Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2492
Gene name
LocationContig_16:14964..17792
Strand-
Gene length (bp)2828
Transcript length (bp)2661
Coding sequence length (bp)2661
Protein length (aa) 887

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 5.7E-52 503 712

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 266 288 22
2 308 330 22
3 694 716 22
4 731 753 22
5 774 796 22
6 829 851 22
7 858 877 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2492
MGLKDYFKAGKAEPAPATQDAPPPTQRPPPSTGSEKPPQMGRSGNDMELLPPTPRFHSRPQSSSGRSTPSTHSSM
FLDDIKHEVMVNYLYQQQCSQLWVSDGSGEVEGVLLRKARGHYMACPPQLGASAFALACSAMNLQCAMTVNSRVI
KTFLQWSPDAVDVPLMNGLRVQILPTLEDLPRARKHQFAAFVASEGLLIVWDDDPMNLVQRAKAIESELMELVWK
AGNSDDDDDEKRGGPMATVEIDEESGEIKPEKRPVHLQNTILVSLTLVLVVVSLGAAWRQLAIEVSVDGSYVRLA
LVALCPVQVFFTLFFAQVIVGCLAQIFGPVRQLAVNSKFYSARPPPRLQTAILPHVTIQCPVYKEGLQGVIVPTV
KSIKQAMSTYELQGGSANMFVNDDGLQLISDEDRRARIEFYADHSIGWVARPRHGENGFLRRGKFKKASNMNFGL
MISCKVEERLQALERPAEWSQHDEAQAYEQALKEVLEADGRAWADGNIRVGDYILLIDSDTRVPADCFLDAVSEM
EQSPDVGIMQFSSGVMQVVNTYFENGITFFTNLIYSAIRYTVSNGDVAPFVGHNAVLRWSAIQQVSYRDEDGYDK
FWSESHVSEDFDMSLRLQCSGYIIRLAAWAGEGFKEGVSLTVYDELARWEKYAYGCNELLFHPIRTWLWRGPFTP
LFRRFLFSNIRFTSKITVVSYIGTYYAIGAAWIMTAVNYFLMGWFNGYLDKYYVDSWQVWFSIIIVFNGLGNVAL
AVMRYRVGERSLLYALFENFKWTFMLAIFLGGLSLHVSQALLAHMFEIDMTWGATSKEAEFSNFFIEVPKVLKKF
KFSMLFALVFIIGMVVLAVAPFVPYGWRITDFVAILPMATVAASHFLLPLALNPALMTFSW*
Coding >Hirsu2|2492
ATGGGCCTCAAAGACTACTTCAAGGCCGGCAAGGCCGAGCCTGCTCCGGCAACCCAAGATGCTCCCCCGCCCACC
CAGCGCCCGCCTCCTTCTACCGGGTCGGAGAAGCCGCCCCAGATGGGGCGGAGCGGCAACGACATGGAACTCCTG
CCGCCCACTCCCCGCTTCCACTCTCGGCCTCAGTCCAGCTCGGGCCGGTCGACACCGTCGACCCACAGCTCCATG
TTCCTCGACGACATCAAGCACGAGGTCATGGTCAACTACCTGTACCAGCAGCAGTGCTCGCAGCTCTGGGTGAGC
GACGGGTCCGGAGAGGTCGAGGGCGTACTGCTGCGAAAGGCACGCGGCCACTACATGGCTTGTCCGCCCCAGCTG
GGCGCCTCGGCCTTTGCCCTGGCCTGCTCCGCCATGAACCTCCAGTGTGCCATGACGGTCAACTCGCGCGTCATC
AAGACGTTCCTGCAGTGGTCGCCCGACGCCGTCGACGTGCCCCTGATGAACGGCCTGCGCGTCCAGATCCTGCCG
ACGCTCGAGGATCTCCCGCGGGCGCGCAAGCACCAGTTCGCGGCCTTCGTCGCCTCGGAGGGGCTGCTGATCGTC
TGGGACGACGACCCGATGAACCTGGTGCAGCGCGCCAAGGCCATCGAGTCGGAGCTCATGGAGCTCGTCTGGAAG
GCGGGCAACAGCGACGACGACGACGACGAGAAGCGCGGCGGCCCCATGGCCACGGTCGAGATCGACGAGGAGAGC
GGCGAGATCAAGCCGGAGAAGCGGCCGGTCCACCTGCAGAACACGATACTCGTCTCGCTGACGCTGGTGCTCGTC
GTCGTCTCGCTCGGCGCGGCCTGGAGGCAGCTGGCCATCGAGGTGTCGGTCGACGGCAGCTACGTCCGCCTCGCC
CTCGTCGCCCTCTGCCCCGTCCAGGTCTTCTTCACCCTCTTCTTCGCCCAGGTCATCGTCGGCTGCCTGGCCCAG
ATCTTCGGGCCCGTGCGCCAGCTAGCCGTCAACTCCAAGTTCTACTCGGCGCGGCCGCCGCCGCGGCTGCAGACG
GCCATCCTGCCGCACGTCACCATCCAGTGCCCGGTCTACAAGGAGGGCCTTCAGGGCGTCATCGTGCCGACGGTC
AAGTCGATCAAGCAGGCCATGTCGACGTACGAGCTGCAGGGCGGGTCGGCCAACATGTTCGTCAACGACGACGGG
CTGCAGCTCATCTCGGACGAGGACCGGCGGGCGCGGATCGAGTTCTACGCCGACCACAGCATCGGATGGGTGGCC
CGGCCGCGGCACGGCGAGAACGGCTTCCTGCGGCGGGGCAAGTTCAAGAAGGCGAGCAACATGAACTTTGGGCTG
ATGATCTCGTGCAAGGTGGAGGAGCGGCTGCAGGCGCTGGAGCGGCCGGCCGAGTGGAGCCAGCACGACGAGGCG
CAGGCGTACGAGCAGGCGCTCAAGGAGGTGCTGGAGGCGGACGGGCGGGCGTGGGCGGACGGCAACATCCGGGTG
GGCGACTACATCCTGCTGATCGACTCGGACACGCGGGTGCCGGCCGACTGCTTCCTCGACGCCGTGTCGGAGATG
GAGCAGTCGCCGGACGTGGGCATCATGCAGTTCTCGTCGGGCGTGATGCAGGTGGTCAACACGTACTTTGAGAAC
GGCATCACCTTCTTCACCAACCTCATCTACTCGGCCATCCGGTACACCGTGTCCAACGGCGACGTGGCGCCGTTC
GTCGGGCACAACGCGGTGCTGCGCTGGTCGGCCATCCAGCAGGTCTCGTACCGGGACGAGGACGGCTACGACAAG
TTCTGGTCCGAGTCGCACGTCAGCGAGGACTTCGACATGTCGCTCCGGCTGCAGTGCTCCGGCTACATCATCCGG
CTGGCGGCCTGGGCGGGCGAGGGCTTCAAGGAGGGCGTGTCGCTGACGGTGTACGACGAGCTGGCGCGGTGGGAG
AAGTACGCGTACGGCTGCAACGAGCTGCTCTTCCACCCGATCCGCACGTGGCTGTGGCGCGGGCCCTTTACGCCG
CTCTTCCGCCGCTTCCTCTTCTCCAACATCCGGTTCACGTCCAAGATCACGGTGGTGTCGTACATCGGCACCTAC
TACGCCATCGGGGCCGCGTGGATCATGACGGCCGTCAACTACTTCCTCATGGGCTGGTTCAACGGCTACCTGGAC
AAGTACTACGTCGACTCGTGGCAGGTCTGGTTCTCCATCATCATCGTCTTCAACGGGCTCGGCAACGTGGCGCTG
GCCGTGATGCGGTACCGCGTCGGCGAGCGCAGCCTGCTGTACGCCCTCTTCGAGAACTTCAAGTGGACCTTCATG
CTGGCCATCTTCCTCGGCGGCCTGTCGCTGCACGTCAGCCAGGCGCTGCTGGCGCACATGTTCGAGATCGACATG
ACGTGGGGGGCCACGAGCAAGGAGGCCGAGTTTTCAAACTTCTTCATCGAGGTGCCCAAGGTGCTGAAGAAGTTC
AAGTTCTCCATGCTGTTCGCCCTCGTCTTCATCATCGGCATGGTCGTCCTGGCCGTCGCGCCCTTCGTGCCGTAC
GGCTGGCGCATCACCGACTTCGTCGCCATCCTGCCCATGGCCACCGTCGCCGCCAGCCACTTCCTGCTGCCGCTG
GCGCTGAACCCCGCCCTGATGACGTTTTCGTGGTGA
Transcript >Hirsu2|2492
ATGGGCCTCAAAGACTACTTCAAGGCCGGCAAGGCCGAGCCTGCTCCGGCAACCCAAGATGCTCCCCCGCCCACC
CAGCGCCCGCCTCCTTCTACCGGGTCGGAGAAGCCGCCCCAGATGGGGCGGAGCGGCAACGACATGGAACTCCTG
CCGCCCACTCCCCGCTTCCACTCTCGGCCTCAGTCCAGCTCGGGCCGGTCGACACCGTCGACCCACAGCTCCATG
TTCCTCGACGACATCAAGCACGAGGTCATGGTCAACTACCTGTACCAGCAGCAGTGCTCGCAGCTCTGGGTGAGC
GACGGGTCCGGAGAGGTCGAGGGCGTACTGCTGCGAAAGGCACGCGGCCACTACATGGCTTGTCCGCCCCAGCTG
GGCGCCTCGGCCTTTGCCCTGGCCTGCTCCGCCATGAACCTCCAGTGTGCCATGACGGTCAACTCGCGCGTCATC
AAGACGTTCCTGCAGTGGTCGCCCGACGCCGTCGACGTGCCCCTGATGAACGGCCTGCGCGTCCAGATCCTGCCG
ACGCTCGAGGATCTCCCGCGGGCGCGCAAGCACCAGTTCGCGGCCTTCGTCGCCTCGGAGGGGCTGCTGATCGTC
TGGGACGACGACCCGATGAACCTGGTGCAGCGCGCCAAGGCCATCGAGTCGGAGCTCATGGAGCTCGTCTGGAAG
GCGGGCAACAGCGACGACGACGACGACGAGAAGCGCGGCGGCCCCATGGCCACGGTCGAGATCGACGAGGAGAGC
GGCGAGATCAAGCCGGAGAAGCGGCCGGTCCACCTGCAGAACACGATACTCGTCTCGCTGACGCTGGTGCTCGTC
GTCGTCTCGCTCGGCGCGGCCTGGAGGCAGCTGGCCATCGAGGTGTCGGTCGACGGCAGCTACGTCCGCCTCGCC
CTCGTCGCCCTCTGCCCCGTCCAGGTCTTCTTCACCCTCTTCTTCGCCCAGGTCATCGTCGGCTGCCTGGCCCAG
ATCTTCGGGCCCGTGCGCCAGCTAGCCGTCAACTCCAAGTTCTACTCGGCGCGGCCGCCGCCGCGGCTGCAGACG
GCCATCCTGCCGCACGTCACCATCCAGTGCCCGGTCTACAAGGAGGGCCTTCAGGGCGTCATCGTGCCGACGGTC
AAGTCGATCAAGCAGGCCATGTCGACGTACGAGCTGCAGGGCGGGTCGGCCAACATGTTCGTCAACGACGACGGG
CTGCAGCTCATCTCGGACGAGGACCGGCGGGCGCGGATCGAGTTCTACGCCGACCACAGCATCGGATGGGTGGCC
CGGCCGCGGCACGGCGAGAACGGCTTCCTGCGGCGGGGCAAGTTCAAGAAGGCGAGCAACATGAACTTTGGGCTG
ATGATCTCGTGCAAGGTGGAGGAGCGGCTGCAGGCGCTGGAGCGGCCGGCCGAGTGGAGCCAGCACGACGAGGCG
CAGGCGTACGAGCAGGCGCTCAAGGAGGTGCTGGAGGCGGACGGGCGGGCGTGGGCGGACGGCAACATCCGGGTG
GGCGACTACATCCTGCTGATCGACTCGGACACGCGGGTGCCGGCCGACTGCTTCCTCGACGCCGTGTCGGAGATG
GAGCAGTCGCCGGACGTGGGCATCATGCAGTTCTCGTCGGGCGTGATGCAGGTGGTCAACACGTACTTTGAGAAC
GGCATCACCTTCTTCACCAACCTCATCTACTCGGCCATCCGGTACACCGTGTCCAACGGCGACGTGGCGCCGTTC
GTCGGGCACAACGCGGTGCTGCGCTGGTCGGCCATCCAGCAGGTCTCGTACCGGGACGAGGACGGCTACGACAAG
TTCTGGTCCGAGTCGCACGTCAGCGAGGACTTCGACATGTCGCTCCGGCTGCAGTGCTCCGGCTACATCATCCGG
CTGGCGGCCTGGGCGGGCGAGGGCTTCAAGGAGGGCGTGTCGCTGACGGTGTACGACGAGCTGGCGCGGTGGGAG
AAGTACGCGTACGGCTGCAACGAGCTGCTCTTCCACCCGATCCGCACGTGGCTGTGGCGCGGGCCCTTTACGCCG
CTCTTCCGCCGCTTCCTCTTCTCCAACATCCGGTTCACGTCCAAGATCACGGTGGTGTCGTACATCGGCACCTAC
TACGCCATCGGGGCCGCGTGGATCATGACGGCCGTCAACTACTTCCTCATGGGCTGGTTCAACGGCTACCTGGAC
AAGTACTACGTCGACTCGTGGCAGGTCTGGTTCTCCATCATCATCGTCTTCAACGGGCTCGGCAACGTGGCGCTG
GCCGTGATGCGGTACCGCGTCGGCGAGCGCAGCCTGCTGTACGCCCTCTTCGAGAACTTCAAGTGGACCTTCATG
CTGGCCATCTTCCTCGGCGGCCTGTCGCTGCACGTCAGCCAGGCGCTGCTGGCGCACATGTTCGAGATCGACATG
ACGTGGGGGGCCACGAGCAAGGAGGCCGAGTTTTCAAACTTCTTCATCGAGGTGCCCAAGGTGCTGAAGAAGTTC
AAGTTCTCCATGCTGTTCGCCCTCGTCTTCATCATCGGCATGGTCGTCCTGGCCGTCGCGCCCTTCGTGCCGTAC
GGCTGGCGCATCACCGACTTCGTCGCCATCCTGCCCATGGCCACCGTCGCCGCCAGCCACTTCCTGCTGCCGCTG
GCGCTGAACCCCGCCCTGATGACGTTTTCGTGGTGA
Gene >Hirsu2|2492
ATGGGCCTCAAAGACTACTTCAAGGCCGGCAAGGCCGAGCCTGCTCCGGCAACCCAAGATGCTCCCCCGCCCACC
CAGCGCCCGCCTCCTTCTACCGGGTCGGAGAAGCCGCCCCAGATGGGGCGGAGCGGCAACGACATGGAACTCCTG
CCGCCCACTCCCCGCTTCCACTCTCGGCCTCAGTCCAGCTCGGGCCGGTCGACACCGTCGACCCACAGCTCCATG
TTCCTCGACGACATCAAGCACGAGGTCATGGTCAACTACCTGTACCAGCAGCAGTGCTCGCAGCTCTGGGTGAGC
GACGGGTCCGGAGAGGTCGAGGGCGTACTGCTGCGAAAGGCACGCGGCCACTACATGGCTTGTCCGCCCCAGCTG
GGCGCCTCGGCCTTTGCCCTGGCCTGCTCCGCCATGAACCTCCAGGTGAGCCGGCTCTGCTGGCCCCCTCCCCTC
CCTCCCCCCGTCCGGCCCGGGCCCGACTGACCGCCGTGCAGTGTGCCATGACGGTCAACTCGCGCGTCATCAAGA
CGTTCCTGCAGTGGTCGCCCGACGCCGTCGACGTGCCCCTGATGAACGGCCTGCGCGTCCAGATCCTGCCGACGC
TCGAGGATCTCCCGCGGGCGCGCAAGCACCAGTTCGCGGCCTTCGTCGCCTCGGAGGGGCTGCTGATCGTCTGGG
ACGACGACCCGATGAACCTGGTGCAGCGCGCCAAGGCCATCGAGTCGGAGCTCATGGAGCTCGTCTGGAAGGCGG
GCAACAGCGACGACGACGACGACGAGAAGCGCGGCGGCCCCATGGCCACGGTCGAGATCGACGAGGAGAGCGGCG
AGATCAAGCCGGAGAAGCGGCCGGTCCACCTGCAGAACACGATACTCGTCTCGCTGACGCTGGTGCTCGTCGTCG
TCTCGCTCGGCGCGGCCTGGAGGCAGCTGGCCATCGAGGTGTCGGTCGACGGCAGCTACGTCCGCCTCGCCCTCG
TCGCCCTCTGCCCCGTCCAGGTCTTCTTCACCCTCTTCTTCGCCCAGGTCATCGTCGGCTGCCTGGCCCAGATCT
TCGGGCCCGTGCGCCAGCTAGCCGTCAACTCCAAGTTCTACTCGGCGCGGCCGCCGCCGCGGCTGCAGACGGCCA
TCCTGCCGCACGTCACCATCCAGTGCCCGGTCTACAAGGAGGGCCTTCAGGGCGTCATCGTGCCGACGGTCAAGT
CGATCAAGCAGGCCATGTCGACGTACGAGCTGCAGGGCGGGTCGGCCAACATGTTCGTCAACGACGACGGGCTGC
AGCTCATCTCGGACGAGGACCGGCGGGCGCGGATCGAGTTCTACGCCGACCACAGCATCGGATGGGTGGCCCGGC
CGCGGCACGGCGAGAACGGCTTCCTGCGGCGGGGCAAGTTCAAGAAGGCGAGCAACATGAACTTTGGGCTGATGA
TCTCGTGCAAGGTGGAGGAGCGGCTGCAGGCGCTGGAGCGGCCGGCCGAGTGGAGCCAGCACGACGAGGCGCAGG
CGTACGAGCAGGCGCTCAAGGAGGTGCTGGAGGCGGACGGGCGGGCGTGGGCGGACGGCAACATCCGGGTGGGCG
ACTACATCCTGCTGATCGACTCGGACACGCGGGTGCCGGCCGACTGCTTCCTCGACGCCGTGTCGGAGATGGAGC
AGTCGCCGGACGTGGGCATCATGCAGTTCTCGTCGGGCGTGATGCAGGTGGTCAACACGTACTTTGAGAACGGCA
TCACCTTCTTCACCAACCTCATCTACTCGGCCATCCGGTACACCGTGTCCAACGGCGACGTGGCGCCGTTCGTCG
GGCACAACGCGGTGCTGCGCTGGTCGGCCATCCAGCAGGTCTCGTACCGGGACGAGGACGGCTACGACAAGTTCT
GGTCCGAGTCGCACGTCAGCGAGGACTTCGACATGTCGCTCCGGCTGCAGTGCTCCGGCTACATCATCCGGCTGG
CGGCCTGGGCGGGCGAGGGCTTCAAGGAGGGCGTGTCGCTGACGGTGTACGACGAGCTGGCGCGGTGGGAGAAGT
ACGCGTACGGCTGCAACGAGCTGCTCTTCCACCCGATCCGCACGTGGCTGTGGCGCGGGCCCTTTACGCCGCTCT
TCCGCCGCTTCCTCTTCTCCAACATCCGGTTCACGTCCAAGATCACGGTGGTGTCGTACATCGGCACCTACTACG
CCATCGGGGCCGCGTGGATCATGACGGCCGTCAACTACTTCCTCATGGGCTGGTTCAACGGCTACCTGGACAAGT
ACTACGTCGACTCGTGGCAGGTCTGGTTCTCCATCATCATCGTCTTCAACGGGCTCGGCAACGTGGCGCTGGCCG
TGATGCGGTACCGCGTCGGCGAGCGCAGCCTGCTGTACGCCCTCTTCGAGAACTTCAAGTGGACCTTCATGCTGG
CCATCTTCCTCGGCGGCCTGTCGCTGCACGTCAGCCAGGCGCTGCTGGCGCACATGTTCGAGATCGACATGACGT
GGGGGGCCACGAGCAAGGAGGCCGAGTTTTCAAACTTCTTCATCGAGGTGCCCAAGGTGCTGAAGAAGGTGAGTC
TTTTTTTTTTTTTTTTTCCTTCCTTTCCCACCCCGCTCGCCGCCCTCTGTCCGTCTCACACCCATCGGCTCACCT
GTCCCGGTCCGCAGTTCAAGTTCTCCATGCTGTTCGCCCTCGTCTTCATCATCGGCATGGTCGTCCTGGCCGTCG
CGCCCTTCGTGCCGTACGGCTGGCGCATCACCGACTTCGTCGCCATCCTGCCCATGGCCACCGTCGCCGCCAGCC
ACTTCCTGCTGCCGCTGGCGCTGAACCCCGCCCTGATGACGTTTTCGTGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail