Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2494
Gene name
LocationContig_16:25263..26834
Strand-
Gene length (bp)1571
Transcript length (bp)1506
Coding sequence length (bp)1506
Protein length (aa) 502

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 1.9E-16 244 422

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N0N3|BGBP_PENMO Beta-1,3-glucan-binding protein OS=Penaeus monodon PE=2 SV=1 164 493 5.0E-58
sp|Q9NJ98|BGBP1_MANSE Beta-1,3-glucan-binding protein 1 OS=Manduca sexta PE=1 SV=1 166 492 1.0E-27
sp|Q9NHB0|BGBP1_DROME Gram-negative bacteria-binding protein 1 OS=Drosophila melanogaster GN=GNBP1 PE=2 SV=2 206 489 1.0E-25
sp|Q76DI2|BGBP_TENMO Beta-1,3-glucan-binding protein OS=Tenebrio molitor GN=GRP PE=1 SV=1 175 489 3.0E-24
sp|P23903|E13B_BACCI Glucan endo-1,3-beta-glucosidase A1 OS=Bacillus circulans GN=glcA PE=1 SV=1 188 471 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N0N3|BGBP_PENMO Beta-1,3-glucan-binding protein OS=Penaeus monodon PE=2 SV=1 164 493 5.0E-58
sp|Q9NJ98|BGBP1_MANSE Beta-1,3-glucan-binding protein 1 OS=Manduca sexta PE=1 SV=1 166 492 1.0E-27
sp|Q9NHB0|BGBP1_DROME Gram-negative bacteria-binding protein 1 OS=Drosophila melanogaster GN=GNBP1 PE=2 SV=2 206 489 1.0E-25
sp|Q76DI2|BGBP_TENMO Beta-1,3-glucan-binding protein OS=Tenebrio molitor GN=GRP PE=1 SV=1 175 489 3.0E-24
sp|P23903|E13B_BACCI Glucan endo-1,3-beta-glucosidase A1 OS=Bacillus circulans GN=glcA PE=1 SV=1 188 471 1.0E-23
sp|Q9NL89|BGBP_BOMMO Beta-1,3-glucan-binding protein OS=Bombyx mori PE=1 SV=1 179 481 8.0E-23
sp|O96363|BGBP_HYPCU Beta-1,3-glucan-binding protein (Fragment) OS=Hyphantria cunea GN=gnbp1 PE=2 SV=1 175 492 9.0E-22
sp|Q8ISB6|BGBP2_MANSE Beta-1,3-glucan-binding protein 2 OS=Manduca sexta PE=1 SV=1 157 489 1.0E-20
sp|Q9NHA8|BGBP3_DROME Gram-negative bacteria-binding protein 3 OS=Drosophila melanogaster GN=GNBP3 PE=1 SV=2 167 475 3.0E-18
sp|P45798|GUB_RHOMR Beta-glucanase OS=Rhodothermus marinus GN=bglA PE=1 SV=1 171 446 2.0E-17
sp|Q8MU95|BGBP_PLOIN Beta-1,3-glucan-binding protein OS=Plodia interpunctella PE=1 SV=1 206 489 2.0E-17
sp|Q9VVR4|BGBP2_DROME Gram-negative bacteria-binding protein 2 OS=Drosophila melanogaster GN=GNBP2 PE=2 SV=3 203 479 6.0E-16
sp|Q9ZG90|KSBGL_SPHMU Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum PE=1 SV=1 264 447 3.0E-10
sp|O33680|EXSH_RHIME Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) GN=exsH PE=1 SV=1 264 454 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 131 153 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2494
MDQEHQQQQYAHGGHLGRSLVPSATTSADVTPLRPGTPNTDGGRNNNNGGSNPFGDGNDAAMSLRPGPSSNPFGA
GGSSPDASRPASSYGSSSALGHRFEERAQRYFHSRRVRKGEVEKPWLERKDPKEKWVTILPIVGILLGLAISGFL
VWDGIRSVIRHKYCPVMDDTFSGGFDTNIWTKEVTVGGFGNGEFEQTTGNEENVFIQGGHLVIKATLQDADKVEK
DGVVDLLKDGSCTSKEWSSCVASTNTSSGNWSTVPPTKSGRINTKKGAKIRYGRVEVTAKLPEGDWLWPAIWMMP
VKETYGAWPSSGEIDIMESRGNNWTYAQGGNDIVSSALHWGPDPANDAWWKTNNKHKALHATYSQGFNTFGLEWS
QKYIFTYVNSRLLQVLYTNFDRPMWRRGGFPESNANGTRLADVWSQTGRDNTPFDQDFYLVINLAVGGTNGWFED
GKSDKPWLDHSASAKKDFWRARDTWYPTWKQPQLEVSRVLMMQQCDGNEEL*
Coding >Hirsu2|2494
ATGGACCAAGAACACCAACAACAGCAGTACGCCCACGGCGGCCATTTGGGCCGTTCCCTGGTCCCTTCAGCCACC
ACCTCGGCCGACGTCACCCCCCTACGTCCCGGCACCCCCAACACCGACGGCGGCCGCAACAATAACAACGGCGGC
AGCAATCCGTTCGGCGACGGCAATGATGCGGCCATGTCACTGCGTCCGGGGCCCAGCTCCAACCCGTTCGGCGCC
GGCGGCAGCAGCCCGGACGCGTCCCGCCCGGCCTCGAGCTACGGCTCTTCGAGCGCACTGGGCCACCGCTTCGAG
GAGCGGGCGCAGCGCTACTTCCACTCGAGAAGGGTGCGCAAGGGCGAGGTCGAGAAGCCGTGGCTCGAGAGGAAG
GATCCCAAGGAGAAGTGGGTGACGATCCTGCCCATCGTCGGCATCCTACTCGGTCTCGCCATCTCGGGCTTCCTC
GTCTGGGACGGCATCCGGAGCGTGATCCGGCACAAGTACTGTCCGGTCATGGACGACACCTTTTCCGGCGGCTTC
GACACAAACATATGGACTAAGGAGGTGACCGTGGGAGGCTTCGGAAACGGCGAGTTTGAGCAGACGACGGGCAAC
GAGGAAAACGTCTTCATCCAGGGCGGGCACCTGGTCATCAAGGCGACGCTGCAGGACGCGGACAAGGTGGAAAAG
GACGGCGTGGTAGACCTGCTCAAGGACGGCAGCTGCACGTCCAAGGAGTGGTCGAGCTGCGTGGCGTCGACGAAC
ACGAGCAGCGGCAACTGGAGCACGGTGCCGCCGACCAAGTCCGGGCGGATCAACACGAAGAAGGGGGCCAAGATC
CGGTACGGGCGGGTGGAGGTGACGGCGAAGCTGCCCGAGGGCGACTGGCTGTGGCCGGCCATCTGGATGATGCCG
GTCAAGGAGACGTACGGGGCGTGGCCGTCGTCGGGGGAGATTGACATCATGGAGTCGCGCGGCAACAACTGGACG
TACGCGCAGGGCGGCAACGACATCGTGTCGTCGGCGCTGCACTGGGGGCCGGACCCGGCCAACGACGCGTGGTGG
AAGACGAACAACAAGCACAAGGCGCTGCACGCGACGTACAGCCAGGGCTTCAACACGTTCGGGCTCGAGTGGTCG
CAGAAGTACATCTTCACGTACGTCAACAGCCGGCTGCTGCAGGTGCTCTACACCAACTTCGACCGGCCGATGTGG
CGGCGCGGCGGCTTCCCCGAGTCGAACGCGAACGGGACGCGGCTGGCGGACGTCTGGAGCCAGACGGGGCGCGAC
AACACGCCCTTTGACCAGGACTTTTACCTCGTCATCAACCTGGCCGTCGGCGGCACCAACGGCTGGTTCGAGGAC
GGCAAGTCGGACAAGCCCTGGCTCGACCACTCGGCCAGCGCCAAGAAGGACTTTTGGAGGGCGCGCGACACGTGG
TACCCGACGTGGAAGCAACCCCAGCTCGAGGTGAGCCGGGTGCTGATGATGCAGCAGTGCGACGGCAACGAGGAG
CTATAG
Transcript >Hirsu2|2494
ATGGACCAAGAACACCAACAACAGCAGTACGCCCACGGCGGCCATTTGGGCCGTTCCCTGGTCCCTTCAGCCACC
ACCTCGGCCGACGTCACCCCCCTACGTCCCGGCACCCCCAACACCGACGGCGGCCGCAACAATAACAACGGCGGC
AGCAATCCGTTCGGCGACGGCAATGATGCGGCCATGTCACTGCGTCCGGGGCCCAGCTCCAACCCGTTCGGCGCC
GGCGGCAGCAGCCCGGACGCGTCCCGCCCGGCCTCGAGCTACGGCTCTTCGAGCGCACTGGGCCACCGCTTCGAG
GAGCGGGCGCAGCGCTACTTCCACTCGAGAAGGGTGCGCAAGGGCGAGGTCGAGAAGCCGTGGCTCGAGAGGAAG
GATCCCAAGGAGAAGTGGGTGACGATCCTGCCCATCGTCGGCATCCTACTCGGTCTCGCCATCTCGGGCTTCCTC
GTCTGGGACGGCATCCGGAGCGTGATCCGGCACAAGTACTGTCCGGTCATGGACGACACCTTTTCCGGCGGCTTC
GACACAAACATATGGACTAAGGAGGTGACCGTGGGAGGCTTCGGAAACGGCGAGTTTGAGCAGACGACGGGCAAC
GAGGAAAACGTCTTCATCCAGGGCGGGCACCTGGTCATCAAGGCGACGCTGCAGGACGCGGACAAGGTGGAAAAG
GACGGCGTGGTAGACCTGCTCAAGGACGGCAGCTGCACGTCCAAGGAGTGGTCGAGCTGCGTGGCGTCGACGAAC
ACGAGCAGCGGCAACTGGAGCACGGTGCCGCCGACCAAGTCCGGGCGGATCAACACGAAGAAGGGGGCCAAGATC
CGGTACGGGCGGGTGGAGGTGACGGCGAAGCTGCCCGAGGGCGACTGGCTGTGGCCGGCCATCTGGATGATGCCG
GTCAAGGAGACGTACGGGGCGTGGCCGTCGTCGGGGGAGATTGACATCATGGAGTCGCGCGGCAACAACTGGACG
TACGCGCAGGGCGGCAACGACATCGTGTCGTCGGCGCTGCACTGGGGGCCGGACCCGGCCAACGACGCGTGGTGG
AAGACGAACAACAAGCACAAGGCGCTGCACGCGACGTACAGCCAGGGCTTCAACACGTTCGGGCTCGAGTGGTCG
CAGAAGTACATCTTCACGTACGTCAACAGCCGGCTGCTGCAGGTGCTCTACACCAACTTCGACCGGCCGATGTGG
CGGCGCGGCGGCTTCCCCGAGTCGAACGCGAACGGGACGCGGCTGGCGGACGTCTGGAGCCAGACGGGGCGCGAC
AACACGCCCTTTGACCAGGACTTTTACCTCGTCATCAACCTGGCCGTCGGCGGCACCAACGGCTGGTTCGAGGAC
GGCAAGTCGGACAAGCCCTGGCTCGACCACTCGGCCAGCGCCAAGAAGGACTTTTGGAGGGCGCGCGACACGTGG
TACCCGACGTGGAAGCAACCCCAGCTCGAGGTGAGCCGGGTGCTGATGATGCAGCAGTGCGACGGCAACGAGGAG
CTATAG
Gene >Hirsu2|2494
ATGGACCAAGAACACCAACAACAGCAGTACGCCCACGGCGGCCATTTGGGCCGTTCCCTGGTCCCTTCAGCCACC
ACCTCGGCCGACGTCACCCCCCTACGTCCCGGCACCCCCAACACCGACGGCGGCCGCAACAATAACAACGGCGGC
AGCAATCCGTTCGGCGACGGCAATGATGCGGCCATGTCACTGCGTCCGGGGCCCAGCTCCAACCCGTTCGGCGCC
GGCGGCAGCAGCCCGGACGCGTCCCGCCCGGCCTCGAGCTACGGCTCTTCGAGCGCACTGGGCCACCGCTTCGAG
GAGCGGGCGCAGCGCTACTTCCACTCGAGAAGGGTGCGCAAGGGCGAGGTCGAGAAGCCGTGGCTCGAGAGGAAG
GATCCCAAGGAGAAGTGGGTGACGATCCTGCCCATCGTCGGCATCCTACTCGGTCTCGCCATCTCGGGCTTCCTC
GTCTGGGACGGCATCCGGAGCGTGATCCGGCACAAGTACTGTCCGGTCATGGACGACACCTTTTCCGGCGGCTTC
GACACAAACATATGGACTAAGGAGGTGACCGTGGGAGGCTTCGGGTGAGACTTTTTTTCCCCCCCCTCTCGCTGT
TTCTTGTGGGCGCGCTGACGGAGAGTGTACGCAGAAACGGCGAGTTTGAGCAGACGACGGGCAACGAGGAAAACG
TCTTCATCCAGGGCGGGCACCTGGTCATCAAGGCGACGCTGCAGGACGCGGACAAGGTGGAAAAGGACGGCGTGG
TAGACCTGCTCAAGGACGGCAGCTGCACGTCCAAGGAGTGGTCGAGCTGCGTGGCGTCGACGAACACGAGCAGCG
GCAACTGGAGCACGGTGCCGCCGACCAAGTCCGGGCGGATCAACACGAAGAAGGGGGCCAAGATCCGGTACGGGC
GGGTGGAGGTGACGGCGAAGCTGCCCGAGGGCGACTGGCTGTGGCCGGCCATCTGGATGATGCCGGTCAAGGAGA
CGTACGGGGCGTGGCCGTCGTCGGGGGAGATTGACATCATGGAGTCGCGCGGCAACAACTGGACGTACGCGCAGG
GCGGCAACGACATCGTGTCGTCGGCGCTGCACTGGGGGCCGGACCCGGCCAACGACGCGTGGTGGAAGACGAACA
ACAAGCACAAGGCGCTGCACGCGACGTACAGCCAGGGCTTCAACACGTTCGGGCTCGAGTGGTCGCAGAAGTACA
TCTTCACGTACGTCAACAGCCGGCTGCTGCAGGTGCTCTACACCAACTTCGACCGGCCGATGTGGCGGCGCGGCG
GCTTCCCCGAGTCGAACGCGAACGGGACGCGGCTGGCGGACGTCTGGAGCCAGACGGGGCGCGACAACACGCCCT
TTGACCAGGACTTTTACCTCGTCATCAACCTGGCCGTCGGCGGCACCAACGGCTGGTTCGAGGACGGCAAGTCGG
ACAAGCCCTGGCTCGACCACTCGGCCAGCGCCAAGAAGGACTTTTGGAGGGCGCGCGACACGTGGTACCCGACGT
GGAAGCAACCCCAGCTCGAGGTGAGCCGGGTGCTGATGATGCAGCAGTGCGACGGCAACGAGGAGCTATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail