Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2499
Gene name
LocationContig_16:40020..42758
Strand-
Gene length (bp)2738
Transcript length (bp)2643
Coding sequence length (bp)2643
Protein length (aa) 881

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04768 NAT NAT, N-acetyltransferase, of N-acetylglutamate synthase 1.0E-41 319 474
PF00696 AA_kinase Amino acid kinase family 8.7E-30 88 295
PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain 1.5E-26 563 688

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54898|ARG56_NEUCR Protein arg-6, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-6 PE=1 SV=2 55 880 0.0E+00
sp|P78586|ARG56_CANAX Protein ARG5,6, mitochondrial OS=Candida albicans GN=ARG5,6 PE=3 SV=1 55 879 0.0E+00
sp|P31318|ARG56_SCHPO Protein arg11, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg11 PE=3 SV=2 45 877 0.0E+00
sp|Q01217|ARG56_YEAST Protein ARG5,6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG5,6 PE=1 SV=1 55 878 0.0E+00
sp|Q54M18|ARG56_DICDI Bifunctional protein argC, mitochondrial OS=Dictyostelium discoideum GN=argC PE=1 SV=1 85 877 3.0E-166
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54898|ARG56_NEUCR Protein arg-6, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-6 PE=1 SV=2 55 880 0.0E+00
sp|P78586|ARG56_CANAX Protein ARG5,6, mitochondrial OS=Candida albicans GN=ARG5,6 PE=3 SV=1 55 879 0.0E+00
sp|P31318|ARG56_SCHPO Protein arg11, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg11 PE=3 SV=2 45 877 0.0E+00
sp|Q01217|ARG56_YEAST Protein ARG5,6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG5,6 PE=1 SV=1 55 878 0.0E+00
sp|Q54M18|ARG56_DICDI Bifunctional protein argC, mitochondrial OS=Dictyostelium discoideum GN=argC PE=1 SV=1 85 877 3.0E-166
sp|B2FMD7|ARGC_STRMK N-acetyl-gamma-glutamyl-phosphate reductase OS=Stenotrophomonas maltophilia (strain K279a) GN=argC PE=3 SV=1 564 878 4.0E-104
sp|Q8PK31|ARGC_XANAC N-acetyl-gamma-glutamyl-phosphate reductase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=argC PE=3 SV=1 561 877 1.0E-103
sp|B0RS54|ARGC_XANCB N-acetyl-gamma-glutamyl-phosphate reductase OS=Xanthomonas campestris pv. campestris (strain B100) GN=argC PE=3 SV=1 561 877 3.0E-103
sp|B4SQ93|ARGC_STRM5 N-acetyl-gamma-glutamyl-phosphate reductase OS=Stenotrophomonas maltophilia (strain R551-3) GN=argC PE=3 SV=1 564 878 4.0E-103
sp|Q3BSI7|ARGC_XANC5 N-acetyl-gamma-glutamyl-phosphate reductase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=argC PE=3 SV=1 564 877 4.0E-103
sp|Q2P2F6|ARGC_XANOM N-acetyl-gamma-glutamyl-phosphate reductase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=argC PE=3 SV=1 564 877 2.0E-102
sp|Q8P8J8|ARGC_XANCP N-acetyl-gamma-glutamyl-phosphate reductase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=argC PE=3 SV=1 561 877 1.0E-101
sp|Q4UVI5|ARGC_XANC8 N-acetyl-gamma-glutamyl-phosphate reductase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=argC PE=3 SV=1 561 877 2.0E-101
sp|Q87EL1|ARGC_XYLFT N-acetyl-gamma-glutamyl-phosphate reductase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=argC PE=3 SV=1 564 878 4.0E-101
sp|B2I7K9|ARGC_XYLF2 N-acetyl-gamma-glutamyl-phosphate reductase OS=Xylella fastidiosa (strain M23) GN=argC PE=3 SV=1 564 878 4.0E-101
sp|Q9PEM6|ARGC_XYLFA N-acetyl-gamma-glutamyl-phosphate reductase OS=Xylella fastidiosa (strain 9a5c) GN=argC PE=3 SV=1 564 878 8.0E-101
sp|Q8PK29|ARGB_XANAC Acetylglutamate kinase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=argB PE=3 SV=2 66 474 2.0E-90
sp|Q8P8J6|ARGB_XANCP Acetylglutamate kinase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=argB PE=3 SV=2 66 474 9.0E-89
sp|Q9PEM7|ARGB_XYLFA Acetylglutamate kinase OS=Xylella fastidiosa (strain 9a5c) GN=argB PE=3 SV=2 66 473 3.0E-84
sp|Q87EL2|ARGB_XYLFT Acetylglutamate kinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=argB PE=1 SV=1 66 473 3.0E-83
sp|Q8TWF8|ARGC_METKA N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=argC PE=3 SV=1 564 877 1.0E-45
sp|Q6M102|ARGC_METMP N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanococcus maripaludis (strain S2 / LL) GN=argC PE=3 SV=1 564 877 5.0E-45
sp|A4G075|ARGC_METM5 N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=argC PE=3 SV=1 564 877 9.0E-45
sp|A6VIA5|ARGC_METM7 N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=argC PE=3 SV=1 564 877 3.0E-44
sp|Q58496|ARGC_METJA N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=argC PE=3 SV=2 563 877 4.0E-44
sp|A9A8I0|ARGC_METM6 N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=argC PE=3 SV=1 564 877 9.0E-44
sp|A7I4D1|ARGC_METB6 N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanoregula boonei (strain 6A8) GN=argC PE=3 SV=1 563 877 2.0E-43
sp|A6UR99|ARGC_METVS N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=argC PE=3 SV=1 564 877 7.0E-43
sp|B0KBV9|ARGC_THEP3 N-acetyl-gamma-glutamyl-phosphate reductase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=argC PE=3 SV=1 562 873 1.0E-42
sp|Q2NGV2|ARGC_METST N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=argC PE=3 SV=1 564 877 2.0E-42
sp|A6UWL8|ARGC_META3 N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=argC PE=3 SV=1 564 877 3.0E-42
sp|Q2RG62|ARGC_MOOTA N-acetyl-gamma-glutamyl-phosphate reductase OS=Moorella thermoacetica (strain ATCC 39073) GN=argC PE=3 SV=1 563 873 4.0E-42
sp|O26934|ARGC_METTH N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=argC PE=3 SV=2 564 877 5.0E-42
sp|Q8PZL6|ARGC_METMA N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=argC PE=3 SV=1 563 877 6.0E-42
sp|B0K4D2|ARGC_THEPX N-acetyl-gamma-glutamyl-phosphate reductase OS=Thermoanaerobacter sp. (strain X514) GN=argC PE=3 SV=1 562 877 1.0E-41
sp|A0B6F6|ARGC_METTP N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=argC PE=3 SV=1 564 877 1.0E-40
sp|Q0W932|ARGC_METAR N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=argC PE=3 SV=1 563 877 3.0E-40
sp|O28208|ARGC_ARCFU N-acetyl-gamma-glutamyl-phosphate reductase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=argC PE=3 SV=1 563 879 6.0E-40
sp|Q9X2A2|ARGC_THEMA N-acetyl-gamma-glutamyl-phosphate reductase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=argC PE=1 SV=1 563 877 1.0E-39
sp|B1LAP2|ARGC_THESQ N-acetyl-gamma-glutamyl-phosphate reductase OS=Thermotoga sp. (strain RQ2) GN=argC PE=3 SV=1 563 877 1.0E-39
sp|Q8TK53|ARGC_METAC N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=argC PE=3 SV=1 563 877 2.0E-39
sp|A4J167|ARGC_DESRM N-acetyl-gamma-glutamyl-phosphate reductase OS=Desulfotomaculum reducens (strain MI-1) GN=argC PE=3 SV=1 563 877 3.0E-39
sp|Q3Z629|ARGC_DEHM1 N-acetyl-gamma-glutamyl-phosphate reductase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=argC PE=3 SV=1 563 877 4.0E-39
sp|Q8R7B8|ARGC_CALS4 N-acetyl-gamma-glutamyl-phosphate reductase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=argC PE=3 SV=1 563 877 5.0E-39
sp|A5FPC2|ARGC_DEHMB N-acetyl-gamma-glutamyl-phosphate reductase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=argC PE=3 SV=1 563 880 8.0E-39
sp|Q3A3B8|ARGC_PELCD N-acetyl-gamma-glutamyl-phosphate reductase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=argC PE=3 SV=1 563 877 1.0E-38
sp|Q3ZZX5|ARGC_DEHMC N-acetyl-gamma-glutamyl-phosphate reductase OS=Dehalococcoides mccartyi (strain CBDB1) GN=argC PE=3 SV=1 563 880 2.0E-38
sp|C1D5B2|ARGC_LARHH N-acetyl-gamma-glutamyl-phosphate reductase OS=Laribacter hongkongensis (strain HLHK9) GN=argC PE=3 SV=1 563 877 2.0E-38
sp|Q9Z4S2|ARGC_THENN N-acetyl-gamma-glutamyl-phosphate reductase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=argC PE=3 SV=2 563 880 2.0E-38
sp|A5ILL3|ARGC_THEP1 N-acetyl-gamma-glutamyl-phosphate reductase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=argC PE=3 SV=1 563 877 3.0E-38
sp|A3DGK5|ARGC_CLOTH N-acetyl-gamma-glutamyl-phosphate reductase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=argC PE=3 SV=1 562 877 4.0E-38
sp|B2TQ25|ARGC_CLOBB N-acetyl-gamma-glutamyl-phosphate reductase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=argC PE=3 SV=1 563 877 4.0E-38
sp|Q3JC91|ARGC_NITOC N-acetyl-gamma-glutamyl-phosphate reductase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=argC PE=3 SV=1 563 877 4.0E-38
sp|B8E0N8|ARGC_DICTD N-acetyl-gamma-glutamyl-phosphate reductase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=argC PE=3 SV=1 563 877 5.0E-38
sp|A5ULI7|ARGC_METS3 N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=argC PE=3 SV=1 563 877 6.0E-38
sp|Q64YZ5|ARGC_BACFR N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacteroides fragilis (strain YCH46) GN=argC PE=3 SV=1 563 877 1.0E-37
sp|Q46B07|ARGC_METBF N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=argC PE=3 SV=1 563 877 1.0E-37
sp|Q8A1A7|ARGC_BACTN N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=argC PE=3 SV=1 563 877 1.0E-37
sp|Q5LHZ1|ARGC_BACFN N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=argC PE=3 SV=1 563 877 2.0E-37
sp|Q2KV05|ARGC_BORA1 N-acetyl-gamma-glutamyl-phosphate reductase OS=Bordetella avium (strain 197N) GN=argC PE=3 SV=1 563 877 2.0E-37
sp|Q4FRK9|ARGC_PSYA2 N-acetyl-gamma-glutamyl-phosphate reductase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=argC PE=3 SV=1 565 877 2.0E-37
sp|B1I1C5|ARGC_DESAP N-acetyl-gamma-glutamyl-phosphate reductase OS=Desulforudis audaxviator (strain MP104C) GN=argC PE=3 SV=1 563 877 4.0E-37
sp|A6L849|ARGC_PARD8 N-acetyl-gamma-glutamyl-phosphate reductase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=argC PE=3 SV=1 563 877 5.0E-37
sp|B5EFN1|ARGC_GEOBB N-acetyl-gamma-glutamyl-phosphate reductase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=argC PE=3 SV=1 563 877 5.0E-37
sp|A5D504|ARGC_PELTS N-acetyl-gamma-glutamyl-phosphate reductase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=argC PE=3 SV=1 563 877 5.0E-37
sp|Q8KDE3|ARGC_CHLTE N-acetyl-gamma-glutamyl-phosphate reductase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=argC PE=3 SV=1 564 873 7.0E-37
sp|B5EQH6|ARGC_ACIF5 N-acetyl-gamma-glutamyl-phosphate reductase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=argC PE=3 SV=1 563 877 8.0E-37
sp|B7JAI2|ARGC_ACIF2 N-acetyl-gamma-glutamyl-phosphate reductase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=argC PE=3 SV=1 563 877 8.0E-37
sp|Q1AS32|ARGC_RUBXD N-acetyl-gamma-glutamyl-phosphate reductase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=argC PE=3 SV=1 564 877 8.0E-37
sp|A2STZ4|ARGC_METLZ N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=argC PE=3 SV=1 564 877 9.0E-37
sp|Q3SF19|ARGC_THIDA N-acetyl-gamma-glutamyl-phosphate reductase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=argC PE=3 SV=1 563 873 1.0E-36
sp|A6M1Z6|ARGC_CLOB8 N-acetyl-gamma-glutamyl-phosphate reductase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=argC PE=3 SV=1 562 877 1.0E-36
sp|Q7NRT5|ARGC_CHRVO N-acetyl-gamma-glutamyl-phosphate reductase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=argC PE=3 SV=1 563 877 1.0E-36
sp|Q0AHZ8|ARGC_NITEC N-acetyl-gamma-glutamyl-phosphate reductase OS=Nitrosomonas eutropha (strain C91) GN=argC PE=3 SV=1 564 877 2.0E-36
sp|B9MR76|ARGC_CALBD N-acetyl-gamma-glutamyl-phosphate reductase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=argC PE=3 SV=1 563 877 2.0E-36
sp|C6E4S6|ARGC_GEOSM N-acetyl-gamma-glutamyl-phosphate reductase OS=Geobacter sp. (strain M21) GN=argC PE=3 SV=1 563 877 2.0E-36
sp|A3CRT6|ARGC_METMJ N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=argC PE=3 SV=1 564 879 2.0E-36
sp|C5CHW7|ARGC_KOSOT N-acetyl-gamma-glutamyl-phosphate reductase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=argC PE=3 SV=1 563 877 3.0E-36
sp|Q1QA46|ARGC_PSYCK N-acetyl-gamma-glutamyl-phosphate reductase OS=Psychrobacter cryohalolentis (strain K5) GN=argC PE=3 SV=1 565 877 3.0E-36
sp|A0Q1F0|ARGC_CLONN N-acetyl-gamma-glutamyl-phosphate reductase OS=Clostridium novyi (strain NT) GN=argC PE=3 SV=1 563 880 3.0E-36
sp|Q6ANM0|ARGC_DESPS N-acetyl-gamma-glutamyl-phosphate reductase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=argC PE=3 SV=1 563 877 3.0E-36
sp|B2UYI2|ARGC_CLOBA N-acetyl-gamma-glutamyl-phosphate reductase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=argC PE=3 SV=1 563 877 4.0E-36
sp|Q39Y23|ARGC_GEOMG N-acetyl-gamma-glutamyl-phosphate reductase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=argC PE=3 SV=1 564 878 1.0E-35
sp|Q2YBK4|ARGC_NITMU N-acetyl-gamma-glutamyl-phosphate reductase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=argC PE=3 SV=1 563 873 1.0E-35
sp|C6DI81|ARGC_PECCP N-acetyl-gamma-glutamyl-phosphate reductase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=argC PE=3 SV=1 566 877 2.0E-35
sp|A6KXY5|ARGC_BACV8 N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=argC PE=3 SV=1 563 877 2.0E-35
sp|Q65LF0|ARGC_BACLD N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=argC PE=3 SV=1 563 877 2.0E-35
sp|Q6DAR1|ARGC_PECAS N-acetyl-gamma-glutamyl-phosphate reductase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=argC PE=3 SV=1 566 877 2.0E-35
sp|B8D1G6|ARGC_HALOH N-acetyl-gamma-glutamyl-phosphate reductase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=argC PE=3 SV=1 563 877 2.0E-35
sp|B5YAL8|ARGC_DICT6 N-acetyl-gamma-glutamyl-phosphate reductase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=argC PE=3 SV=1 563 877 2.0E-35
sp|Q82UK2|ARGC_NITEU N-acetyl-gamma-glutamyl-phosphate reductase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=argC PE=3 SV=1 565 877 3.0E-35
sp|A3M5Z6|ARGC_ACIBT N-acetyl-gamma-glutamyl-phosphate reductase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=argC PE=3 SV=2 564 877 3.0E-35
sp|B0VQK3|ARGC_ACIBS N-acetyl-gamma-glutamyl-phosphate reductase OS=Acinetobacter baumannii (strain SDF) GN=argC PE=3 SV=1 564 877 3.0E-35
sp|A5WFU8|ARGC_PSYWF N-acetyl-gamma-glutamyl-phosphate reductase OS=Psychrobacter sp. (strain PRwf-1) GN=argC PE=3 SV=1 563 877 3.0E-35
sp|B2I2V4|ARGC_ACIBC N-acetyl-gamma-glutamyl-phosphate reductase OS=Acinetobacter baumannii (strain ACICU) GN=argC PE=3 SV=1 564 877 3.0E-35
sp|Q8KA61|ARGC_BUCAP N-acetyl-gamma-glutamyl-phosphate reductase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=argC PE=3 SV=1 563 877 4.0E-35
sp|B0TCA6|ARGC_HELMI N-acetyl-gamma-glutamyl-phosphate reductase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=argC PE=3 SV=1 563 877 5.0E-35
sp|A8F448|ARGC_PSELT N-acetyl-gamma-glutamyl-phosphate reductase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=argC PE=3 SV=1 563 877 6.0E-35
sp|A9I242|ARGC_BORPD N-acetyl-gamma-glutamyl-phosphate reductase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=argC PE=3 SV=1 563 877 1.0E-34
sp|B4S9V0|ARGC_PELPB N-acetyl-gamma-glutamyl-phosphate reductase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=argC PE=3 SV=1 564 877 1.0E-34
sp|B7V620|ARGC_PSEA8 N-acetyl-gamma-glutamyl-phosphate reductase OS=Pseudomonas aeruginosa (strain LESB58) GN=argC PE=3 SV=1 563 877 1.0E-34
sp|C0QI21|ARGC_DESAH N-acetyl-gamma-glutamyl-phosphate reductase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=argC PE=3 SV=1 563 877 1.0E-34
sp|Q93Z70|ARGC_ARATH Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic OS=Arabidopsis thaliana GN=At2g19940 PE=1 SV=2 563 877 1.0E-34
sp|Q02TA4|ARGC_PSEAB N-acetyl-gamma-glutamyl-phosphate reductase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=argC PE=3 SV=1 563 877 1.0E-34
sp|Q88QQ6|ARGC1_PSEPK N-acetyl-gamma-glutamyl-phosphate reductase 1 OS=Pseudomonas putida (strain KT2440) GN=argC1 PE=3 SV=1 563 877 2.0E-34
sp|A6TTJ3|ARGC_ALKMQ N-acetyl-gamma-glutamyl-phosphate reductase OS=Alkaliphilus metalliredigens (strain QYMF) GN=argC PE=3 SV=1 563 880 2.0E-34
sp|A5GAY8|ARGC_GEOUR N-acetyl-gamma-glutamyl-phosphate reductase OS=Geobacter uraniireducens (strain Rf4) GN=argC PE=3 SV=1 563 880 2.0E-34
sp|A7Z3A7|ARGC_BACMF N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=argC PE=3 SV=1 563 877 2.0E-34
sp|A8AAF8|ARGC_IGNH4 N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=argC PE=3 SV=1 564 880 2.0E-34
sp|A5N8G4|ARGC_CLOK5 N-acetyl-gamma-glutamyl-phosphate reductase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=argC PE=3 SV=1 562 880 2.0E-34
sp|B9E1X0|ARGC_CLOK1 N-acetyl-gamma-glutamyl-phosphate reductase OS=Clostridium kluyveri (strain NBRC 12016) GN=argC PE=3 SV=1 562 880 2.0E-34
sp|B3E0U0|ARGC_METI4 N-acetyl-gamma-glutamyl-phosphate reductase OS=Methylacidiphilum infernorum (isolate V4) GN=argC PE=3 SV=1 563 877 3.0E-34
sp|Q97GH7|ARGC_CLOAB N-acetyl-gamma-glutamyl-phosphate reductase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=argC PE=3 SV=1 563 877 3.0E-34
sp|Q7M7U1|ARGC_WOLSU N-acetyl-gamma-glutamyl-phosphate reductase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=argC PE=3 SV=1 564 878 3.0E-34
sp|A6UZG3|ARGC_PSEA7 N-acetyl-gamma-glutamyl-phosphate reductase OS=Pseudomonas aeruginosa (strain PA7) GN=argC PE=3 SV=1 563 877 3.0E-34
sp|Q9I5Q9|ARGC_PSEAE N-acetyl-gamma-glutamyl-phosphate reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=argC PE=3 SV=1 563 877 3.0E-34
sp|B0V684|ARGC_ACIBY N-acetyl-gamma-glutamyl-phosphate reductase OS=Acinetobacter baumannii (strain AYE) GN=argC PE=3 SV=1 564 877 3.0E-34
sp|B7I933|ARGC_ACIB5 N-acetyl-gamma-glutamyl-phosphate reductase OS=Acinetobacter baumannii (strain AB0057) GN=argC PE=3 SV=1 564 877 3.0E-34
sp|B7H211|ARGC_ACIB3 N-acetyl-gamma-glutamyl-phosphate reductase OS=Acinetobacter baumannii (strain AB307-0294) GN=argC PE=3 SV=1 564 877 3.0E-34
sp|Q8ZA86|ARGC_YERPE N-acetyl-gamma-glutamyl-phosphate reductase OS=Yersinia pestis GN=argC PE=3 SV=1 566 877 4.0E-34
sp|Q21MI4|ARGC_SACD2 N-acetyl-gamma-glutamyl-phosphate reductase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=argC PE=3 SV=1 563 877 4.0E-34
sp|Q66G72|ARGC_YERPS N-acetyl-gamma-glutamyl-phosphate reductase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=argC PE=3 SV=1 566 877 5.0E-34
sp|Q1IFY8|ARGC_PSEE4 N-acetyl-gamma-glutamyl-phosphate reductase OS=Pseudomonas entomophila (strain L48) GN=argC PE=3 SV=1 563 877 8.0E-34
sp|A4IL46|ARGC_GEOTN N-acetyl-gamma-glutamyl-phosphate reductase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=argC PE=3 SV=1 563 877 8.0E-34
sp|B0KK45|ARGC_PSEPG N-acetyl-gamma-glutamyl-phosphate reductase OS=Pseudomonas putida (strain GB-1) GN=argC PE=3 SV=1 563 877 1.0E-33
sp|Q8CUN2|ARGC_OCEIH N-acetyl-gamma-glutamyl-phosphate reductase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=argC PE=3 SV=1 563 877 1.0E-33
sp|Q7VUW0|ARGC_BORPE N-acetyl-gamma-glutamyl-phosphate reductase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=argC PE=3 SV=1 563 877 2.0E-33
sp|A1AXV8|ARGC_RUTMC N-acetyl-gamma-glutamyl-phosphate reductase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=argC PE=3 SV=1 563 877 2.0E-33
sp|B8GLD4|ARGC_THISH N-acetyl-gamma-glutamyl-phosphate reductase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=argC PE=3 SV=1 563 877 2.0E-33
sp|A0LIV2|ARGC_SYNFM N-acetyl-gamma-glutamyl-phosphate reductase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=argC PE=3 SV=1 563 877 2.0E-33
sp|A5VXM5|ARGC_PSEP1 N-acetyl-gamma-glutamyl-phosphate reductase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=argC PE=3 SV=1 563 877 2.0E-33
sp|B9M6W2|ARGC_GEODF N-acetyl-gamma-glutamyl-phosphate reductase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=argC PE=3 SV=1 563 880 3.0E-33
sp|Q6FCI4|ARGC_ACIAD N-acetyl-gamma-glutamyl-phosphate reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=argC PE=3 SV=1 564 877 4.0E-33
sp|Q7W3Z3|ARGC_BORPA N-acetyl-gamma-glutamyl-phosphate reductase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=argC PE=3 SV=1 563 877 4.0E-33
sp|Q7WFC5|ARGC_BORBR N-acetyl-gamma-glutamyl-phosphate reductase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=argC PE=3 SV=1 563 877 4.0E-33
sp|Q5L1V5|ARGC_GEOKA N-acetyl-gamma-glutamyl-phosphate reductase OS=Geobacillus kaustophilus (strain HTA426) GN=argC PE=3 SV=1 563 880 5.0E-33
sp|C1DHY0|ARGC_AZOVD N-acetyl-gamma-glutamyl-phosphate reductase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=argC PE=3 SV=1 563 877 7.0E-33
sp|B1MAZ6|ARGC_MYCA9 N-acetyl-gamma-glutamyl-phosphate reductase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=argC PE=3 SV=1 564 877 7.0E-33
sp|Q07906|ARGC_GEOSE N-acetyl-gamma-glutamyl-phosphate reductase OS=Geobacillus stearothermophilus GN=argC PE=2 SV=2 563 880 7.0E-33
sp|A4T032|ARGC_POLSQ N-acetyl-gamma-glutamyl-phosphate reductase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=argC PE=3 SV=1 563 877 8.0E-33
sp|A4XZB4|ARGC_PSEMY N-acetyl-gamma-glutamyl-phosphate reductase OS=Pseudomonas mendocina (strain ymp) GN=argC PE=3 SV=1 563 877 1.0E-32
sp|A9VG72|ARGC_BACWK N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacillus weihenstephanensis (strain KBAB4) GN=argC PE=3 SV=1 563 880 1.0E-32
sp|A7GSF4|ARGC_BACCN N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=argC PE=3 SV=1 563 877 1.0E-32
sp|Q5MZ48|ARGB_SYNP6 Acetylglutamate kinase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=argB PE=3 SV=1 71 334 1.0E-32
sp|Q6V1L5|ARGB_SYNE7 Acetylglutamate kinase OS=Synechococcus elongatus (strain PCC 7942) GN=argB PE=1 SV=1 71 334 1.0E-32
sp|A0M376|ARGC_GRAFK N-acetyl-gamma-glutamyl-phosphate reductase OS=Gramella forsetii (strain KT0803) GN=argC PE=3 SV=1 565 877 2.0E-32
sp|Q48NN7|ARGC_PSE14 N-acetyl-gamma-glutamyl-phosphate reductase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=argC PE=3 SV=1 563 877 2.0E-32
sp|C3K2Z7|ARGC_PSEFS N-acetyl-gamma-glutamyl-phosphate reductase OS=Pseudomonas fluorescens (strain SBW25) GN=argC PE=3 SV=1 563 877 2.0E-32
sp|A1VXU6|ARGC_CAMJJ N-acetyl-gamma-glutamyl-phosphate reductase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=argC PE=3 SV=1 563 877 2.0E-32
sp|Q81M95|ARGC_BACAN N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacillus anthracis GN=argC PE=3 SV=1 563 880 2.0E-32
sp|C3LJQ9|ARGC_BACAC N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=argC PE=3 SV=1 563 880 2.0E-32
sp|C3P7R8|ARGC_BACAA N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacillus anthracis (strain A0248) GN=argC PE=3 SV=1 563 880 2.0E-32
sp|Q3K5W5|ARGC_PSEPF N-acetyl-gamma-glutamyl-phosphate reductase OS=Pseudomonas fluorescens (strain Pf0-1) GN=argC PE=3 SV=1 563 877 2.0E-32
sp|Q889Z3|ARGC_PSESM N-acetyl-gamma-glutamyl-phosphate reductase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=argC PE=3 SV=1 563 877 3.0E-32
sp|B7HB04|ARGC_BACC4 N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacillus cereus (strain B4264) GN=argC PE=3 SV=1 563 880 3.0E-32
sp|Q5WEW7|ARGC_BACSK N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacillus clausii (strain KSM-K16) GN=argC PE=3 SV=1 563 877 3.0E-32
sp|Q9K4Z6|ARGC_MORPR N-acetyl-gamma-glutamyl-phosphate reductase OS=Moritella profunda GN=argC PE=3 SV=1 566 872 3.0E-32
sp|C1ER06|ARGC_BACC3 N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacillus cereus (strain 03BB102) GN=argC PE=3 SV=1 563 880 3.0E-32
sp|A5CVH0|ARGC_VESOH N-acetyl-gamma-glutamyl-phosphate reductase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=argC PE=3 SV=1 563 877 4.0E-32
sp|Q7MYD6|ARGC_PHOLL N-acetyl-gamma-glutamyl-phosphate reductase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=argC PE=3 SV=1 566 877 8.0E-32
sp|B8GFN1|ARGC_METPE N-acetyl-gamma-glutamyl-phosphate reductase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=argC PE=3 SV=1 564 877 8.0E-32
sp|Q5HWN8|ARGC_CAMJR N-acetyl-gamma-glutamyl-phosphate reductase OS=Campylobacter jejuni (strain RM1221) GN=argC PE=3 SV=1 563 877 8.0E-32
sp|Q4ZMM3|ARGC_PSEU2 N-acetyl-gamma-glutamyl-phosphate reductase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=argC PE=3 SV=1 563 877 9.0E-32
sp|C0QYU7|ARGC_BRAHW N-acetyl-gamma-glutamyl-phosphate reductase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=argC PE=3 SV=1 563 877 1.0E-31
sp|A1ATK5|ARGC_PELPD N-acetyl-gamma-glutamyl-phosphate reductase OS=Pelobacter propionicus (strain DSM 2379) GN=argC PE=3 SV=1 564 877 1.0E-31
sp|C1KVN8|ARGC_LISMC N-acetyl-gamma-glutamyl-phosphate reductase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=argC PE=3 SV=1 563 877 1.0E-31
sp|Q9K4Z1|ARGC_MORAB N-acetyl-gamma-glutamyl-phosphate reductase OS=Moritella abyssi GN=argC PE=3 SV=1 566 872 1.0E-31
sp|Q9JY18|ARGC_NEIMB N-acetyl-gamma-glutamyl-phosphate reductase OS=Neisseria meningitidis serogroup B (strain MC58) GN=argC PE=3 SV=1 563 877 1.0E-31
sp|A4X650|ARGC_SALTO N-acetyl-gamma-glutamyl-phosphate reductase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=argC PE=3 SV=1 563 877 2.0E-31
sp|Q71Z76|ARGC_LISMF N-acetyl-gamma-glutamyl-phosphate reductase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=argC PE=3 SV=1 563 877 2.0E-31
sp|P57156|ARGC_BUCAI N-acetyl-gamma-glutamyl-phosphate reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=argC PE=3 SV=1 564 877 2.0E-31
sp|B8D8K6|ARGC_BUCA5 N-acetyl-gamma-glutamyl-phosphate reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=argC PE=3 SV=1 564 877 2.0E-31
sp|B1JE24|ARGC_PSEPW N-acetyl-gamma-glutamyl-phosphate reductase OS=Pseudomonas putida (strain W619) GN=argC PE=3 SV=1 563 877 2.0E-31
sp|B3PL73|ARGC_CELJU N-acetyl-gamma-glutamyl-phosphate reductase OS=Cellvibrio japonicus (strain Ueda107) GN=argC PE=3 SV=1 563 877 2.0E-31
sp|Q8ZUA0|ARGC_PYRAE N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=argC PE=3 SV=1 563 877 2.0E-31
sp|A4XJN9|ARGC_CALS8 N-acetyl-gamma-glutamyl-phosphate reductase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=argC PE=3 SV=1 563 877 2.0E-31
sp|Q92BB7|ARGC_LISIN N-acetyl-gamma-glutamyl-phosphate reductase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=argC PE=3 SV=1 563 877 2.0E-31
sp|Q9JVU6|ARGC_NEIMA N-acetyl-gamma-glutamyl-phosphate reductase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=argC PE=3 SV=1 563 877 3.0E-31
sp|Q5E2E5|ARGC_VIBF1 N-acetyl-gamma-glutamyl-phosphate reductase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=argC PE=3 SV=1 563 871 3.0E-31
sp|Q6HE28|ARGC_BACHK N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=argC PE=3 SV=1 563 880 3.0E-31
sp|A0LUC5|ARGC_ACIC1 N-acetyl-gamma-glutamyl-phosphate reductase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=argC PE=3 SV=1 562 877 3.0E-31
sp|A7H1S3|ARGC_CAMJD N-acetyl-gamma-glutamyl-phosphate reductase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=argC PE=3 SV=1 563 877 3.0E-31
sp|Q8Y6U1|ARGC_LISMO N-acetyl-gamma-glutamyl-phosphate reductase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=argC PE=3 SV=1 563 877 4.0E-31
sp|A8F450|ARGB_PSELT Acetylglutamate kinase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=argB PE=3 SV=1 74 335 4.0E-31
sp|A8FK14|ARGC_CAMJ8 N-acetyl-gamma-glutamyl-phosphate reductase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=argC PE=3 SV=1 563 877 4.0E-31
sp|Q9PIS0|ARGC_CAMJE N-acetyl-gamma-glutamyl-phosphate reductase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=argC PE=1 SV=1 563 877 4.0E-31
sp|Q748X6|ARGC_GEOSL N-acetyl-gamma-glutamyl-phosphate reductase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=argC PE=3 SV=1 563 877 4.0E-31
sp|A1WVE4|ARGC_HALHL N-acetyl-gamma-glutamyl-phosphate reductase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=argC PE=3 SV=1 564 877 5.0E-31
sp|B8DHF0|ARGC_LISMH N-acetyl-gamma-glutamyl-phosphate reductase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=argC PE=3 SV=1 563 877 5.0E-31
sp|A1KSA9|ARGC_NEIMF N-acetyl-gamma-glutamyl-phosphate reductase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=argC PE=3 SV=1 563 877 5.0E-31
sp|B8D6W0|ARGC_BUCAT N-acetyl-gamma-glutamyl-phosphate reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=argC PE=3 SV=1 564 877 6.0E-31
sp|A9KHN1|ARGC_CLOPH N-acetyl-gamma-glutamyl-phosphate reductase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=argC PE=3 SV=1 563 877 6.0E-31
sp|B6JHG4|ARGC_OLICO N-acetyl-gamma-glutamyl-phosphate reductase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=argC PE=3 SV=1 563 877 8.0E-31
sp|C4Z4C2|ARGC_EUBE2 N-acetyl-gamma-glutamyl-phosphate reductase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=argC PE=3 SV=1 563 877 1.0E-30
sp|Q0ABJ9|ARGC_ALKEH N-acetyl-gamma-glutamyl-phosphate reductase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=argC PE=3 SV=1 564 877 1.0E-30
sp|Q6NHH0|ARGC_CORDI N-acetyl-gamma-glutamyl-phosphate reductase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=argC PE=3 SV=1 563 878 1.0E-30
sp|C5BP49|ARGC_TERTT N-acetyl-gamma-glutamyl-phosphate reductase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=argC PE=3 SV=1 563 877 2.0E-30
sp|C5D764|ARGC_GEOSW N-acetyl-gamma-glutamyl-phosphate reductase OS=Geobacillus sp. (strain WCH70) GN=argC PE=3 SV=1 564 877 2.0E-30
sp|A0JV20|ARGC_ARTS2 N-acetyl-gamma-glutamyl-phosphate reductase OS=Arthrobacter sp. (strain FB24) GN=argC PE=3 SV=1 564 877 2.0E-30
sp|A9M1W9|ARGC_NEIM0 N-acetyl-gamma-glutamyl-phosphate reductase OS=Neisseria meningitidis serogroup C (strain 053442) GN=argC PE=3 SV=1 563 877 2.0E-30
sp|P23715|ARGC_BACSU N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacillus subtilis (strain 168) GN=argC PE=3 SV=3 563 877 2.0E-30
sp|Q846B4|ARGC_BACAM N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacillus amyloliquefaciens GN=argC PE=3 SV=1 563 877 3.0E-30
sp|Q87L55|ARGC_VIBPA N-acetyl-gamma-glutamyl-phosphate reductase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=argC PE=3 SV=1 563 877 3.0E-30
sp|Q828A6|ARGC_STRAW N-acetyl-gamma-glutamyl-phosphate reductase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=argC PE=3 SV=1 563 880 3.0E-30
sp|Q9K8V2|ARGC_BACHD N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=argC PE=3 SV=1 563 877 4.0E-30
sp|Q8Z309|ARGC_SALTI N-acetyl-gamma-glutamyl-phosphate reductase OS=Salmonella typhi GN=argC PE=3 SV=1 566 877 5.0E-30
sp|Q5PK75|ARGC_SALPA N-acetyl-gamma-glutamyl-phosphate reductase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=argC PE=3 SV=1 566 877 5.0E-30
sp|A0AJ40|ARGC_LISW6 N-acetyl-gamma-glutamyl-phosphate reductase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=argC PE=3 SV=1 563 877 6.0E-30
sp|A3MT41|ARGC_PYRCJ N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=argC PE=3 SV=1 563 877 7.0E-30
sp|P59311|ARGC_STRMU N-acetyl-gamma-glutamyl-phosphate reductase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=argC PE=3 SV=1 563 878 9.0E-30
sp|Q4A0N1|ARGC_STAS1 N-acetyl-gamma-glutamyl-phosphate reductase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=argC PE=3 SV=1 563 877 1.0E-29
sp|P96136|ARGC_THET2 N-acetyl-gamma-glutamyl-phosphate reductase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=argC PE=3 SV=3 564 878 1.0E-29
sp|Q8ZKL8|ARGC_SALTY N-acetyl-gamma-glutamyl-phosphate reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=argC PE=1 SV=1 566 877 1.0E-29
sp|B0CAM3|ARGB_ACAM1 Acetylglutamate kinase OS=Acaryochloris marina (strain MBIC 11017) GN=argB PE=3 SV=1 71 334 1.0E-29
sp|P11446|ARGC_ECOLI N-acetyl-gamma-glutamyl-phosphate reductase OS=Escherichia coli (strain K12) GN=argC PE=3 SV=1 566 877 1.0E-29
sp|A4G1T4|ARGC_HERAR N-acetyl-gamma-glutamyl-phosphate reductase OS=Herminiimonas arsenicoxydans GN=argC PE=3 SV=1 563 877 1.0E-29
sp|O67724|ARGC_AQUAE N-acetyl-gamma-glutamyl-phosphate reductase OS=Aquifex aeolicus (strain VF5) GN=argC PE=3 SV=1 563 877 1.0E-29
sp|Q5FAA9|ARGC_NEIG1 N-acetyl-gamma-glutamyl-phosphate reductase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=argC PE=3 SV=1 563 877 1.0E-29
sp|Q7UVL4|ARGC_RHOBA N-acetyl-gamma-glutamyl-phosphate reductase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=argC PE=3 SV=1 563 877 2.0E-29
sp|Q731G3|ARGC_BACC1 N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=argC PE=3 SV=1 563 880 2.0E-29
sp|Q30QC1|ARGC_SULDN N-acetyl-gamma-glutamyl-phosphate reductase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=argC PE=3 SV=1 564 880 2.0E-29
sp|B1YB54|ARGC_PYRNV N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=argC PE=3 SV=1 563 877 2.0E-29
sp|B4RQ50|ARGC_NEIG2 N-acetyl-gamma-glutamyl-phosphate reductase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=argC PE=3 SV=1 563 877 2.0E-29
sp|A1TYH0|ARGC_MARHV N-acetyl-gamma-glutamyl-phosphate reductase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=argC PE=3 SV=1 563 877 2.0E-29
sp|B9IXC9|ARGC_BACCQ N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacillus cereus (strain Q1) GN=argC PE=3 SV=1 563 880 3.0E-29
sp|B7HNP9|ARGC_BACC7 N-acetyl-gamma-glutamyl-phosphate reductase OS=Bacillus cereus (strain AH187) GN=argC PE=3 SV=1 563 880 3.0E-29
sp|A0KFV0|ARGC_AERHH N-acetyl-gamma-glutamyl-phosphate reductase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=argC PE=3 SV=1 566 877 3.0E-29
sp|A4SIM2|ARGC_AERS4 N-acetyl-gamma-glutamyl-phosphate reductase OS=Aeromonas salmonicida (strain A449) GN=argC PE=3 SV=1 566 877 4.0E-29
sp|A0L482|ARGC_MAGMM N-acetyl-gamma-glutamyl-phosphate reductase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=argC PE=3 SV=1 563 873 4.0E-29
sp|B1XIA1|ARGC_SYNP2 N-acetyl-gamma-glutamyl-phosphate reductase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=argC PE=3 SV=1 557 880 4.0E-29
sp|P54895|ARGC_STRCO N-acetyl-gamma-glutamyl-phosphate reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=argC PE=3 SV=2 563 880 5.0E-29
sp|Q6AGD3|ARGC_LEIXX N-acetyl-gamma-glutamyl-phosphate reductase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=argC PE=3 SV=1 564 877 7.0E-29
sp|B4S0H8|ARGC_ALTMD N-acetyl-gamma-glutamyl-phosphate reductase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=argC PE=3 SV=1 564 867 8.0E-29
sp|Q980X1|ARGC_SULSO N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=argC PE=3 SV=1 563 877 9.0E-29
sp|A3CLY4|ARGC_STRSV N-acetyl-gamma-glutamyl-phosphate reductase OS=Streptococcus sanguinis (strain SK36) GN=argC PE=3 SV=1 563 877 1.0E-28
sp|Q110V5|ARGC_TRIEI N-acetyl-gamma-glutamyl-phosphate reductase OS=Trichodesmium erythraeum (strain IMS101) GN=argC PE=3 SV=1 559 880 1.0E-28
sp|Q2RRM4|ARGC_RHORT N-acetyl-gamma-glutamyl-phosphate reductase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=argC PE=3 SV=1 564 877 1.0E-28
sp|A6SUN9|ARGC_JANMA N-acetyl-gamma-glutamyl-phosphate reductase OS=Janthinobacterium sp. (strain Marseille) GN=argC PE=3 SV=1 563 877 1.0E-28
sp|Q5UZ50|ARGC_HALMA N-acetyl-gamma-glutamyl-phosphate reductase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=argC PE=3 SV=1 566 877 1.0E-28
sp|A1R585|ARGC_ARTAT N-acetyl-gamma-glutamyl-phosphate reductase OS=Arthrobacter aurescens (strain TC1) GN=argC PE=3 SV=1 564 877 2.0E-28
sp|B6YQY8|ARGC_AZOPC N-acetyl-gamma-glutamyl-phosphate reductase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=argC PE=3 SV=1 572 877 2.0E-28
sp|B0JHB1|ARGB_MICAN Acetylglutamate kinase OS=Microcystis aeruginosa (strain NIES-843) GN=argB PE=3 SV=1 86 334 2.0E-28
sp|A9BAE1|ARGC_PROM4 N-acetyl-gamma-glutamyl-phosphate reductase OS=Prochlorococcus marinus (strain MIT 9211) GN=argC PE=3 SV=1 557 878 2.0E-28
sp|Q8X732|ARGC_ECO57 N-acetyl-gamma-glutamyl-phosphate reductase OS=Escherichia coli O157:H7 GN=argC PE=3 SV=1 566 877 2.0E-28
sp|A5FEC6|ARGC_FLAJ1 N-acetyl-gamma-glutamyl-phosphate reductase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=argC PE=3 SV=1 563 877 2.0E-28
sp|B0KBW1|ARGB_THEP3 Acetylglutamate kinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=argB PE=3 SV=1 71 336 2.0E-28
sp|Q03LZ4|ARGC_STRTD N-acetyl-gamma-glutamyl-phosphate reductase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=argC PE=3 SV=1 563 877 3.0E-28
sp|Q8R7C0|ARGB_CALS4 Acetylglutamate kinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=argB PE=3 SV=1 71 336 3.0E-28
sp|B0K4D4|ARGB_THEPX Acetylglutamate kinase OS=Thermoanaerobacter sp. (strain X514) GN=argB PE=3 SV=1 71 336 3.0E-28
sp|Q8U0B6|ARGC_PYRFU N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=argC PE=3 SV=1 563 877 3.0E-28
sp|Q5M5L1|ARGC_STRT2 N-acetyl-gamma-glutamyl-phosphate reductase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=argC PE=3 SV=1 563 877 3.0E-28
sp|Q5M123|ARGC_STRT1 N-acetyl-gamma-glutamyl-phosphate reductase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=argC PE=3 SV=1 563 877 3.0E-28
sp|Q67KC3|ARGC_SYMTH N-acetyl-gamma-glutamyl-phosphate reductase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=argC PE=3 SV=1 563 877 4.0E-28
sp|B2GBN0|ARGC_LACF3 N-acetyl-gamma-glutamyl-phosphate reductase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=argC PE=3 SV=1 563 879 4.0E-28
sp|Q976J5|ARGC_SULTO N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=argC PE=3 SV=2 563 877 4.0E-28
sp|B1GYR2|ARGC_UNCTG N-acetyl-gamma-glutamyl-phosphate reductase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=argC PE=3 SV=1 562 877 4.0E-28
sp|Q3IMD8|ARGC_NATPD N-acetyl-gamma-glutamyl-phosphate reductase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=argC PE=3 SV=1 566 877 6.0E-28
sp|A1RR73|ARGC_PYRIL N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=argC PE=3 SV=1 563 877 6.0E-28
sp|Q6AV34|ARGC_ORYSJ Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0617900 PE=1 SV=1 563 877 7.0E-28
sp|A8AYI7|ARGC_STRGC N-acetyl-gamma-glutamyl-phosphate reductase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=argC PE=3 SV=1 563 877 8.0E-28
sp|P59312|ARGC_THEEB N-acetyl-gamma-glutamyl-phosphate reductase OS=Thermosynechococcus elongatus (strain BP-1) GN=argC PE=3 SV=1 564 880 8.0E-28
sp|C5CAN3|ARGC_MICLC N-acetyl-gamma-glutamyl-phosphate reductase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=argC PE=3 SV=1 564 877 9.0E-28
sp|P59310|ARGC_SHIFL N-acetyl-gamma-glutamyl-phosphate reductase OS=Shigella flexneri GN=argC PE=1 SV=1 566 877 9.0E-28
sp|B2UKZ6|ARGC_AKKM8 N-acetyl-gamma-glutamyl-phosphate reductase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=argC PE=3 SV=1 563 877 1.0E-27
sp|P54896|ARGC_STRC2 N-acetyl-gamma-glutamyl-phosphate reductase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=argC PE=3 SV=2 563 878 1.0E-27
sp|B1WYI6|ARGC_CYAA5 N-acetyl-gamma-glutamyl-phosphate reductase OS=Cyanothece sp. (strain ATCC 51142) GN=argC PE=3 SV=1 564 880 1.0E-27
sp|B2IX33|ARGB_NOSP7 Acetylglutamate kinase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=argB PE=3 SV=1 53 334 2.0E-27
sp|B8HGC3|ARGC_ARTCA N-acetyl-gamma-glutamyl-phosphate reductase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=argC PE=3 SV=1 564 877 2.0E-27
sp|Q5N5V5|ARGC_SYNP6 N-acetyl-gamma-glutamyl-phosphate reductase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=argC PE=3 SV=1 564 880 2.0E-27
sp|Q31NA6|ARGC_SYNE7 N-acetyl-gamma-glutamyl-phosphate reductase OS=Synechococcus elongatus (strain PCC 7942) GN=argC PE=3 SV=1 564 880 2.0E-27
sp|A7I2W9|ARGC_CAMHC N-acetyl-gamma-glutamyl-phosphate reductase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=argC PE=3 SV=1 563 880 3.0E-27
sp|A7H097|ARGC_CAMC5 N-acetyl-gamma-glutamyl-phosphate reductase OS=Campylobacter curvus (strain 525.92) GN=argC PE=3 SV=1 560 880 3.0E-27
sp|P59306|ARGC_ECOL6 N-acetyl-gamma-glutamyl-phosphate reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=argC PE=3 SV=1 566 877 3.0E-27
sp|O50146|ARGC2_THET2 N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=argC2 PE=2 SV=2 564 877 5.0E-27
sp|Q59279|ARGC_CORGL N-acetyl-gamma-glutamyl-phosphate reductase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=argC PE=3 SV=3 563 878 5.0E-27
sp|A9A1K6|ARGC_NITMS N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase OS=Nitrosopumilus maritimus (strain SCM1) GN=argC PE=3 SV=1 563 877 5.0E-27
sp|Q4FNF2|ARGB_PELUB Acetylglutamate kinase OS=Pelagibacter ubique (strain HTCC1062) GN=argB PE=3 SV=1 71 335 5.0E-27
sp|B8HY92|ARGC_CYAP4 N-acetyl-gamma-glutamyl-phosphate reductase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=argC PE=3 SV=1 564 880 6.0E-27
sp|Q18E32|ARGC_HALWD N-acetyl-gamma-glutamyl-phosphate reductase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=argC PE=3 SV=1 566 877 6.0E-27
sp|B7JY20|ARGC_CYAP8 N-acetyl-gamma-glutamyl-phosphate reductase OS=Cyanothece sp. (strain PCC 8801) GN=argC PE=3 SV=1 564 880 6.0E-27
sp|Q9KNT6|ARGC_VIBCH N-acetyl-gamma-glutamyl-phosphate reductase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=argC PE=3 SV=2 563 877 7.0E-27
sp|Q8FTN5|ARGC_COREF N-acetyl-gamma-glutamyl-phosphate reductase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=argC PE=3 SV=1 563 878 8.0E-27
sp|Q5JFW1|ARGC_THEKO N-acetyl-gamma-glutamyl-phosphate reductase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=argC PE=3 SV=1 563 877 8.0E-27
sp|B0RHD0|ARGC_CLAMS N-acetyl-gamma-glutamyl-phosphate reductase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=argC PE=3 SV=1 564 878 8.0E-27
sp|A5CSI9|ARGC_CLAM3 N-acetyl-gamma-glutamyl-phosphate reductase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=argC PE=3 SV=1 564 878 9.0E-27
sp|A8FK16|ARGB_CAMJ8 Acetylglutamate kinase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=argB PE=3 SV=1 71 334 1.0E-26
sp|A9WQ84|ARGC_RENSM N-acetyl-gamma-glutamyl-phosphate reductase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=argC PE=3 SV=1 564 877 1.0E-26
sp|A7H1S5|ARGB_CAMJD Acetylglutamate kinase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=argB PE=3 SV=1 71 334 1.0E-26
sp|C4LID5|ARGC_CORK4 N-acetyl-gamma-glutamyl-phosphate reductase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=argC PE=3 SV=1 564 877 1.0E-26
sp|B0TL88|ARGC_SHEHH N-acetyl-gamma-glutamyl-phosphate reductase OS=Shewanella halifaxensis (strain HAW-EB4) GN=argC PE=3 SV=1 563 867 1.0E-26
sp|Q5P7T9|ARGC_AROAE N-acetyl-gamma-glutamyl-phosphate reductase OS=Aromatoleum aromaticum (strain EbN1) GN=argC PE=3 SV=1 577 877 2.0E-26
sp|A4QDY8|ARGC_CORGB N-acetyl-gamma-glutamyl-phosphate reductase OS=Corynebacterium glutamicum (strain R) GN=argC PE=3 SV=1 563 878 2.0E-26
sp|Q116Q9|ARGB_TRIEI Acetylglutamate kinase OS=Trichodesmium erythraeum (strain IMS101) GN=argB PE=3 SV=1 71 334 2.0E-26
sp|Q8YXG8|ARGB_NOSS1 Acetylglutamate kinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=argB PE=3 SV=1 71 334 2.0E-26
sp|Q3J6V9|ARGB_NITOC Acetylglutamate kinase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=argB PE=3 SV=1 85 336 2.0E-26
sp|A6Q9U8|ARGC_SULNB N-acetyl-gamma-glutamyl-phosphate reductase OS=Sulfurovum sp. (strain NBC37-1) GN=argC PE=3 SV=1 563 880 2.0E-26
sp|Q9PIR8|ARGB_CAMJE Acetylglutamate kinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=argB PE=3 SV=2 71 334 2.0E-26
sp|Q3MFQ8|ARGB_ANAVT Acetylglutamate kinase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=argB PE=3 SV=1 71 334 3.0E-26
sp|Q5QX02|ARGC_IDILO N-acetyl-gamma-glutamyl-phosphate reductase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=argC PE=3 SV=1 564 867 4.0E-26
sp|P59303|ARGB_THEEB Acetylglutamate kinase OS=Thermosynechococcus elongatus (strain BP-1) GN=argB PE=3 SV=1 71 334 5.0E-26
sp|B0JXE8|ARGC_MICAN N-acetyl-gamma-glutamyl-phosphate reductase OS=Microcystis aeruginosa (strain NIES-843) GN=argC PE=3 SV=1 564 880 6.0E-26
sp|C4L7S5|ARGC_TOLAT N-acetyl-gamma-glutamyl-phosphate reductase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=argC PE=3 SV=1 563 877 6.0E-26
sp|A1VXU8|ARGB_CAMJJ Acetylglutamate kinase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=argB PE=3 SV=1 71 334 6.0E-26
sp|P59313|ARGC_VIBVU N-acetyl-gamma-glutamyl-phosphate reductase OS=Vibrio vulnificus (strain CMCP6) GN=argC PE=3 SV=1 563 871 6.0E-26
sp|Q31C34|ARGB_PROM9 Acetylglutamate kinase OS=Prochlorococcus marinus (strain MIT 9312) GN=argB PE=3 SV=1 71 334 7.0E-26
sp|Q7TUD1|ARGB_PROMP Acetylglutamate kinase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=argB PE=3 SV=1 71 335 7.0E-26
sp|P54899|ARGC_SYNY3 N-acetyl-gamma-glutamyl-phosphate reductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=argC PE=3 SV=1 562 880 8.0E-26
sp|A2BVG1|ARGB_PROM5 Acetylglutamate kinase OS=Prochlorococcus marinus (strain MIT 9515) GN=argB PE=3 SV=1 71 334 8.0E-26
sp|A4FKC8|ARGC_SACEN N-acetyl-gamma-glutamyl-phosphate reductase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=argC PE=3 SV=1 563 878 8.0E-26
sp|Q7MH70|ARGC_VIBVY N-acetyl-gamma-glutamyl-phosphate reductase OS=Vibrio vulnificus (strain YJ016) GN=argC PE=3 SV=1 563 871 1.0E-25
sp|C3PGJ1|ARGC_CORA7 N-acetyl-gamma-glutamyl-phosphate reductase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=argC PE=3 SV=1 564 878 1.0E-25
sp|A8GZ18|ARGC_SHEPA N-acetyl-gamma-glutamyl-phosphate reductase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=argC PE=3 SV=1 563 870 1.0E-25
sp|Q9V1I6|ARGC_PYRAB N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=argC PE=3 SV=1 563 877 1.0E-25
sp|Q3AWR0|ARGB_SYNS9 Acetylglutamate kinase OS=Synechococcus sp. (strain CC9902) GN=argB PE=3 SV=1 85 334 2.0E-25
sp|A4J169|ARGB_DESRM Acetylglutamate kinase OS=Desulfotomaculum reducens (strain MI-1) GN=argB PE=3 SV=1 71 334 2.0E-25
sp|A0RWW0|ARGC_CENSY N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase OS=Cenarchaeum symbiosum (strain A) GN=argC PE=3 SV=1 563 877 2.0E-25
sp|Q5HWN6|ARGB_CAMJR Acetylglutamate kinase OS=Campylobacter jejuni (strain RM1221) GN=argB PE=3 SV=1 71 334 2.0E-25
sp|Q4JAQ3|ARGC_SULAC N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=argC PE=3 SV=1 563 877 3.0E-25
sp|B1LAP0|ARGB_THESQ Acetylglutamate kinase OS=Thermotoga sp. (strain RQ2) GN=argB PE=3 SV=1 89 277 3.0E-25
sp|Q9X2A4|ARGB_THEMA Acetylglutamate kinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=argB PE=1 SV=1 89 277 3.0E-25
sp|P59309|ARGC_SHEON N-acetyl-gamma-glutamyl-phosphate reductase OS=Shewanella oneidensis (strain MR-1) GN=argC PE=3 SV=1 563 867 3.0E-25
sp|A5ILL5|ARGB_THEP1 Acetylglutamate kinase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=argB PE=3 SV=1 89 277 3.0E-25
sp|A8G3L5|ARGB_PROM2 Acetylglutamate kinase OS=Prochlorococcus marinus (strain MIT 9215) GN=argB PE=3 SV=1 71 334 3.0E-25
sp|A9KTZ0|ARGC_SHEB9 N-acetyl-gamma-glutamyl-phosphate reductase OS=Shewanella baltica (strain OS195) GN=argC PE=3 SV=1 563 867 4.0E-25
sp|C0Z6T1|ARGC_BREBN N-acetyl-gamma-glutamyl-phosphate reductase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=argC PE=3 SV=1 563 878 4.0E-25
sp|Q9CC15|ARGC_MYCLE N-acetyl-gamma-glutamyl-phosphate reductase OS=Mycobacterium leprae (strain TN) GN=argC PE=3 SV=1 563 877 4.0E-25
sp|B8ZRK2|ARGC_MYCLB N-acetyl-gamma-glutamyl-phosphate reductase OS=Mycobacterium leprae (strain Br4923) GN=argC PE=3 SV=1 563 877 4.0E-25
sp|Q85FW5|ARGB_CYAME Acetylglutamate kinase OS=Cyanidioschyzon merolae GN=argB PE=3 SV=1 89 277 4.0E-25
sp|A2BPY1|ARGB_PROMS Acetylglutamate kinase OS=Prochlorococcus marinus (strain AS9601) GN=argB PE=3 SV=1 71 334 5.0E-25
sp|Q2J860|ARGC_FRASC N-acetyl-gamma-glutamyl-phosphate reductase OS=Frankia sp. (strain CcI3) GN=argC PE=3 SV=1 628 877 5.0E-25
sp|A3PCW5|ARGC_PROM0 N-acetyl-gamma-glutamyl-phosphate reductase OS=Prochlorococcus marinus (strain MIT 9301) GN=argC PE=3 SV=1 563 877 5.0E-25
sp|O08318|ARGC2_LACPL N-acetyl-gamma-glutamyl-phosphate reductase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=argC2 PE=3 SV=2 563 880 6.0E-25
sp|P57907|ARGC_PASMU N-acetyl-gamma-glutamyl-phosphate reductase OS=Pasteurella multocida (strain Pm70) GN=argC PE=3 SV=1 566 877 6.0E-25
sp|A8LY49|ARGC_SALAI N-acetyl-gamma-glutamyl-phosphate reductase OS=Salinispora arenicola (strain CNS-205) GN=argC PE=3 SV=1 563 877 7.0E-25
sp|Q2JHF7|ARGB_SYNJB Acetylglutamate kinase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=argB PE=3 SV=1 86 332 7.0E-25
sp|Q7TUU2|ARGB_PROMM Acetylglutamate kinase OS=Prochlorococcus marinus (strain MIT 9313) GN=argB PE=3 SV=1 39 334 7.0E-25
sp|B8CNH7|ARGC_SHEPW N-acetyl-gamma-glutamyl-phosphate reductase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=argC PE=3 SV=1 563 867 7.0E-25
sp|A3PBM4|ARGB_PROM0 Acetylglutamate kinase OS=Prochlorococcus marinus (strain MIT 9301) GN=argB PE=3 SV=1 71 334 8.0E-25
sp|O59397|ARGC_PYRHO N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=argC PE=3 SV=1 563 877 8.0E-25
sp|P73326|ARGB_SYNY3 Acetylglutamate kinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=argB PE=3 SV=1 71 334 2.0E-24
sp|Q8N159|NAGS_HUMAN N-acetylglutamate synthase, mitochondrial OS=Homo sapiens GN=NAGS PE=1 SV=1 56 476 2.0E-24
sp|Q46L18|ARGC_PROMT N-acetyl-gamma-glutamyl-phosphate reductase OS=Prochlorococcus marinus (strain NATL2A) GN=argC PE=3 SV=1 563 880 2.0E-24
sp|A9BI99|ARGB_PETMO Acetylglutamate kinase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=argB PE=3 SV=1 71 336 3.0E-24
sp|Q2JXF5|ARGB_SYNJA Acetylglutamate kinase OS=Synechococcus sp. (strain JA-3-3Ab) GN=argB PE=3 SV=1 86 332 3.0E-24
sp|Q7M7Q9|ARGB_WOLSU Acetylglutamate kinase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=argB PE=3 SV=1 75 277 3.0E-24
sp|Q188A2|ARGB_PEPD6 Acetylglutamate kinase OS=Peptoclostridium difficile (strain 630) GN=argB PE=3 SV=1 89 336 4.0E-24
sp|A5EB56|ARGC_BRASB N-acetyl-gamma-glutamyl-phosphate reductase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=argC PE=3 SV=1 563 877 4.0E-24
sp|A4G0C7|ARGB_METM5 Acetylglutamate kinase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=argB PE=3 SV=1 84 336 4.0E-24
sp|Q24ZJ1|ARGB_DESHY Acetylglutamate kinase OS=Desulfitobacterium hafniense (strain Y51) GN=argB PE=3 SV=1 71 333 4.0E-24
sp|A6WTS3|ARGC_SHEB8 N-acetyl-gamma-glutamyl-phosphate reductase OS=Shewanella baltica (strain OS185) GN=argC PE=3 SV=1 563 867 4.0E-24
sp|A2C7M5|ARGB_PROM3 Acetylglutamate kinase OS=Prochlorococcus marinus (strain MIT 9303) GN=argB PE=3 SV=1 39 334 4.0E-24
sp|A0B9X4|ARGB_METTP Acetylglutamate kinase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=argB PE=3 SV=1 89 334 4.0E-24
sp|B7KF19|ARGC_CYAP7 N-acetyl-gamma-glutamyl-phosphate reductase OS=Cyanothece sp. (strain PCC 7424) GN=argC PE=3 SV=1 564 880 4.0E-24
sp|B8FWU9|ARGB_DESHD Acetylglutamate kinase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=argB PE=3 SV=1 85 333 5.0E-24
sp|B1KND3|ARGC_SHEWM N-acetyl-gamma-glutamyl-phosphate reductase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=argC PE=3 SV=1 564 871 6.0E-24
sp|Q31AX7|ARGC_PROM9 N-acetyl-gamma-glutamyl-phosphate reductase OS=Prochlorococcus marinus (strain MIT 9312) GN=argC PE=3 SV=1 563 877 6.0E-24
sp|Q15X80|ARGC_PSEA6 N-acetyl-gamma-glutamyl-phosphate reductase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=argC PE=3 SV=1 563 877 6.0E-24
sp|A3DA26|ARGC_SHEB5 N-acetyl-gamma-glutamyl-phosphate reductase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=argC PE=3 SV=1 563 867 7.0E-24
sp|A0RPV9|ARGB_CAMFF Acetylglutamate kinase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=argB PE=3 SV=1 89 335 7.0E-24
sp|P69366|ARGB_PORUM Acetylglutamate kinase OS=Porphyra umbilicalis GN=argB PE=3 SV=1 84 277 8.0E-24
sp|P69365|ARGB_PORPU Acetylglutamate kinase OS=Porphyra purpurea GN=argB PE=3 SV=1 84 277 8.0E-24
sp|A2C0V9|ARGB_PROM1 Acetylglutamate kinase OS=Prochlorococcus marinus (strain NATL1A) GN=argB PE=3 SV=1 85 334 8.0E-24
sp|A6UR56|ARGB_METVS Acetylglutamate kinase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=argB PE=3 SV=1 84 336 9.0E-24
sp|Q6GKC2|ARGC_STAAR N-acetyl-gamma-glutamyl-phosphate reductase OS=Staphylococcus aureus (strain MRSA252) GN=argC PE=3 SV=2 563 867 9.0E-24
sp|Q5HP21|ARGC_STAEQ N-acetyl-gamma-glutamyl-phosphate reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=argC PE=3 SV=1 563 877 9.0E-24
sp|Q8NYM6|ARGC_STAAW N-acetyl-gamma-glutamyl-phosphate reductase OS=Staphylococcus aureus (strain MW2) GN=argC PE=3 SV=1 563 867 9.0E-24
sp|Q6GCU2|ARGC_STAAS N-acetyl-gamma-glutamyl-phosphate reductase OS=Staphylococcus aureus (strain MSSA476) GN=argC PE=3 SV=2 563 867 9.0E-24
sp|Q5HJI9|ARGC_STAAC N-acetyl-gamma-glutamyl-phosphate reductase OS=Staphylococcus aureus (strain COL) GN=argC PE=3 SV=1 563 867 9.0E-24
sp|Q2G1H4|ARGC_STAA8 N-acetyl-gamma-glutamyl-phosphate reductase OS=Staphylococcus aureus (strain NCTC 8325) GN=argC PE=3 SV=1 563 867 9.0E-24
sp|Q2FK78|ARGC_STAA3 N-acetyl-gamma-glutamyl-phosphate reductase OS=Staphylococcus aureus (strain USA300) GN=argC PE=3 SV=1 563 867 9.0E-24
sp|Q8Y339|ARGC_RALSO N-acetyl-gamma-glutamyl-phosphate reductase OS=Ralstonia solanacearum (strain GMI1000) GN=argC PE=3 SV=1 630 873 1.0E-23
sp|B8EBG3|ARGC_SHEB2 N-acetyl-gamma-glutamyl-phosphate reductase OS=Shewanella baltica (strain OS223) GN=argC PE=3 SV=1 563 867 1.0E-23
sp|O67848|ARGB_AQUAE Acetylglutamate kinase OS=Aquifex aeolicus (strain VF5) GN=argB PE=3 SV=2 86 334 1.0E-23
sp|O28988|ARGB_ARCFU Probable acetylglutamate kinase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=argB PE=3 SV=1 71 334 1.0E-23
sp|B9K8S3|ARGB_THENN Acetylglutamate kinase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=argB PE=3 SV=1 89 277 1.0E-23
sp|A8G4T4|ARGC_PROM2 N-acetyl-gamma-glutamyl-phosphate reductase OS=Prochlorococcus marinus (strain MIT 9215) GN=argC PE=3 SV=1 563 877 1.0E-23
sp|Q8R4H7|NAGS_MOUSE N-acetylglutamate synthase, mitochondrial OS=Mus musculus GN=Nags PE=1 SV=2 41 476 1.0E-23
sp|Q0I064|ARGC_SHESR N-acetyl-gamma-glutamyl-phosphate reductase OS=Shewanella sp. (strain MR-7) GN=argC PE=3 SV=1 563 867 1.0E-23
sp|Q0HDU5|ARGC_SHESM N-acetyl-gamma-glutamyl-phosphate reductase OS=Shewanella sp. (strain MR-4) GN=argC PE=3 SV=1 563 867 1.0E-23
sp|A0L254|ARGC_SHESA N-acetyl-gamma-glutamyl-phosphate reductase OS=Shewanella sp. (strain ANA-3) GN=argC PE=3 SV=1 563 867 1.0E-23
sp|Q8CP35|ARGC_STAES N-acetyl-gamma-glutamyl-phosphate reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=argC PE=3 SV=1 563 877 1.0E-23
sp|A4WWI7|ARGB_RHOS5 Acetylglutamate kinase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=argB PE=3 SV=1 85 335 1.0E-23
sp|Q0AUM4|ARGB_SYNWW Acetylglutamate kinase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=argB PE=3 SV=1 71 334 2.0E-23
sp|Q12SN0|ARGC_SHEDO N-acetyl-gamma-glutamyl-phosphate reductase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=argC PE=3 SV=1 563 867 2.0E-23
sp|A2C239|ARGC_PROM1 N-acetyl-gamma-glutamyl-phosphate reductase OS=Prochlorococcus marinus (strain NATL1A) GN=argC PE=3 SV=1 557 880 2.0E-23
sp|P63565|ARGC_STAAN N-acetyl-gamma-glutamyl-phosphate reductase OS=Staphylococcus aureus (strain N315) GN=argC PE=3 SV=1 563 867 2.0E-23
sp|P63564|ARGC_STAAM N-acetyl-gamma-glutamyl-phosphate reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=argC PE=3 SV=1 563 867 2.0E-23
sp|A7WXH5|ARGC_STAA1 N-acetyl-gamma-glutamyl-phosphate reductase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=argC PE=3 SV=1 563 867 2.0E-23
sp|Q47N79|ARGC_THEFY N-acetyl-gamma-glutamyl-phosphate reductase OS=Thermobifida fusca (strain YX) GN=argC PE=3 SV=1 568 878 2.0E-23
sp|A9A8M9|ARGB_METM6 Acetylglutamate kinase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=argB PE=3 SV=1 84 336 2.0E-23
sp|Q089L1|ARGC_SHEFN N-acetyl-gamma-glutamyl-phosphate reductase OS=Shewanella frigidimarina (strain NCIMB 400) GN=argC PE=3 SV=1 564 870 2.0E-23
sp|P59305|ARGC_BIFLO N-acetyl-gamma-glutamyl-phosphate reductase OS=Bifidobacterium longum (strain NCC 2705) GN=argC PE=3 SV=1 564 877 2.0E-23
sp|Q7UQZ8|ARGB_RHOBA Acetylglutamate kinase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=argB PE=3 SV=1 86 336 2.0E-23
sp|Q7V1H9|ARGC_PROMP N-acetyl-gamma-glutamyl-phosphate reductase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=argC PE=3 SV=1 563 870 3.0E-23
sp|Q2GFI0|ARGC_EHRCR N-acetyl-gamma-glutamyl-phosphate reductase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=argC PE=3 SV=1 564 873 3.0E-23
sp|Q8YRB1|ARGC1_NOSS1 N-acetyl-gamma-glutamyl-phosphate reductase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=argC1 PE=3 SV=1 564 880 3.0E-23
sp|B9KP00|ARGB_RHOSK Acetylglutamate kinase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=argB PE=3 SV=1 85 335 3.0E-23
sp|Q3IYY2|ARGB_RHOS4 Acetylglutamate kinase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=argB PE=3 SV=1 85 335 3.0E-23
sp|A3PNB5|ARGB_RHOS1 Acetylglutamate kinase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=argB PE=3 SV=1 85 335 3.0E-23
sp|Q7NEE9|ARGB_GLOVI Acetylglutamate kinase OS=Gloeobacter violaceus (strain PCC 7421) GN=argB PE=3 SV=1 85 266 4.0E-23
sp|A6UT97|ARGB_META3 Acetylglutamate kinase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=argB PE=3 SV=1 89 336 4.0E-23
sp|Q97GH8|ARGB_CLOAB Acetylglutamate kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=argB PE=3 SV=1 76 272 4.0E-23
sp|B3DSZ3|ARGC_BIFLD N-acetyl-gamma-glutamyl-phosphate reductase OS=Bifidobacterium longum (strain DJO10A) GN=argC PE=3 SV=1 564 877 4.0E-23
sp|Q74GU4|ARGB_GEOSL Acetylglutamate kinase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=argB PE=3 SV=1 71 336 5.0E-23
sp|A8M8Q9|ARGC_CALMQ N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=argC PE=3 SV=1 563 877 5.0E-23
sp|B1J4L7|ARGB_PSEPW Acetylglutamate kinase OS=Pseudomonas putida (strain W619) GN=argB PE=3 SV=1 71 334 5.0E-23
sp|B1YJL9|ARGC_EXIS2 N-acetyl-gamma-glutamyl-phosphate reductase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=argC PE=3 SV=1 563 877 5.0E-23
sp|C5CHW9|ARGB_KOSOT Acetylglutamate kinase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=argB PE=3 SV=1 89 335 6.0E-23
sp|Q7VJR4|ARGB_HELHP Acetylglutamate kinase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=argB PE=3 SV=1 79 337 6.0E-23
sp|Q46GS3|ARGB_PROMT Acetylglutamate kinase OS=Prochlorococcus marinus (strain NATL2A) GN=argB PE=3 SV=1 85 334 7.0E-23
sp|A5CXF1|ARGB_VESOH Acetylglutamate kinase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=argB PE=3 SV=1 85 334 7.0E-23
sp|B9KZP8|ARGC_THERP N-acetyl-gamma-glutamyl-phosphate reductase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=argC PE=3 SV=1 564 877 9.0E-23
sp|A0LEB5|ARGB_SYNFM Acetylglutamate kinase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=argB PE=3 SV=1 71 340 9.0E-23
sp|Q7VBZ8|ARGC_PROMA N-acetyl-gamma-glutamyl-phosphate reductase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=argC PE=3 SV=1 555 880 1.0E-22
sp|Q46D93|ARGB_METBF Acetylglutamate kinase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=argB PE=3 SV=1 87 339 1.0E-22
sp|Q6M154|ARGB_METMP Acetylglutamate kinase OS=Methanococcus maripaludis (strain S2 / LL) GN=argB PE=3 SV=1 89 336 1.0E-22
sp|A2RM00|ARGB_LACLM Acetylglutamate kinase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=argB PE=3 SV=1 76 336 1.0E-22
sp|A6VED0|ARGB_PSEA7 Acetylglutamate kinase OS=Pseudomonas aeruginosa (strain PA7) GN=argB PE=3 SV=1 50 334 1.0E-22
sp|Q72RJ9|ARGC_LEPIC N-acetyl-gamma-glutamyl-phosphate reductase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=argC PE=3 SV=1 562 877 2.0E-22
sp|Q8PXJ8|ARGB_METMA Acetylglutamate kinase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=argB PE=3 SV=1 89 334 2.0E-22
sp|Q3ALS4|ARGB_SYNSC Acetylglutamate kinase OS=Synechococcus sp. (strain CC9605) GN=argB PE=3 SV=1 71 334 2.0E-22
sp|Q1I2T9|ARGB_PSEE4 Acetylglutamate kinase OS=Pseudomonas entomophila (strain L48) GN=argB PE=3 SV=1 71 334 2.0E-22
sp|A5GSD0|ARGB_SYNR3 Acetylglutamate kinase OS=Synechococcus sp. (strain RCC307) GN=argB PE=3 SV=1 85 334 2.0E-22
sp|Q7U5C7|ARGB_SYNPX Acetylglutamate kinase OS=Synechococcus sp. (strain WH8102) GN=argB PE=3 SV=1 71 334 2.0E-22
sp|A3CRT9|ARGB_METMJ Acetylglutamate kinase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=argB PE=3 SV=1 89 334 2.0E-22
sp|Q9HTN2|ARGB_PSEAE Acetylglutamate kinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=argB PE=1 SV=3 50 334 3.0E-22
sp|Q02E39|ARGB_PSEAB Acetylglutamate kinase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=argB PE=3 SV=1 50 334 3.0E-22
sp|B7V5L4|ARGB_PSEA8 Acetylglutamate kinase OS=Pseudomonas aeruginosa (strain LESB58) GN=argB PE=3 SV=1 50 334 3.0E-22
sp|P59300|ARGB_PSEPK Acetylglutamate kinase OS=Pseudomonas putida (strain KT2440) GN=argB PE=3 SV=1 71 334 3.0E-22
sp|A5WB06|ARGB_PSEP1 Acetylglutamate kinase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=argB PE=3 SV=1 71 334 3.0E-22
sp|A2BWM0|ARGC_PROM5 N-acetyl-gamma-glutamyl-phosphate reductase OS=Prochlorococcus marinus (strain MIT 9515) GN=argC PE=3 SV=1 563 870 3.0E-22
sp|A1AVQ7|ARGB_RUTMC Acetylglutamate kinase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=argB PE=3 SV=1 71 334 3.0E-22
sp|O87890|ARGC_NOSEL N-acetyl-gamma-glutamyl-phosphate reductase OS=Nostoc ellipsosporum GN=argC PE=3 SV=1 564 880 4.0E-22
sp|A2BR42|ARGC_PROMS N-acetyl-gamma-glutamyl-phosphate reductase OS=Prochlorococcus marinus (strain AS9601) GN=argC PE=3 SV=1 563 877 4.0E-22
sp|A6VI50|ARGB_METM7 Acetylglutamate kinase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=argB PE=3 SV=1 88 336 4.0E-22
sp|Q31ED4|ARGB_THICR Acetylglutamate kinase OS=Thiomicrospira crunogena (strain XCL-2) GN=argB PE=3 SV=2 60 334 4.0E-22
sp|A7GXW0|ARGB_CAMC5 Acetylglutamate kinase OS=Campylobacter curvus (strain 525.92) GN=argB PE=3 SV=1 85 335 4.0E-22
sp|A1KTW0|ARGB_NEIMF Acetylglutamate kinase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=argB PE=3 SV=1 71 337 5.0E-22
sp|Q4FU68|ARGB_PSYA2 Acetylglutamate kinase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=argB PE=3 SV=1 85 336 5.0E-22
sp|Q39Z75|ARGB_GEOMG Acetylglutamate kinase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=argB PE=3 SV=1 71 336 5.0E-22
sp|A4Y0L1|ARGB_PSEMY Acetylglutamate kinase OS=Pseudomonas mendocina (strain ymp) GN=argB PE=3 SV=1 71 334 5.0E-22
sp|Q7VD84|ARGB_PROMA Acetylglutamate kinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=argB PE=3 SV=1 85 334 5.0E-22
sp|C1DI53|ARGB_AZOVD Acetylglutamate kinase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=argB PE=3 SV=1 50 334 5.0E-22
sp|A0QHB4|ARGC_MYCA1 N-acetyl-gamma-glutamyl-phosphate reductase OS=Mycobacterium avium (strain 104) GN=argC PE=3 SV=1 563 877 6.0E-22
sp|Q1QDA2|ARGB_PSYCK Acetylglutamate kinase OS=Psychrobacter cryohalolentis (strain K5) GN=argB PE=3 SV=1 85 336 7.0E-22
sp|Q030G2|ARGB_LACLS Acetylglutamate kinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=argB PE=3 SV=1 74 336 7.0E-22
sp|A3Q9C6|ARGC_SHELP N-acetyl-gamma-glutamyl-phosphate reductase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=argC PE=3 SV=1 564 871 7.0E-22
sp|A5GJC5|ARGB_SYNPW Acetylglutamate kinase OS=Synechococcus sp. (strain WH7803) GN=argB PE=3 SV=1 85 334 8.0E-22
sp|B0KQ91|ARGB_PSEPG Acetylglutamate kinase OS=Pseudomonas putida (strain GB-1) GN=argB PE=3 SV=1 71 334 8.0E-22
sp|Q0ADI4|ARGB_NITEC Acetylglutamate kinase OS=Nitrosomonas eutropha (strain C91) GN=argB PE=3 SV=1 46 335 8.0E-22
sp|Q9CHD5|ARGC_LACLA N-acetyl-gamma-glutamyl-phosphate reductase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=argC PE=3 SV=1 563 880 8.0E-22
sp|Q5HA98|ARGC_EHRRW N-acetyl-gamma-glutamyl-phosphate reductase OS=Ehrlichia ruminantium (strain Welgevonden) GN=argC PE=3 SV=1 564 873 9.0E-22
sp|Q5FGD5|ARGC_EHRRG N-acetyl-gamma-glutamyl-phosphate reductase OS=Ehrlichia ruminantium (strain Gardel) GN=argC PE=3 SV=1 564 873 9.0E-22
sp|Q740I9|ARGC_MYCPA N-acetyl-gamma-glutamyl-phosphate reductase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=argC PE=3 SV=1 563 877 1.0E-21
sp|P59307|ARGC_LEPIN N-acetyl-gamma-glutamyl-phosphate reductase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=argC PE=3 SV=1 562 877 1.0E-21
sp|B4RLF4|ARGB_NEIG2 Acetylglutamate kinase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=argB PE=3 SV=1 71 334 1.0E-21
sp|Q0RFA8|ARGB_FRAAA Acetylglutamate kinase OS=Frankia alni (strain ACN14a) GN=argB PE=3 SV=1 89 334 1.0E-21
sp|Q9CHD2|ARGB_LACLA Acetylglutamate kinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=argB PE=3 SV=1 76 336 1.0E-21
sp|Q603M3|ARGB_METCA Acetylglutamate kinase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=argB PE=3 SV=1 71 336 1.0E-21
sp|B1ZUD7|ARGB_OPITP Acetylglutamate kinase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=argB PE=3 SV=1 89 332 1.0E-21
sp|B3E9Y3|ARGB_GEOLS Acetylglutamate kinase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=argB PE=3 SV=1 71 336 1.0E-21
sp|B0UPC4|ARGC_METS4 N-acetyl-gamma-glutamyl-phosphate reductase OS=Methylobacterium sp. (strain 4-46) GN=argC PE=3 SV=1 563 877 1.0E-21
sp|Q5F8D8|ARGB_NEIG1 Acetylglutamate kinase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=argB PE=3 SV=1 71 334 1.0E-21
sp|Q051G7|ARGC_LEPBL N-acetyl-gamma-glutamyl-phosphate reductase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=argC PE=3 SV=1 562 877 2.0E-21
sp|Q04T45|ARGC_LEPBJ N-acetyl-gamma-glutamyl-phosphate reductase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=argC PE=3 SV=1 562 877 2.0E-21
sp|A4VGS4|ARGB_PSEU5 Acetylglutamate kinase OS=Pseudomonas stutzeri (strain A1501) GN=argB PE=3 SV=1 68 334 2.0E-21
sp|Q3A9W2|ARGB_CARHZ Acetylglutamate kinase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=argB PE=3 SV=1 71 334 2.0E-21
sp|Q8THJ9|ARGB_METAC Acetylglutamate kinase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=argB PE=3 SV=1 87 334 2.0E-21
sp|Q2J862|ARGB_FRASC Acetylglutamate kinase OS=Frankia sp. (strain CcI3) GN=argB PE=3 SV=1 89 334 2.0E-21
sp|Q6B8Z0|ARGB_GRATL Acetylglutamate kinase OS=Gracilaria tenuistipitata var. liui GN=argB PE=3 SV=1 86 262 2.0E-21
sp|Q21EE9|ARGB_SACD2 Acetylglutamate kinase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=argB PE=3 SV=1 71 334 2.0E-21
sp|Q1XDF8|ARGB_PYRYE Acetylglutamate kinase OS=Pyropia yezoensis GN=argB PE=3 SV=2 71 277 2.0E-21
sp|B8D1G8|ARGB_HALOH Acetylglutamate kinase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=argB PE=3 SV=1 89 334 3.0E-21
sp|Q3SFH1|ARGB_THIDA Acetylglutamate kinase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=argB PE=3 SV=1 85 336 3.0E-21
sp|Q9JUK2|ARGB_NEIMA Acetylglutamate kinase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=argB PE=3 SV=1 71 337 3.0E-21
sp|Q9JZF7|ARGB_NEIMB Acetylglutamate kinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=argB PE=3 SV=1 71 337 4.0E-21
sp|P54894|ARGC2_NOSS1 N-acetyl-gamma-glutamyl-phosphate reductase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=argC2 PE=3 SV=1 629 877 4.0E-21
sp|A8Z5X3|ARGC_SULMW N-acetyl-gamma-glutamyl-phosphate reductase OS=Sulcia muelleri (strain GWSS) GN=argC PE=3 SV=1 572 873 4.0E-21
sp|Q04WW3|ARGB_LEPBL Acetylglutamate kinase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=argB PE=3 SV=1 84 334 5.0E-21
sp|A1U6L0|ARGB_MARHV Acetylglutamate kinase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=argB PE=3 SV=1 63 336 6.0E-21
sp|B0BSQ0|ARGB_ACTPJ Acetylglutamate kinase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=argB PE=3 SV=1 85 263 6.0E-21
sp|B3H084|ARGB_ACTP7 Acetylglutamate kinase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=argB PE=3 SV=1 85 263 7.0E-21
sp|Q6AR56|ARGB_DESPS Acetylglutamate kinase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=argB PE=3 SV=1 85 277 7.0E-21
sp|Q2YA02|ARGB_NITMU Acetylglutamate kinase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=argB PE=3 SV=1 85 335 8.0E-21
sp|Q9SCL7|NAGK_ARATH Acetylglutamate kinase, chloroplastic OS=Arabidopsis thaliana GN=NAGK PE=1 SV=1 89 334 8.0E-21
sp|Q1GZ15|ARGB_METFK Acetylglutamate kinase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=argB PE=3 SV=1 71 334 8.0E-21
sp|Q820N1|ARGB_NITEU Acetylglutamate kinase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=argB PE=3 SV=1 71 335 8.0E-21
sp|Q2SN65|ARGB_HAHCH Acetylglutamate kinase OS=Hahella chejuensis (strain KCTC 2396) GN=argB PE=3 SV=1 85 336 8.0E-21
sp|Q0I8J0|ARGB_SYNS3 Acetylglutamate kinase OS=Synechococcus sp. (strain CC9311) GN=argB PE=3 SV=1 85 334 8.0E-21
sp|Q28UR2|ARGB_JANSC Acetylglutamate kinase OS=Jannaschia sp. (strain CCS1) GN=argB PE=3 SV=1 71 335 1.0E-20
sp|Q2NGV4|ARGB_METST Acetylglutamate kinase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=argB PE=3 SV=1 71 336 1.0E-20
sp|A1ATU7|ARGB_PELPD Acetylglutamate kinase OS=Pelobacter propionicus (strain DSM 2379) GN=argB PE=3 SV=1 85 336 1.0E-20
sp|B0CD68|ARGC_ACAM1 N-acetyl-gamma-glutamyl-phosphate reductase OS=Acaryochloris marina (strain MBIC 11017) GN=argC PE=3 SV=1 564 880 1.0E-20
sp|Q4A0M9|ARGB_STAS1 Acetylglutamate kinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=argB PE=3 SV=1 87 248 1.0E-20
sp|P59299|ARGB_LEPIN Acetylglutamate kinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=argB PE=3 SV=1 79 335 1.0E-20
sp|Q75FU1|ARGB_LEPIC Acetylglutamate kinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=argB PE=3 SV=1 79 335 1.0E-20
sp|Q4K3S0|ARGB_PSEF5 Acetylglutamate kinase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=argB PE=3 SV=1 89 334 1.0E-20
sp|A4Z1S1|ARGC_BRASO N-acetyl-gamma-glutamyl-phosphate reductase OS=Bradyrhizobium sp. (strain ORS278) GN=argC PE=3 SV=1 563 877 1.0E-20
sp|B0SIF3|ARGB_LEPBA Acetylglutamate kinase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=argB PE=3 SV=1 84 337 1.0E-20
sp|A9LYZ5|ARGB_NEIM0 Acetylglutamate kinase OS=Neisseria meningitidis serogroup C (strain 053442) GN=argB PE=3 SV=1 71 337 1.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0051287 NAD binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2499
MLSAAASTALRAGCRRAVPRAATAAPRRLRCSRRLLCRSLSTARPLAAPLARDRTREIVAQTVSSIGSKREGQQY
LKLFTSVSSQRFAVIKVGGAILTEHLAELCRSLLFLYELGLYPIIVHGAGPQLNRLLEEAGVEPQFEEGIRVTDA
KTLGIARKLFLEENLKLIDRLDELGVQTRTLSGVFIADYLDKDKWQYVGRITKVNKDVIERSIEAGYIPVLTSMA
ETEDGRLLNVNADVAAAELARALEPLKVVYLSEKGGLFDGDGQKISHINLDEEFGHLMAQPWCRYGTRLKIKQIK
ELLDTLPRSSSVAIIHPSDLQKELFTDSGAGTLIRRGDKIQKMTSIPDFGDVAKLKATLIRDREGLDADATVDRW
IDYLGENPFTAYCDEAMQCLAIVMPPGNGRPMATLATLTITKSGWLTNIAENVFAAIKKDFPSMVWTVNGADENL
TWFFEKADGSFSSNGSVLFYYGCDLRSEDLSPVYDEFMAHGRAMLGGSNLESRLRQAAQGASQPPSRPRLAAQGA
RGFSTLGRAASQRRGLATTTNPNPPLGKKNASNTVPARVGLIGARGYTGQALIDLLNAHPFMDLRHVSSRELAGQ
QLQGYSKREITYENLGPEDVGRLEKSGDIDCWVMALPNGVCRPYLEAIDEASKGRDKRSVIVDLSADYRFDGSWT
YGLPELTKRSDICQAQRISNPGCYATAAQLGIAPVLEHLGGQPTVFGVSGYSGAGTKPSAKNDVNQLRDNLMPYS
LTDHIHEREISSQLGTPVAFIPHVASWFRGIHHTINIPLNKTMTSRDIRQMYQDRYAGEKLVKVVGEAPLVKSIM
DKHGVEIGGFAVHSSGKRVVVCASIDNLLKGAATQCLQNMNLALGYGEFEGIPTM*
Coding >Hirsu2|2499
ATGCTGTCCGCTGCTGCGTCTACCGCCCTGAGGGCTGGCTGTCGCCGTGCCGTCCCCCGGGCTGCGACCGCGGCG
CCGAGGAGGCTCCGATGCTCCCGTCGTCTCCTCTGCCGCTCGCTCTCTACTGCCCGTCCTCTGGCCGCGCCCCTG
GCCCGGGACCGGACGCGCGAGATTGTCGCCCAGACGGTCAGCAGCATCGGCAGCAAGCGCGAGGGTCAGCAGTAC
CTCAAGCTCTTCACCTCCGTCTCCTCCCAGCGCTTCGCCGTCATCAAGGTCGGCGGCGCCATCCTGACCGAGCAC
CTGGCCGAGCTGTGCCGCAGCCTGCTCTTCCTCTACGAGCTCGGTCTCTACCCCATCATCGTCCACGGCGCCGGC
CCCCAGCTCAACCGTCTGCTGGAGGAGGCCGGCGTCGAGCCCCAATTCGAGGAGGGCATCCGCGTCACCGACGCC
AAGACGCTCGGCATCGCCCGCAAGCTGTTCCTCGAGGAGAACCTCAAGCTGATCGACCGCCTCGACGAGCTCGGC
GTCCAGACCCGCACCCTGAGCGGCGTCTTCATCGCCGACTACCTCGACAAGGACAAGTGGCAGTACGTCGGCAGG
ATCACAAAGGTCAACAAGGACGTCATCGAGAGGTCCATCGAGGCCGGCTACATCCCGGTCCTCACCTCCATGGCC
GAGACGGAGGACGGCCGCCTGCTCAACGTCAATGCCGACGTGGCCGCCGCCGAGCTCGCCCGCGCCCTCGAGCCG
CTCAAGGTCGTCTACCTGTCCGAGAAGGGCGGTCTGTTCGACGGTGACGGCCAGAAGATCTCCCACATCAACCTC
GACGAGGAGTTCGGCCATCTGATGGCGCAGCCCTGGTGCCGCTACGGCACGCGCCTCAAGATCAAGCAGATCAAG
GAGCTGCTCGACACCCTCCCGCGAAGCTCGAGCGTCGCCATCATCCACCCGAGCGACCTGCAGAAGGAGCTGTTC
ACCGACTCGGGTGCCGGCACCCTGATCCGCCGCGGCGACAAGATACAGAAGATGACGTCCATCCCCGACTTCGGC
GACGTCGCCAAGCTCAAGGCCACCCTGATCCGAGACCGGGAAGGCCTCGATGCCGACGCGACCGTCGACCGATGG
ATCGACTACCTCGGCGAGAATCCCTTCACCGCCTACTGCGACGAGGCCATGCAGTGCCTCGCCATCGTCATGCCG
CCCGGCAACGGCCGCCCCATGGCCACCCTCGCCACCCTGACCATCACCAAGTCCGGCTGGCTGACCAATATCGCC
GAGAACGTCTTCGCCGCCATCAAGAAGGACTTCCCCAGTATGGTCTGGACCGTCAACGGGGCCGACGAGAACCTG
ACCTGGTTCTTCGAGAAGGCCGACGGCAGCTTCAGCAGTAACGGCAGCGTGCTCTTCTACTACGGCTGCGATCTG
CGCTCCGAGGACTTGTCGCCCGTCTACGACGAGTTCATGGCCCACGGCCGGGCCATGCTGGGCGGCTCCAACCTC
GAGTCTCGGCTCCGGCAGGCGGCCCAGGGCGCCAGTCAGCCGCCCAGCCGCCCGCGTCTCGCCGCCCAGGGCGCC
AGGGGCTTCTCCACGCTGGGACGCGCCGCGAGCCAGCGGCGGGGCTTGGCGACGACGACGAACCCGAACCCGCCG
CTGGGCAAGAAGAACGCGTCCAACACGGTGCCGGCCCGCGTCGGCCTGATCGGCGCGCGCGGATACACAGGCCAG
GCTCTGATCGACCTGCTCAACGCGCACCCGTTCATGGACCTCAGGCACGTGTCGTCGCGCGAGCTGGCGGGCCAG
CAGCTGCAGGGCTACTCGAAGCGGGAGATTACGTACGAGAACCTCGGGCCCGAGGACGTCGGCCGGCTGGAGAAG
AGCGGGGACATCGACTGCTGGGTCATGGCGCTGCCCAACGGCGTGTGCAGGCCGTACCTGGAGGCCATCGACGAG
GCGAGCAAGGGCCGCGACAAGAGGAGCGTCATCGTTGACCTCTCGGCCGACTACCGCTTCGACGGCAGTTGGACG
TACGGCCTGCCGGAGCTGACGAAGCGGTCCGACATATGCCAGGCGCAGCGCATCTCCAACCCCGGCTGCTACGCC
ACGGCGGCGCAGCTGGGCATCGCGCCCGTGCTGGAGCACCTGGGCGGGCAGCCGACCGTCTTCGGCGTGTCGGGC
TACTCGGGCGCGGGGACCAAGCCGTCGGCCAAGAACGACGTGAACCAGCTGCGCGACAACCTGATGCCCTACAGC
CTGACGGACCACATCCACGAGCGCGAGATCAGCAGCCAGCTGGGCACGCCGGTGGCCTTCATCCCGCACGTCGCC
TCGTGGTTCCGCGGCATCCACCACACCATCAACATCCCGCTCAACAAGACGATGACGTCGCGCGACATCCGGCAG
ATGTACCAGGACCGGTACGCGGGCGAGAAGCTGGTCAAGGTGGTCGGCGAGGCGCCGCTGGTCAAGAGCATCATG
GACAAGCACGGCGTCGAGATCGGCGGCTTCGCCGTCCACAGCAGCGGGAAGCGCGTGGTGGTGTGCGCGAGCATC
GACAACCTGCTCAAGGGCGCCGCGACCCAATGCCTGCAAAACATGAACCTGGCCCTGGGATACGGCGAGTTTGAG
GGCATCCCCACCATGTGA
Transcript >Hirsu2|2499
ATGCTGTCCGCTGCTGCGTCTACCGCCCTGAGGGCTGGCTGTCGCCGTGCCGTCCCCCGGGCTGCGACCGCGGCG
CCGAGGAGGCTCCGATGCTCCCGTCGTCTCCTCTGCCGCTCGCTCTCTACTGCCCGTCCTCTGGCCGCGCCCCTG
GCCCGGGACCGGACGCGCGAGATTGTCGCCCAGACGGTCAGCAGCATCGGCAGCAAGCGCGAGGGTCAGCAGTAC
CTCAAGCTCTTCACCTCCGTCTCCTCCCAGCGCTTCGCCGTCATCAAGGTCGGCGGCGCCATCCTGACCGAGCAC
CTGGCCGAGCTGTGCCGCAGCCTGCTCTTCCTCTACGAGCTCGGTCTCTACCCCATCATCGTCCACGGCGCCGGC
CCCCAGCTCAACCGTCTGCTGGAGGAGGCCGGCGTCGAGCCCCAATTCGAGGAGGGCATCCGCGTCACCGACGCC
AAGACGCTCGGCATCGCCCGCAAGCTGTTCCTCGAGGAGAACCTCAAGCTGATCGACCGCCTCGACGAGCTCGGC
GTCCAGACCCGCACCCTGAGCGGCGTCTTCATCGCCGACTACCTCGACAAGGACAAGTGGCAGTACGTCGGCAGG
ATCACAAAGGTCAACAAGGACGTCATCGAGAGGTCCATCGAGGCCGGCTACATCCCGGTCCTCACCTCCATGGCC
GAGACGGAGGACGGCCGCCTGCTCAACGTCAATGCCGACGTGGCCGCCGCCGAGCTCGCCCGCGCCCTCGAGCCG
CTCAAGGTCGTCTACCTGTCCGAGAAGGGCGGTCTGTTCGACGGTGACGGCCAGAAGATCTCCCACATCAACCTC
GACGAGGAGTTCGGCCATCTGATGGCGCAGCCCTGGTGCCGCTACGGCACGCGCCTCAAGATCAAGCAGATCAAG
GAGCTGCTCGACACCCTCCCGCGAAGCTCGAGCGTCGCCATCATCCACCCGAGCGACCTGCAGAAGGAGCTGTTC
ACCGACTCGGGTGCCGGCACCCTGATCCGCCGCGGCGACAAGATACAGAAGATGACGTCCATCCCCGACTTCGGC
GACGTCGCCAAGCTCAAGGCCACCCTGATCCGAGACCGGGAAGGCCTCGATGCCGACGCGACCGTCGACCGATGG
ATCGACTACCTCGGCGAGAATCCCTTCACCGCCTACTGCGACGAGGCCATGCAGTGCCTCGCCATCGTCATGCCG
CCCGGCAACGGCCGCCCCATGGCCACCCTCGCCACCCTGACCATCACCAAGTCCGGCTGGCTGACCAATATCGCC
GAGAACGTCTTCGCCGCCATCAAGAAGGACTTCCCCAGTATGGTCTGGACCGTCAACGGGGCCGACGAGAACCTG
ACCTGGTTCTTCGAGAAGGCCGACGGCAGCTTCAGCAGTAACGGCAGCGTGCTCTTCTACTACGGCTGCGATCTG
CGCTCCGAGGACTTGTCGCCCGTCTACGACGAGTTCATGGCCCACGGCCGGGCCATGCTGGGCGGCTCCAACCTC
GAGTCTCGGCTCCGGCAGGCGGCCCAGGGCGCCAGTCAGCCGCCCAGCCGCCCGCGTCTCGCCGCCCAGGGCGCC
AGGGGCTTCTCCACGCTGGGACGCGCCGCGAGCCAGCGGCGGGGCTTGGCGACGACGACGAACCCGAACCCGCCG
CTGGGCAAGAAGAACGCGTCCAACACGGTGCCGGCCCGCGTCGGCCTGATCGGCGCGCGCGGATACACAGGCCAG
GCTCTGATCGACCTGCTCAACGCGCACCCGTTCATGGACCTCAGGCACGTGTCGTCGCGCGAGCTGGCGGGCCAG
CAGCTGCAGGGCTACTCGAAGCGGGAGATTACGTACGAGAACCTCGGGCCCGAGGACGTCGGCCGGCTGGAGAAG
AGCGGGGACATCGACTGCTGGGTCATGGCGCTGCCCAACGGCGTGTGCAGGCCGTACCTGGAGGCCATCGACGAG
GCGAGCAAGGGCCGCGACAAGAGGAGCGTCATCGTTGACCTCTCGGCCGACTACCGCTTCGACGGCAGTTGGACG
TACGGCCTGCCGGAGCTGACGAAGCGGTCCGACATATGCCAGGCGCAGCGCATCTCCAACCCCGGCTGCTACGCC
ACGGCGGCGCAGCTGGGCATCGCGCCCGTGCTGGAGCACCTGGGCGGGCAGCCGACCGTCTTCGGCGTGTCGGGC
TACTCGGGCGCGGGGACCAAGCCGTCGGCCAAGAACGACGTGAACCAGCTGCGCGACAACCTGATGCCCTACAGC
CTGACGGACCACATCCACGAGCGCGAGATCAGCAGCCAGCTGGGCACGCCGGTGGCCTTCATCCCGCACGTCGCC
TCGTGGTTCCGCGGCATCCACCACACCATCAACATCCCGCTCAACAAGACGATGACGTCGCGCGACATCCGGCAG
ATGTACCAGGACCGGTACGCGGGCGAGAAGCTGGTCAAGGTGGTCGGCGAGGCGCCGCTGGTCAAGAGCATCATG
GACAAGCACGGCGTCGAGATCGGCGGCTTCGCCGTCCACAGCAGCGGGAAGCGCGTGGTGGTGTGCGCGAGCATC
GACAACCTGCTCAAGGGCGCCGCGACCCAATGCCTGCAAAACATGAACCTGGCCCTGGGATACGGCGAGTTTGAG
GGCATCCCCACCATGTGA
Gene >Hirsu2|2499
ATGCTGTCCGCTGCTGCGTCTACCGCCCTGAGGGCTGGCTGTCGCCGTGCCGTCCCCCGGGCTGCGACCGCGGCG
CCGAGGAGGCTCCGATGCTCCCGTCGTCTCCTCTGCCGCTCGCTCTCTACTGCCCGTCCTCTGGCCGCGCCCCTG
GCCCGGGACCGGACGCGCGAGATTGTCGCCCAGACGGTCAGCAGCATCGGCAGCAAGCGCGAGGGTCAGCAGTAC
CTCAAGCTCTTCACCTCCGTCTCCTCCCAGCGCTTCGCCGTCATCAAGGTCGGCGGCGCCATCCTGACCGAGCAC
CTGGCCGAGCTGTGCCGCAGCCTGCTCTTCCTCTACGAGCTCGGTCTCTACCCCATCATCGTCCACGGCGCCGGC
CCCCAGCTCAACCGTCTGCTGGAGGAGGCCGGCGTCGAGCCCCAATTCGAGGAGGGCATCCGCGTCACCGACGCC
AAGACGCTCGGCATCGCCCGCAAGCTGTTCCTCGAGGAGAACCTCAAGCTGATCGACCGCCTCGACGAGCTCGGC
GTCCAGACCCGCACCCTGAGCGGCGTCTTCATCGCCGACTACCTCGACAAGGACAAGTGGCAGTACGTCGGCAGG
ATCACAAAGGTCAACAAGGACGTCATCGAGAGGTCCATCGAGGCCGGCTACATCCCGGTCCTCACCTCCATGGCC
GAGACGGAGGACGGCCGCCTGCTCAACGTCAATGCCGACGTGGCCGCCGCCGAGCTCGCCCGCGCCCTCGAGCCG
CTCAAGGTCGTCTACCTGTCCGAGAAGGGCGGTCTGTTCGACGGTGACGGCCAGAAGATCTCCCACATCAACCTC
GACGAGGAGTTCGGCCATCTGATGGCGCAGCCCTGGTGCCGCTACGGCACGCGCCTCAAGATCAAGCAGATCAAG
GAGCTGCTCGACACCCTCCCGCGAAGCTCGAGCGTCGCCATCATCCACCCGAGCGACCTGCAGAAGGAGCTGTTC
ACCGACTCGGGTGCCGGCACCCTGATCCGCCGCGGCGACAAGATACAGAAGATGACGTCCATCCCCGACTTCGGC
GACGTCGCCAAGCTCAAGGCCACCCTGATCCGAGACCGGGAAGGCCTCGATGCCGACGCGACCGTCGACCGATGG
ATCGACTACCTCGGCGAGAATCCCTTCACCGCCTACTGCGACGAGGCCATGCAGTGCCTCGCCATCGTCATGCCG
CCCGGCAACGGCCGCCCCATGGCCACCCTCGCCACCCTGACCATCACCAAGTCCGGCTGGCTGACCAATATCGCC
GAGAACGTCTTCGCCGCCATCAAGAAGGACTTCCCCAGTATGGTCTGGACCGTCAACGGGGCCGACGAGAACCTG
ACCTGGTTCTTCGAGAAGGCCGACGGCAGCTTCAGCAGTAACGGCAGCGTGCTCTTCTACTACGGCTGCGATCTG
CGCTCCGAGGACTTGTCGCCCGTCTACGACGAGTTCATGGCCCACGGCCGGGCCATGCTGGGCGGCTCCAACCTC
GAGTCTCGGCTCCGGCAGGCGGCCCAGGGCGCCAGTCAGCCGCCCAGCCGCCCGCGTCTCGCCGCCCAGGGCGCC
AGGGGCTTCTCCACGCTGGGACGCGCCGCGAGCCAGCGGCGGGGCTTGGCGACGACGACGAACCCGAACCCGCCG
CTGGGCAAGAAGAACGCGTCCAACACGGTGCCGGCCCGCGTCGGCCTGATCGGCGCGCGCGGATACACAGGCCAG
GCTCTGATCGACCTGCTCAACGCGCACCCGTTCATGGACCTCAGGCACGTGTCGTCGCGCGAGCTGGCGGGCCAG
CAGCTGCAGGGCTACTCGAAGCGGGAGATTACGTACGAGAACCTCGGGCCCGAGGACGTCGGCCGGCTGGAGAAG
AGCGGGGACATCGACTGCTGGGTCATGGCGCTGCCCAACGGCGTGTGCAGGCCGTACCTGGAGGCCATCGACGAG
GCGAGCAAGGGCCGCGACAAGAGGAGCGTCATCGTTGACCTCTCGGCCGACTACCGCTTCGACGGCAGTTGGACG
TACGGCCTGCCGGAGCTGACGAAGCGGTCCGACATATGCCAGGCGCAGCGCATCTCCAACCCCGGCTGCTACGCC
ACGGCGGCGCAGCTGGGCATCGCGCCCGTGCTGGAGCACCTGGGCGGGCAGCCGACCGTCTTCGGCGTGTCGGGC
TACTCGGGCGCGGGGACCAAGCCGTCGGCCAAGAACGACGTGAACCAGCTGCGCGACAACCTGATGCCCTACAGC
CTGACGGACCACATCCACGAGCGCGAGATCAGCAGCCAGCTGGGCACGCCGGTGGCCTTCATCCCGCACGTCGCC
TCGTGGTTCCGCGGCATCCACCACACCATCAACATCCCGCTCAACAAGACGATGACGTCGCGCGACATCCGGCAG
ATGTACCAGGACCGGTACGCGGGCGAGAAGCTGGTCAAGGTGGTCGGCGAGGCGCCGCTGGTCAAGAGCATCATG
GACAAGCACGGCGTCGAGATCGGCGGCTTCGCCGTCCACAGCAGCGGGAAGCGCGTGGTGGTGTGCGCGAGCATC
GACAACCTGCTCAAGGGCGCCGCGACCCAATGCCTGCGTAAGTTTCGTCTCTGTTGGCTTGTCACCCTACGACTC
GACGTTTGGGCGAGTCGACGTTCGGCCGACTTTCGTGTGCTGACGTGGACCGAACAGAAAACATGAACCTGGCCC
TGGGATACGGCGAGTTTGAGGGCATCCCCACCATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail