Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|25
Gene name
LocationContig_10:69986..73373
Strand+
Gene length (bp)3387
Transcript length (bp)3093
Coding sequence length (bp)3093
Protein length (aa) 1031

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14765 PS-DH Polyketide synthase dehydratase 5.3E-63 133 413
PF08242 Methyltransf_12 Methyltransferase domain 4.7E-18 598 703
PF13489 Methyltransf_23 Methyltransferase domain 3.5E-10 589 752
PF13649 Methyltransf_25 Methyltransferase domain 1.5E-09 597 701
PF08241 Methyltransf_11 Methyltransferase domain 3.3E-08 598 704
PF13847 Methyltransf_31 Methyltransferase domain 1.7E-08 594 709

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 5 1010 1.0E-69
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1 915 1.0E-68
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1 915 2.0E-68
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 30 885 8.0E-61
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 588 837 3.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 5 1010 1.0E-69
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1 915 1.0E-68
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1 915 2.0E-68
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 30 885 8.0E-61
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 588 837 3.0E-19
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 22 357 4.0E-18
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 517 753 2.0E-15
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 595 744 7.0E-15
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 595 744 1.0E-14
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 595 744 1.0E-14
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 595 753 1.0E-14
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 595 744 2.0E-14
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 595 744 2.0E-14
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 595 744 3.0E-14
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 595 744 3.0E-14
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 6 334 6.0E-14
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 6 334 6.0E-14
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 6 334 6.0E-14
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 6 334 6.0E-14
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 594 753 2.0E-13
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 595 744 3.0E-13
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 6 334 4.0E-13
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 595 744 7.0E-13
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 595 816 3.0E-11
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 595 753 4.0E-11
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 7 334 6.0E-11
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 7 334 6.0E-11
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 7 334 6.0E-11
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 595 775 6.0E-11
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 6 360 6.0E-11
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 595 775 1.0E-10
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 595 749 2.0E-10
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 595 748 3.0E-10
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 595 753 3.0E-10
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 9 340 7.0E-10
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 598 910 2.0E-09
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 598 910 4.0E-09
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 7 340 4.0E-09
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 652 760 4.0E-07
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 160 362 6.0E-07
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 598 803 1.0E-06
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 598 795 2.0E-06
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 598 764 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|25
MKDIASPEIPFYSAVTGRRLTKDMDLGPAYWRKNLENPVLFNTAFRSALSGEDRRLVLIEIGAHPALKAPVIQIL
RDLGRNEDVHVGTLHRGEGCDESLLHLAGKLFQQGQGTASLAGPRQADEWRFREHAPHELLGSRAFEVSHEPIWR
NKLSLTHVPWLSGHRIDGQILLPGTAYVAMVGEAIRQLHGARAYKMRNVEFAAGLEIAHDKEVEVVTSMATGNAD
DMESSWCAFRINAFDGERWVKHCTGEARLSSDDSEDPPPAHKPPALARTVDEADWYRVLRRAGYNYTDRFQGLRN
ISSAPEKDEATATIPVQDAADYAIHPVVMDQCIQLFTVAACRGLGRRLRSVSVPTFIREVTVRHAAANEDLSATA
SIGPSEGSSLVGDLTARIGRETIFSVEGLKMVTIARAETAEESLPLISQIEWRPHADFIDFDALKYVPPCLDRQK
YVSLAELVTLCMIDHREKLQVADEAPPHLSNYLAWMEEFVRHYESGSNAFLADCPRLCDMTRTERLARMEAIVAD
GETSPFAVAFTAIWRMYNAAEAIFAGSTHPLHVLQQDNLNSAVYGLVLDMQSATNADDMILIIAHTNPRLRILEV
GAGTGASSERLLEKLHSSYGERLYGSYTFTDISTGFMREARERLARFDSVDYQVLDISKDPTEQGFRQQEYDLIV
AHNVLRATPYLRETLGHLKGLLRPEGRLYLLELCQEMKYINYIYGFLEGWWLGAEDGRADEPYITPERWSEELVA
AGFLKPDVSIPDCVAPYQTCASILASADTRTSKPSRVGLLCYGPRGPYVEEVRESLASLGIAVDTCILGQPLPGQ
DVISLLELEKPLVDDLCEESFRSLIGHMRELDGRLIWATRPSQVGCQDPRYSLILGLARSARKEFSVKLYTVEID
DSSSASAAGALARILLHVRRPERVSDSMQPDWEYGVVNDEVLIPRFHGQTISDALSQPEEDRPGRPPTMQRLTLD
TPGLLQNMRWSEVEREIPGHGQALLRMEAVGLNFRVSACHSPRLPFSNGSLTIER*
Coding >Hirsu2|25
ATGAAGGACATCGCCTCTCCCGAGATCCCGTTCTACTCCGCCGTGACTGGCCGCAGGCTGACCAAGGATATGGAC
CTCGGCCCGGCGTATTGGCGCAAGAATCTCGAAAACCCCGTTCTCTTTAACACGGCCTTTCGGTCAGCCCTCTCC
GGAGAAGACAGGCGGTTGGTGCTCATCGAGATCGGAGCCCACCCGGCACTCAAGGCTCCGGTGATCCAGATCCTG
AGAGACCTCGGCCGGAATGAGGACGTCCACGTCGGCACTCTACACAGGGGCGAAGGCTGCGACGAGAGTCTCCTC
CACCTCGCGGGCAAGCTGTTCCAGCAGGGCCAAGGCACGGCCTCCCTGGCGGGGCCGCGGCAGGCAGACGAGTGG
AGGTTTCGCGAACACGCGCCGCACGAGCTTCTCGGCTCGAGAGCCTTCGAGGTTTCCCACGAGCCGATTTGGAGA
AACAAGCTTTCGCTGACGCACGTGCCGTGGTTGTCCGGACACAGGATTGACGGCCAGATCTTGCTGCCGGGCACT
GCTTACGTCGCCATGGTCGGGGAGGCCATTCGACAGCTGCATGGGGCCCGCGCGTACAAGATGAGAAATGTCGAG
TTTGCTGCCGGGCTGGAGATTGCGCACGACAAGGAGGTGGAGGTCGTCACCTCGATGGCGACGGGCAACGCGGAC
GACATGGAGTCGTCCTGGTGTGCCTTTAGAATCAACGCCTTCGACGGGGAGAGATGGGTTAAGCACTGCACCGGT
GAAGCAAGACTGTCCTCGGACGACTCGGAGGATCCCCCGCCGGCGCACAAGCCGCCTGCCCTCGCGCGGACGGTC
GATGAGGCCGACTGGTACAGAGTCCTGCGTCGCGCCGGTTACAACTATACCGACCGCTTCCAGGGCCTGCGAAAC
ATCTCGTCCGCCCCGGAGAAGGATGAGGCCACGGCGACCATCCCCGTGCAGGACGCGGCCGATTACGCGATCCAT
CCCGTCGTCATGGATCAGTGCATCCAGCTGTTCACAGTCGCCGCCTGCCGCGGGCTGGGACGGAGACTCCGCAGC
GTGTCGGTCCCAACCTTCATCCGTGAGGTGACGGTTCGGCACGCTGCGGCGAACGAGGACTTGAGCGCAACGGCC
AGCATTGGCCCCTCCGAGGGGAGCTCCCTTGTAGGCGACCTGACGGCACGGATCGGCCGCGAGACGATCTTCTCC
GTCGAGGGGTTGAAGATGGTCACCATTGCCAGGGCGGAGACGGCGGAAGAGAGCCTGCCGCTGATCTCGCAGATC
GAATGGAGGCCTCACGCCGACTTCATCGACTTTGATGCCCTCAAGTATGTTCCACCGTGCCTCGATCGGCAGAAA
TATGTCTCGTTGGCGGAGCTGGTAACTCTCTGCATGATTGACCACCGGGAAAAGTTGCAGGTGGCGGACGAGGCG
CCGCCTCATCTTTCCAACTACCTAGCCTGGATGGAAGAGTTTGTCCGGCACTATGAGTCGGGGTCGAACGCGTTC
TTGGCTGATTGCCCTCGGCTGTGCGACATGACTAGGACGGAGAGGCTGGCCAGGATGGAGGCGATTGTCGCCGAC
GGGGAAACCTCTCCCTTCGCTGTGGCGTTCACGGCAATCTGGCGCATGTACAATGCTGCGGAAGCCATATTCGCA
GGTTCCACTCACCCGCTTCACGTCCTTCAACAGGACAATCTCAATTCCGCCGTATACGGCCTCGTTCTCGATATG
CAAAGCGCTACCAACGCCGACGACATGATTCTTATCATCGCACACACGAACCCCCGGCTCAGAATCCTCGAAGTT
GGTGCCGGCACTGGCGCGTCATCCGAGAGGTTGTTGGAAAAACTCCACTCCTCCTACGGCGAGCGGCTCTATGGC
TCCTACACGTTCACCGATATCTCGACCGGATTCATGCGGGAGGCCCGGGAGCGCCTCGCCCGGTTCGACAGCGTC
GATTACCAAGTGCTCGACATAAGCAAAGATCCCACGGAGCAAGGGTTTCGACAGCAGGAATATGACCTCATCGTT
GCACACAACGTGCTCCGTGCTACCCCATACCTGCGCGAGACCCTTGGCCACCTGAAAGGCTTGCTCCGCCCTGAA
GGGCGGCTGTACCTGTTGGAGCTGTGTCAGGAGATGAAATATATAAACTACATATACGGATTTCTGGAAGGGTGG
TGGCTTGGAGCCGAAGACGGCAGAGCCGACGAGCCTTACATCACGCCTGAGCGGTGGTCGGAAGAGCTGGTCGCG
GCTGGTTTCCTGAAGCCGGATGTCTCGATTCCGGACTGCGTTGCTCCGTATCAAACCTGCGCGTCGATCCTTGCA
TCGGCCGACACCAGGACCAGCAAACCGTCGAGGGTCGGCTTGCTGTGCTATGGCCCTCGGGGGCCGTACGTGGAG
GAAGTGCGGGAAAGCCTCGCCTCTCTGGGCATCGCTGTCGATACCTGCATCTTGGGGCAGCCCCTGCCTGGCCAG
GATGTCATATCTCTCCTCGAGCTGGAGAAGCCCTTGGTCGACGACTTGTGCGAGGAGTCCTTCCGGTCACTAATC
GGCCATATGCGAGAACTCGACGGGAGGCTGATATGGGCGACCCGGCCCTCTCAGGTCGGCTGCCAGGACCCGAGA
TACTCCCTGATCCTGGGTCTCGCCAGATCGGCCCGAAAGGAGTTTTCGGTGAAGCTGTATACGGTTGAAATCGAC
GACAGCAGCAGCGCTAGCGCAGCCGGGGCGCTGGCGAGGATCCTGCTCCACGTTCGGAGGCCTGAGCGGGTCTCT
GACTCGATGCAGCCGGACTGGGAGTATGGCGTCGTCAATGACGAGGTGCTCATCCCCAGGTTCCACGGGCAGACC
ATATCGGACGCCTTATCACAGCCGGAGGAGGACCGGCCCGGCCGGCCGCCGACGATGCAGCGCCTAACCCTCGAC
ACGCCAGGGTTATTGCAGAATATGAGATGGAGCGAGGTGGAGCGGGAGATTCCCGGCCACGGCCAGGCTCTCCTC
CGGATGGAGGCTGTCGGGCTCAACTTTAGGGTCAGTGCTTGCCATTCGCCCCGACTCCCCTTCTCGAACGGCTCT
CTCACGATCGAGCGGTGA
Transcript >Hirsu2|25
ATGAAGGACATCGCCTCTCCCGAGATCCCGTTCTACTCCGCCGTGACTGGCCGCAGGCTGACCAAGGATATGGAC
CTCGGCCCGGCGTATTGGCGCAAGAATCTCGAAAACCCCGTTCTCTTTAACACGGCCTTTCGGTCAGCCCTCTCC
GGAGAAGACAGGCGGTTGGTGCTCATCGAGATCGGAGCCCACCCGGCACTCAAGGCTCCGGTGATCCAGATCCTG
AGAGACCTCGGCCGGAATGAGGACGTCCACGTCGGCACTCTACACAGGGGCGAAGGCTGCGACGAGAGTCTCCTC
CACCTCGCGGGCAAGCTGTTCCAGCAGGGCCAAGGCACGGCCTCCCTGGCGGGGCCGCGGCAGGCAGACGAGTGG
AGGTTTCGCGAACACGCGCCGCACGAGCTTCTCGGCTCGAGAGCCTTCGAGGTTTCCCACGAGCCGATTTGGAGA
AACAAGCTTTCGCTGACGCACGTGCCGTGGTTGTCCGGACACAGGATTGACGGCCAGATCTTGCTGCCGGGCACT
GCTTACGTCGCCATGGTCGGGGAGGCCATTCGACAGCTGCATGGGGCCCGCGCGTACAAGATGAGAAATGTCGAG
TTTGCTGCCGGGCTGGAGATTGCGCACGACAAGGAGGTGGAGGTCGTCACCTCGATGGCGACGGGCAACGCGGAC
GACATGGAGTCGTCCTGGTGTGCCTTTAGAATCAACGCCTTCGACGGGGAGAGATGGGTTAAGCACTGCACCGGT
GAAGCAAGACTGTCCTCGGACGACTCGGAGGATCCCCCGCCGGCGCACAAGCCGCCTGCCCTCGCGCGGACGGTC
GATGAGGCCGACTGGTACAGAGTCCTGCGTCGCGCCGGTTACAACTATACCGACCGCTTCCAGGGCCTGCGAAAC
ATCTCGTCCGCCCCGGAGAAGGATGAGGCCACGGCGACCATCCCCGTGCAGGACGCGGCCGATTACGCGATCCAT
CCCGTCGTCATGGATCAGTGCATCCAGCTGTTCACAGTCGCCGCCTGCCGCGGGCTGGGACGGAGACTCCGCAGC
GTGTCGGTCCCAACCTTCATCCGTGAGGTGACGGTTCGGCACGCTGCGGCGAACGAGGACTTGAGCGCAACGGCC
AGCATTGGCCCCTCCGAGGGGAGCTCCCTTGTAGGCGACCTGACGGCACGGATCGGCCGCGAGACGATCTTCTCC
GTCGAGGGGTTGAAGATGGTCACCATTGCCAGGGCGGAGACGGCGGAAGAGAGCCTGCCGCTGATCTCGCAGATC
GAATGGAGGCCTCACGCCGACTTCATCGACTTTGATGCCCTCAAGTATGTTCCACCGTGCCTCGATCGGCAGAAA
TATGTCTCGTTGGCGGAGCTGGTAACTCTCTGCATGATTGACCACCGGGAAAAGTTGCAGGTGGCGGACGAGGCG
CCGCCTCATCTTTCCAACTACCTAGCCTGGATGGAAGAGTTTGTCCGGCACTATGAGTCGGGGTCGAACGCGTTC
TTGGCTGATTGCCCTCGGCTGTGCGACATGACTAGGACGGAGAGGCTGGCCAGGATGGAGGCGATTGTCGCCGAC
GGGGAAACCTCTCCCTTCGCTGTGGCGTTCACGGCAATCTGGCGCATGTACAATGCTGCGGAAGCCATATTCGCA
GGTTCCACTCACCCGCTTCACGTCCTTCAACAGGACAATCTCAATTCCGCCGTATACGGCCTCGTTCTCGATATG
CAAAGCGCTACCAACGCCGACGACATGATTCTTATCATCGCACACACGAACCCCCGGCTCAGAATCCTCGAAGTT
GGTGCCGGCACTGGCGCGTCATCCGAGAGGTTGTTGGAAAAACTCCACTCCTCCTACGGCGAGCGGCTCTATGGC
TCCTACACGTTCACCGATATCTCGACCGGATTCATGCGGGAGGCCCGGGAGCGCCTCGCCCGGTTCGACAGCGTC
GATTACCAAGTGCTCGACATAAGCAAAGATCCCACGGAGCAAGGGTTTCGACAGCAGGAATATGACCTCATCGTT
GCACACAACGTGCTCCGTGCTACCCCATACCTGCGCGAGACCCTTGGCCACCTGAAAGGCTTGCTCCGCCCTGAA
GGGCGGCTGTACCTGTTGGAGCTGTGTCAGGAGATGAAATATATAAACTACATATACGGATTTCTGGAAGGGTGG
TGGCTTGGAGCCGAAGACGGCAGAGCCGACGAGCCTTACATCACGCCTGAGCGGTGGTCGGAAGAGCTGGTCGCG
GCTGGTTTCCTGAAGCCGGATGTCTCGATTCCGGACTGCGTTGCTCCGTATCAAACCTGCGCGTCGATCCTTGCA
TCGGCCGACACCAGGACCAGCAAACCGTCGAGGGTCGGCTTGCTGTGCTATGGCCCTCGGGGGCCGTACGTGGAG
GAAGTGCGGGAAAGCCTCGCCTCTCTGGGCATCGCTGTCGATACCTGCATCTTGGGGCAGCCCCTGCCTGGCCAG
GATGTCATATCTCTCCTCGAGCTGGAGAAGCCCTTGGTCGACGACTTGTGCGAGGAGTCCTTCCGGTCACTAATC
GGCCATATGCGAGAACTCGACGGGAGGCTGATATGGGCGACCCGGCCCTCTCAGGTCGGCTGCCAGGACCCGAGA
TACTCCCTGATCCTGGGTCTCGCCAGATCGGCCCGAAAGGAGTTTTCGGTGAAGCTGTATACGGTTGAAATCGAC
GACAGCAGCAGCGCTAGCGCAGCCGGGGCGCTGGCGAGGATCCTGCTCCACGTTCGGAGGCCTGAGCGGGTCTCT
GACTCGATGCAGCCGGACTGGGAGTATGGCGTCGTCAATGACGAGGTGCTCATCCCCAGGTTCCACGGGCAGACC
ATATCGGACGCCTTATCACAGCCGGAGGAGGACCGGCCCGGCCGGCCGCCGACGATGCAGCGCCTAACCCTCGAC
ACGCCAGGGTTATTGCAGAATATGAGATGGAGCGAGGTGGAGCGGGAGATTCCCGGCCACGGCCAGGCTCTCCTC
CGGATGGAGGCTGTCGGGCTCAACTTTAGGGTCAGTGCTTGCCATTCGCCCCGACTCCCCTTCTCGAACGGCTCT
CTCACGATCGAGCGGTGA
Gene >Hirsu2|25
ATGAAGGACATCGCCTCTCCCGAGATCCCGTTCTACTCCGCCGTGACTGGCCGCAGGCTGACCAAGGATATGGAC
CTCGGCCCGGCGTATTGGCGCAAGAATCTCGAAAACCCCGTTCTCTTTAACACGGCCTTTCGGTCAGCCCTCTCC
GGAGAAGACAGGCGGTTGGTGCTCATCGAGATCGGAGCCCACCCGGCACTCAAGGCTCCGGTGATCCAGATCCTG
AGAGACCTCGGCCGGAATGAGGACGTCCACGTCGGCACTCTACACAGGGGCGAAGGCTGCGACGAGAGTCTCCTC
CACCTCGCGGGCAAGCTGTTCCAGCAGGGCGTCAGTCTGGATCACTCAGCCGTATGTCCTGCGGGAAAGCTCGCG
ATCGGGCTTCCTCGGTACTCCTGAAGCAAGGCACGGCCTCCCTGGCGGGGCCGCGGCAGGCAGACGAGTGGAGGT
TTCGCGAACACGCGCCGCACGAGCTTCTCGGCTCGAGAGCCTTCGAGGTTTCCCACGAGCCGATTTGGAGAAACA
AGCTTTCGCTGACGCACGTGCCGTGGTTGTCCGGACACAGGATTGACGGCCAGATCTTGCTGCCGGGCACTGCTT
ACGTCGCCATGGTCGGGGAGGCCATTCGACAGCTGCATGGGGCCCGCGCGTACAAGATGAGAAATGTCGAGTTTG
CTGCCGGGCTGGAGATTGCGCACGACAAGGAGGTGGAGGTCGTCACCTCGATGGCGACGGGCAACGCGGACGACA
TGGAGTCGTCCTGGTGTGCCTTTAGAATCAACGCCTTCGACGGGGAGAGATGGGTTAAGCACTGCACCGGTGAAG
CAAGACTGTCCTCGGACGACTCGGAGGATCCCCCGCCGGCGCACAAGCCGCCTGCCCTCGCGCGGACGGTCGATG
AGGCCGACTGGTACAGAGTCCTGCGTCGCGCCGGTTACAACTATACCGACCGCTTCCAGGGCCTGCGAAACATCT
CGTCCGCCCCGGAGAAGGATGAGGCCACGGCGACCATCCCCGTGCAGGACGCGGCCGATTACGCGATCCATCCCG
TCGTCATGGATCAGTGCATCCAGCTGTTCACAGTCGCCGCCTGCCGCGGGCTGGGACGGAGACTCCGCAGCGTGT
CGGTCCCAACCTTCATCCGTGAGGTGACGGTTCGGCACGCTGCGGCGAACGAGGACTTGAGCGCAACGGCCAGCA
TTGGCCCCTCCGAGGGGAGCTCCCTTGTAGGCGACCTGACGGCACGGATCGGCCGCGAGACGATCTTCTCCGTCG
AGGGGTTGAAGATGGTCACCATTGCCAGGGCGGAGACGGCGGAAGAGAGCCTGCCGCTGATCTCGCAGATCGAAT
GGAGGCCTCACGCCGACTTCATCGACTTTGATGCCCTCAAGTATGTTCCACCGTGCCTCGATCGGCAGAAATATG
TCTCGTTGGCGGAGCTGGTAACTCTCTGCATGATTGACCACCGGGAAAAGTTGCAGGTGGCGGACGAGGCGCCGC
CTCATCTTTCCAACTACCTAGCCTGGATGGAAGAGTTTGTCCGGCACTATGAGTCGGGGTCGAACGCGTTCTTGG
CTGATTGCCCTCGGCTGTGCGACATGACTAGGACGGAGAGGCTGGCCAGGATGGAGGCGATTGTCGCCGACGGGG
AAACCTCTCCCTTCGCTGTGGCGTTCACGGCAATCTGGCGCATGTACAATGCTGCGGAAGCCATATTCGCAGGTT
CCACTCACCCGCTTCACGTCCTTCAACAGGACAATCTCAATTCCGCCGTATACGGCCTCGTTCTCGATATGCAAA
GCGCTACCAACGCCGACGACATGATTCTTATCATCGCACACACGAACCCCCGGCTCAGAATCCTCGAAGTTGGTG
CCGGCACTGGCGCGTCATCCGAGAGGTTGTTGGAAAAACTCCACTCCTCCTACGGCGAGCGGCTCTATGGCTCCT
ACACGTTCACCGATATCTCGACCGGATTCATGCGGGAGGCCCGGGAGCGCCTCGCCCGGTTCGACAGCGTCGATT
ACCAAGTGCTCGACATAAGCAAAGATCCCACGGAGCAAGGGTTTCGACAGCAGGAATATGACCTCATCGTTGCAC
ACAACGTGGGAACCTATCCCCCCTCCCCTTGCCCCCCTTTCAAACGTTGTCCGGATGGCTAATCGTCCGCTACAG
GTGCTCCGTGCTACCCCATACCTGCGCGAGACCCTTGGCCACCTGAAAGGCTTGCTCCGCCCTGAAGGGCGGCTG
TACCTGTTGGAGCTGTGTCAGGGTGAGTGCCGTTTCTCGTTCAAGCTGCTCCGTGGGACATCACGAAGTCGAGCA
GGATGAGACTGACTCCGATCCCGGCATAGAGATGAAATATATAAACTACATATACGTAAGTCTCCTGCGCGCATC
CAGTCGTTCGTTGGCCCAAAGAGGCCTCCGTTGTTAACTGGCGGCCGCCAGGGATTTCTGGAAGGGTGGTGGCTT
GGAGCCGAAGACGGCAGAGCCGACGAGCCTTACATCACGCCTGAGCGGTGGTCGGAAGAGCTGGTCGCGGCTGGT
TTCCTGAAGCCGGATGTCTCGATTCCGGACTGCGTTGCTCCGTATCAAACCTGCGCGTCGATCCTTGCATCGGCC
GACACCAGGACCAGCAAACCGTCGAGGGTCGGCTTGCTGTGCTATGGCCCTCGGGGGCCGTACGTGGAGGAAGTG
CGGGAAAGCCTCGCCTCTCTGGGCATCGCTGTCGATACCTGCATCTTGGGGCAGCCCCTGCCTGGCCAGGATGTC
ATATCTCTCCTCGAGCTGGAGAAGCCCTTGGTCGACGACTTGTGCGAGGAGTCCTTCCGGTCACTAATCGGCCAT
ATGCGAGAACTCGACGGGAGGCTGATATGGGCGACCCGGCCCTCTCAGGTCGGCTGCCAGGACCCGAGATACTCC
CTGATCCTGGGTCTCGCCAGATCGGCCCGAAAGGAGTTTTCGGTGAAGCTGTATACGGTTGAAATCGACGACAGC
AGCAGCGCTAGCGCAGCCGGGGCGCTGGCGAGGATCCTGCTCCACGTTCGGAGGCCTGAGCGGGTCTCTGACTCG
ATGCAGCCGGACTGGGAGTATGGCGTCGTCAATGACGAGGTGCTCATCCCCAGGTTCCACGGGCAGACCATATCG
GACGCCTTATCACAGCCGGAGGAGGACCGGCCCGGCCGGCCGCCGACGATGCAGCGCCTAACCCTCGACACGCCA
GGGTTATTGCAGAATATGAGATGGAGCGAGGTGGAGCGGGAGATTCCCGGCCACGGCCAGGCTCTCCTCCGGATG
GAGGCTGTCGGGCTCAACTTTAGGGTCAGTGCTTGCCATTCGCCCCGACTCCCCTTCTCGAACGGCTCTCTCACG
ATCGAGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail