis thaliana GN=VAMP725 PE=2 SV=2 27 93 5.0E-12
sp|Q5REQ5|VAMP8_PONAB Vesicle-associated membrane protein 8 OS=Pongo abelii GN=VAMP8 PE=3 SV=1 24 92 6.0E-12
sp|Q9BV40|VAMP8_HUMAN Vesicle-associated membrane protein 8 OS=Homo sapiens GN=VAMP8 PE=1 SV=1 24 92 6.0E-12
sp|Q9MAS5|VA726_ARATH Putative vesicle-associated membrane protein 726 OS=Arabidopsis thaliana GN=VAMP726 PE=2 SV=2 27 94 8.0E-12
sp|P47192|VA722_ARATH Vesicle-associated membrane protein 722 OS=Arabidopsis thaliana GN=VAMP722 PE=2 SV=2 27 93 8.0E-12
sp|Q9LFP1|VA713_ARATH Vesicle-associated membrane protein 713 OS=Arabidopsis thaliana GN=VAMP713 PE=2 SV=1 28 109 2.0E-11
sp|Q9ZTW3|VA721_ARATH Vesicle-associated membrane protein 721 OS=Arabidopsis thaliana GN=VAMP721 PE=1 SV=1 27 93 2.0E-11
sp|Q0V7N0|VAMP1_BOVIN Vesicle-associated membrane protein 1 OS=Bos taurus GN=VAMP1 PE=3 SV=2 25 96 2.0E-11
sp|Q62442|VAMP1_MOUSE Vesicle-associated membrane protein 1 OS=Mus musculus GN=Vamp1 PE=1 SV=1 25 96 2.0E-11
sp|Q15836|VAMP3_HUMAN Vesicle-associated membrane protein 3 OS=Homo sapiens GN=VAMP3 PE=1 SV=3 18 92 2.0E-11
sp|Q63666|VAMP1_RAT Vesicle-associated membrane protein 1 OS=Rattus norvegicus GN=Vamp1 PE=1 SV=2 25 96 2.0E-11
sp|Q4R8T0|VAMP3_MACFA Vesicle-associated membrane protein 3 OS=Macaca fascicularis GN=VAMP3 PE=3 SV=1 18 92 2.0E-11
sp|Q3T0Y8|VAMP8_BOVIN Vesicle-associated membrane protein 8 OS=Bos taurus GN=VAMP8 PE=3 SV=1 22 92 3.0E-11
sp|P23763|VAMP1_HUMAN Vesicle-associated membrane protein 1 OS=Homo sapiens GN=VAMP1 PE=1 SV=1 25 96 7.0E-11
sp|Q9FMR5|VA714_ARATH Vesicle-associated membrane protein 714 OS=Arabidopsis thaliana GN=VAMP714 PE=1 SV=1 32 108 1.0E-10
sp|O23429|VA724_ARATH Vesicle-associated membrane protein 724 OS=Arabidopsis thaliana GN=VAMP724 PE=2 SV=2 32 93 4.0E-10
sp|P47194|SYB_DORPE Synaptobrevin OS=Doryteuthis pealeii PE=1 SV=1 28 96 6.0E-10
sp|Q2KJD2|VAMP3_BOVIN Vesicle-associated membrane protein 3 OS=Bos taurus GN=VAMP3 PE=3 SV=1 28 92 1.0E-09
sp|O49377|VA711_ARATH Vesicle-associated membrane protein 711 OS=Arabidopsis thaliana GN=VAMP711 PE=1 SV=2 28 91 2.0E-09
sp|Q27236|SYBL_SCHMA Synaptobrevin-like protein OS=Schistosoma mansoni PE=2 SV=1 26 92 3.0E-09
sp|Q5RF94|VAMP7_PONAB Vesicle-associated membrane protein 7 OS=Pongo abelii GN=VAMP7 PE=2 SV=3 33 92 8.0E-09
sp|P51809|VAMP7_HUMAN Vesicle-associated membrane protein 7 OS=Homo sapiens GN=VAMP7 PE=1 SV=3 33 92 8.0E-09
sp|Q17QI5|VAMP7_BOVIN Vesicle-associated membrane protein 7 OS=Bos taurus GN=VAMP7 PE=2 SV=1 33 92 8.0E-09
sp|Q5ZL74|VAMP7_CHICK Vesicle-associated membrane protein 7 OS=Gallus gallus GN=VAMP7 PE=2 SV=1 12 92 9.0E-09
sp|Q9JHW5|VAMP7_RAT Vesicle-associated membrane protein 7 OS=Rattus norvegicus GN=Vamp7 PE=1 SV=1 28 92 9.0E-09
sp|P70280|VAMP7_MOUSE Vesicle-associated membrane protein 7 OS=Mus musculus GN=Vamp7 PE=1 SV=1 33 92 1.0E-08
sp|Q54NW7|VAM7A_DICDI Vesicle-associated membrane protein 7A OS=Dictyostelium discoideum GN=vamp7A PE=1 SV=1 6 109 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0016192 vesicle-mediated transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

Domain # Start End Length
1 92 114 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2500
MPEQDAPYDPYIPSGQAGAQQGAGGNARTQALQAQIDDTVGVMRDNINKVSQRGERLDALQDKTDNLAVSAQGFR
RGANRVRKQMWWKDMKMRMCLIAGIIILLLIIIIPTVVATR*
Coding >Hirsu2|2500
ATGCCTGAGCAGGACGCCCCGTACGATCCCTACATCCCCAGCGGCCAGGCCGGCGCGCAACAAGGTGCCGGCGGC
AATGCCAGGACCCAGGCTCTCCAAGCGCAAATCGACGACACCGTCGGTGTGATGCGCGACAACATCAACAAGGTC
TCCCAGCGCGGCGAACGTCTGGATGCGCTCCAGGATAAGACGGACAATTTGGCCGTTTCGGCCCAGGGATTTCGT
CGTGGTGCCAACCGGGTCCGCAAGCAGATGTGGTGGAAGGACATGAAGATGCGCATGTGCCTGATCGCGGGCATC
ATCATCCTACTACTCATCATCATCATCCCCACCGTCGTCGCTACCCGTTAA
Transcript >Hirsu2|2500
ATGCCTGAGCAGGACGCCCCGTACGATCCCTACATCCCCAGCGGCCAGGCCGGCGCGCAACAAGGTGCCGGCGGC
AATGCCAGGACCCAGGCTCTCCAAGCGCAAATCGACGACACCGTCGGTGTGATGCGCGACAACATCAACAAGGTC
TCCCAGCGCGGCGAACGTCTGGATGCGCTCCAGGATAAGACGGACAATTTGGCCGTTTCGGCCCAGGGATTTCGT
CGTGGTGCCAACCGGGTCCGCAAGCAGATGTGGTGGAAGGACATGAAGATGCGCATGTGCCTGATCGCGGGCATC
ATCATCCTACTACTCATCATCATCATCCCCACCGTCGTCGCTACCCGTTAA
Gene >Hirsu2|2500
ATGCCTGAGCAGGACGCCCCGTACGATCCCTACATCCCCAGCGGCCAGGCCGGCGCGCAACAAGGTGCCGGCGGC
AATGCCAGGACCCAGGCTCTCCAAGCGGTAGGTCTCTCGTGCCACCTTGTCCCCCCGTCCATGGTTTTCGCCATG
TGCTCTACCGGATGGTCCTGCACCAACGCCGCCGACCGTCTCGGGGACGCCTGCGGGAACGCCTGCACAAGGGCT
CGCAGAGCCGCGGGCTCTCGCCGTGACAGCCTTGCGACAACGACCAGTGGATCGTTTGCCGATTCCTCAGGCGAG
AGGGGAATTTTTTTTGGGTCGTCGCGCGGATGGTGGTTGAGGAGGAGAAGGATGAGAACAGACAATGCGACAGTC
TGAGTCGACACAGGAGACCCAAGTCGACTGGACGGCTGTCCTTACGATTCTGATGATTTTCCTTGTCCAAATGGG
GTGATGCATGCCCAACGAGCCACACACGCGCGGTGAAACGCTGTTCAGCAACGATGCGCGCAAACAGACTACGGC
AGCGGACGCTGATGCTGACGTGTTCTGTGTAGCAAATCGACGACACCGTCGGTGTGATGCGCGACAACATCAACA
AGGTCTCCCAGCGCGGCGAACGTCTGGATGCGCTCCAGGATAAGACGGACAATTTGGCCGTTTCGGCCCAGGGAT
TTCGTCGTGGTGCCAACCGGGTCCGCAAGCAGATGTGGTGGAAGGACATGAAGATGCGCATGTGCCTGATCGCGG
GCATCATCATCCTACTACTCATCATCATCATCCCCACCGGTGAGGATGCTCCGTCCCCTTGTCCCGCCGTCGAGC
GGTCGCTAATGCCTCCGCCGCAGTCGTCGCTACCCGTTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail