Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2490
Gene name
LocationContig_16:7415..9530
Strand+
Gene length (bp)2115
Transcript length (bp)2046
Coding sequence length (bp)2046
Protein length (aa) 682

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01529 DHHC DHHC palmitoyltransferase 1.3E-35 468 593

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I2M7|ERFB_GIBZE Palmitoyltransferase ERF2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ERF2 PE=3 SV=1 27 676 0.0E+00
sp|Q7SFL7|ERFB_NEUCR Palmitoyltransferase erf2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-2 PE=3 SV=1 28 681 0.0E+00
sp|Q5B3W7|ERFB_EMENI Palmitoyltransferase erf2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=erf2 PE=3 SV=2 97 666 9.0E-167
sp|Q4WWN2|ERFB_ASPFU Palmitoyltransferase erf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=erf2 PE=3 SV=1 21 662 3.0E-163
sp|Q6C890|ERFB_YARLI Palmitoyltransferase ERF2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERF2 PE=3 SV=2 311 598 8.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I2M7|ERFB_GIBZE Palmitoyltransferase ERF2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ERF2 PE=3 SV=1 27 676 0.0E+00
sp|Q7SFL7|ERFB_NEUCR Palmitoyltransferase erf2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-2 PE=3 SV=1 28 681 0.0E+00
sp|Q5B3W7|ERFB_EMENI Palmitoyltransferase erf2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=erf2 PE=3 SV=2 97 666 9.0E-167
sp|Q4WWN2|ERFB_ASPFU Palmitoyltransferase erf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=erf2 PE=3 SV=1 21 662 3.0E-163
sp|Q6C890|ERFB_YARLI Palmitoyltransferase ERF2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERF2 PE=3 SV=2 311 598 8.0E-69
sp|Q6BHT4|ERFB_DEBHA Palmitoyltransferase ERF2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERF2 PE=3 SV=2 352 640 2.0E-60
sp|O74384|ERFB_SCHPO Palmitoyltransferase erf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erf2 PE=1 SV=1 344 628 3.0E-53
sp|Q6FSS4|ERFB_CANGA Palmitoyltransferase ERF2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERF2 PE=3 SV=1 350 630 5.0E-50
sp|P59268|ZDHC9_MOUSE Palmitoyltransferase ZDHHC9 OS=Mus musculus GN=Zdhhc9 PE=2 SV=1 342 625 5.0E-50
sp|Q06551|ERFB_YEAST Palmitoyltransferase ERF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERF2 PE=1 SV=1 350 655 5.0E-50
sp|Q5R5J8|ZDHC9_PONAB Palmitoyltransferase ZDHHC9 OS=Pongo abelii GN=ZDHHC9 PE=2 SV=1 342 625 6.0E-50
sp|Q9Y397|ZDHC9_HUMAN Palmitoyltransferase ZDHHC9 OS=Homo sapiens GN=ZDHHC9 PE=1 SV=2 342 625 6.0E-50
sp|Q58DA8|ZDHC9_BOVIN Palmitoyltransferase ZDHHC9 OS=Bos taurus GN=ZDHHC9 PE=2 SV=1 342 625 7.0E-50
sp|Q750R7|ERFB_ASHGO Palmitoyltransferase ERF2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERF2 PE=3 SV=1 289 640 2.0E-46
sp|Q9SB58|ZDH19_ARATH Protein S-acyltransferase 8 OS=Arabidopsis thaliana GN=PAT08 PE=1 SV=2 342 630 1.0E-45
sp|Q8IZN3|ZDH14_HUMAN Probable palmitoyltransferase ZDHHC14 OS=Homo sapiens GN=ZDHHC14 PE=1 SV=1 344 625 1.0E-45
sp|Q8BQQ1|ZDH14_MOUSE Probable palmitoyltransferase ZDHHC14 OS=Mus musculus GN=Zdhhc14 PE=1 SV=1 344 625 2.0E-45
sp|Q6CQB5|ERFB_KLULA Palmitoyltransferase ERF2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERF2 PE=3 SV=1 337 593 2.0E-42
sp|Q9NUE0|ZDH18_HUMAN Palmitoyltransferase ZDHHC18 OS=Homo sapiens GN=ZDHHC18 PE=2 SV=2 342 625 1.0E-39
sp|Q5Y5T5|ZDHC8_MOUSE Probable palmitoyltransferase ZDHHC8 OS=Mus musculus GN=Zdhhc8 PE=1 SV=1 356 626 1.0E-39
sp|Q2THW8|ZDHC8_CANLF Probable palmitoyltransferase ZDHHC8 OS=Canis lupus familiaris GN=ZDHHC8 PE=2 SV=1 356 626 2.0E-39
sp|Q59QL0|ERFB_CANAL Palmitoyltransferase ERF2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERF2 PE=3 SV=2 350 592 2.0E-39
sp|Q2THX0|ZDHC8_PANTR Probable palmitoyltransferase ZDHHC8 OS=Pan troglodytes GN=ZDHHC8 PE=2 SV=1 356 626 2.0E-39
sp|Q9ULC8|ZDHC8_HUMAN Probable palmitoyltransferase ZDHHC8 OS=Homo sapiens GN=ZDHHC8 PE=1 SV=3 356 626 2.0E-39
sp|Q5Y5T2|ZDH18_MOUSE Palmitoyltransferase ZDHHC18 OS=Mus musculus GN=Zdhhc18 PE=1 SV=4 342 625 2.0E-39
sp|Q5R838|ZDHC5_PONAB Palmitoyltransferase ZDHHC5 OS=Pongo abelii GN=ZDHHC5 PE=2 SV=1 356 626 5.0E-39
sp|Q9FLM3|ZDH23_ARATH Probable protein S-acyltransferase 6 OS=Arabidopsis thaliana GN=PAT06 PE=2 SV=1 342 634 6.0E-39
sp|Q2TGJ1|ZDH18_RAT Palmitoyltransferase ZDHHC18 OS=Rattus norvegicus GN=Zdhhc18 PE=2 SV=1 342 625 6.0E-39
sp|Q8VDZ4|ZDHC5_MOUSE Palmitoyltransferase ZDHHC5 OS=Mus musculus GN=Zdhhc5 PE=1 SV=1 356 626 7.0E-39
sp|Q0WQK2|ZDHC9_ARATH Probable protein S-acyltransferase 7 OS=Arabidopsis thaliana GN=PAT07 PE=1 SV=1 342 639 2.0E-38
sp|Q2THW7|ZDHC5_RAT Palmitoyltransferase ZDHHC5 OS=Rattus norvegicus GN=Zdhhc5 PE=1 SV=1 356 626 2.0E-38
sp|Q2THW9|ZDHC5_CANLF Palmitoyltransferase ZDHHC5 OS=Canis lupus familiaris GN=ZDHHC5 PE=2 SV=1 356 626 3.0E-38
sp|Q9C0B5|ZDHC5_HUMAN Palmitoyltransferase ZDHHC5 OS=Homo sapiens GN=ZDHHC5 PE=1 SV=2 356 626 7.0E-38
sp|Q2THX1|ZDHC5_PANTR Palmitoyltransferase ZDHHC5 OS=Pan troglodytes GN=ZDHHC5 PE=2 SV=1 356 626 8.0E-38
sp|E1BLT8|ZDHC5_BOVIN Palmitoyltransferase ZDHHC5 OS=Bos taurus GN=ZDHHC5 PE=3 SV=1 358 626 9.0E-38
sp|Q9M306|ZDH10_ARATH Probable protein S-acyltransferase 5 OS=Arabidopsis thaliana GN=PAT05 PE=1 SV=2 342 619 3.0E-36
sp|Q9M1K5|ZDH13_ARATH Probable protein S-acyltransferase 4 OS=Arabidopsis thaliana GN=PAT04 PE=2 SV=1 342 640 1.0E-35
sp|Q8VYS8|ZDH24_ARATH Probable protein S-acyltransferase 9 OS=Arabidopsis thaliana GN=PAT09 PE=2 SV=1 341 630 1.0E-34
sp|Q5PNZ1|ZDH21_ARATH Probable protein S-acyltransferase 3 OS=Arabidopsis thaliana GN=PAT03 PE=2 SV=1 323 681 1.0E-30
sp|B3DN87|ZDH12_ARATH Probable protein S-acyltransferase 1 OS=Arabidopsis thaliana GN=PAT01 PE=2 SV=1 342 631 1.0E-27
sp|O80685|ZDHC4_ARATH Probable protein S-acyltransferase 2 OS=Arabidopsis thaliana GN=PAT02 PE=2 SV=3 342 670 1.0E-24
sp|Q550R7|ZDHC1_DICDI Putative ZDHHC-type palmitoyltransferase 1 OS=Dictyostelium discoideum GN=DDB_G0276997 PE=3 SV=3 369 537 1.0E-23
sp|Q557H5|ZDHC3_DICDI Putative ZDHHC-type palmitoyltransferase 3 OS=Dictyostelium discoideum GN=DDB_G0273477 PE=3 SV=1 454 533 7.0E-21
sp|Q5FWL7|ZDH15_XENLA Palmitoyltransferase ZDHHC15 OS=Xenopus laevis GN=zdhhc15 PE=2 SV=1 468 622 8.0E-20
sp|Q9UIJ5|ZDHC2_HUMAN Palmitoyltransferase ZDHHC2 OS=Homo sapiens GN=ZDHHC2 PE=2 SV=1 460 618 2.0E-19
sp|Q8BGJ0|ZDH15_MOUSE Palmitoyltransferase ZDHHC15 OS=Mus musculus GN=Zdhhc15 PE=1 SV=1 467 618 3.0E-19
sp|P59267|ZDHC2_MOUSE Palmitoyltransferase ZDHHC2 OS=Mus musculus GN=Zdhhc2 PE=2 SV=1 460 618 3.0E-19
sp|Q2TGJ4|ZDH15_RAT Palmitoyltransferase ZDHHC15 OS=Rattus norvegicus GN=Zdhhc15 PE=2 SV=1 467 618 3.0E-19
sp|Q96MV8|ZDH15_HUMAN Palmitoyltransferase ZDHHC15 OS=Homo sapiens GN=ZDHHC15 PE=2 SV=1 467 618 3.0E-19
sp|Q9JKR5|ZDHC2_RAT Palmitoyltransferase ZDHHC2 OS=Rattus norvegicus GN=Zdhhc2 PE=2 SV=1 460 618 5.0E-19
sp|Q9C533|ZDHC1_ARATH Probable protein S-acyltransferase 22 OS=Arabidopsis thaliana GN=PAT22 PE=2 SV=2 457 609 2.0E-18
sp|Q8WVZ1|ZDH19_HUMAN Probable palmitoyltransferase ZDHHC19 OS=Homo sapiens GN=ZDHHC19 PE=2 SV=2 381 547 3.0E-18
sp|Q500Z2|ZDH20_ARATH Probable protein S-acyltransferase 15 OS=Arabidopsis thaliana GN=PAT15 PE=2 SV=1 468 618 1.0E-17
sp|Q555N7|ZDHC4_DICDI Putative ZDHHC-type palmitoyltransferase 4 OS=Dictyostelium discoideum GN=DDB_G0274251 PE=3 SV=1 464 589 2.0E-17
sp|Q94C49|ZDH18_ARATH Probable protein S-acyltransferase 13 OS=Arabidopsis thaliana GN=PAT13 PE=2 SV=1 394 594 3.0E-17
sp|Q5AGV7|PFA4_CANAL Palmitoyltransferase PFA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFA4 PE=3 SV=1 375 596 4.0E-17
sp|Q5Y5T1|ZDH20_MOUSE Probable palmitoyltransferase ZDHHC20 OS=Mus musculus GN=Zdhhc20 PE=1 SV=1 467 608 5.0E-17
sp|Q93VV0|ZDHC6_ARATH Probable protein S-acyltransferase 16 OS=Arabidopsis thaliana GN=PAT16 PE=2 SV=1 467 618 6.0E-17
sp|Q6CPU8|PFA3_KLULA Palmitoyltransferase PFA3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFA3 PE=3 SV=1 405 589 1.0E-16
sp|Q810M5|ZDH19_MOUSE Probable palmitoyltransferase ZDHHC19 OS=Mus musculus GN=Zdhhc19 PE=1 SV=1 389 547 2.0E-16
sp|Q0VC89|ZDH20_BOVIN Probable palmitoyltransferase ZDHHC20 OS=Bos taurus GN=ZDHHC20 PE=2 SV=1 467 608 5.0E-16
sp|Q9NXF8|ZDHC7_HUMAN Palmitoyltransferase ZDHHC7 OS=Homo sapiens GN=ZDHHC7 PE=1 SV=2 342 603 1.0E-15
sp|Q6FXC6|SWF1_CANGA Palmitoyltransferase SWF1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWF1 PE=3 SV=1 463 526 1.0E-15
sp|Q7S7C5|PFA3_NEUCR Palmitoyltransferase pfa3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-3 PE=3 SV=3 468 601 1.0E-15
sp|Q923G5|ZDHC7_RAT Palmitoyltransferase ZDHHC7 OS=Rattus norvegicus GN=Zdhhc7 PE=1 SV=1 390 603 2.0E-15
sp|Q91WU6|ZDHC7_MOUSE Palmitoyltransferase ZDHHC7 OS=Mus musculus GN=Zdhhc7 PE=1 SV=1 390 603 2.0E-15
sp|Q75AW7|PFA3_ASHGO Palmitoyltransferase PFA3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PFA3 PE=3 SV=2 468 590 3.0E-15
sp|Q9LIE4|ZDHC8_ARATH Probable protein S-acyltransferase 20 OS=Arabidopsis thaliana GN=PAT20 PE=3 SV=2 470 591 3.0E-15
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 470 597 3.0E-15
sp|Q9D270|ZDH21_MOUSE Probable palmitoyltransferase ZDHHC21 OS=Mus musculus GN=Zdhhc21 PE=1 SV=2 396 575 3.0E-15
sp|Q6CJC5|SWF1_KLULA Palmitoyltransferase SWF1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWF1 PE=3 SV=1 470 526 3.0E-15
sp|Q9ESG8|ZDH16_MOUSE Probable palmitoyltransferase ZDHHC16 OS=Mus musculus GN=Zdhhc16 PE=1 SV=2 450 613 4.0E-15
sp|Q5W0Z9|ZDH20_HUMAN Probable palmitoyltransferase ZDHHC20 OS=Homo sapiens GN=ZDHHC20 PE=1 SV=1 467 589 4.0E-15
sp|P42836|PFA3_YEAST Palmitoyltransferase PFA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFA3 PE=1 SV=1 470 589 4.0E-15
sp|A2VDT6|ZDH21_BOVIN Probable palmitoyltransferase ZDHHC21 OS=Bos taurus GN=ZDHHC21 PE=2 SV=1 396 575 7.0E-15
sp|O60069|SWF1_SCHPO Palmitoyltransferase swf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swf1 PE=3 SV=1 470 589 8.0E-15
sp|Q4WZL8|PFA3_ASPFU Palmitoyltransferase pfa3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfa3 PE=3 SV=1 402 601 9.0E-15
sp|Q6BP23|SWF1_DEBHA Palmitoyltransferase SWF1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWF1 PE=3 SV=1 376 526 2.0E-14
sp|Q5RB84|ZDH21_PONAB Probable palmitoyltransferase ZDHHC21 OS=Pongo abelii GN=ZDHHC21 PE=2 SV=1 396 575 2.0E-14
sp|Q8IVQ6|ZDH21_HUMAN Palmitoyltransferase ZDHHC21 OS=Homo sapiens GN=ZDHHC21 PE=2 SV=1 396 575 2.0E-14
sp|C8VCL4|PFA3_EMENI Palmitoyltransferase pfa3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfa3 PE=3 SV=2 468 601 2.0E-14
sp|Q8VYP5|ZDH14_ARATH Probable protein S-acyltransferase 14 OS=Arabidopsis thaliana GN=PAT14 PE=2 SV=1 397 602 2.0E-14
sp|Q8L5Y5|ZDH17_ARATH Probable protein S-acyltransferase 19 OS=Arabidopsis thaliana GN=PAT19 PE=2 SV=1 470 591 2.0E-14
sp|Q4IA62|PFA3_GIBZE Palmitoyltransferase PFA3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFA3 PE=3 SV=1 468 596 3.0E-14
sp|Q4PE27|PFA4_USTMA Palmitoyltransferase PFA4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PFA4 PE=3 SV=2 468 618 3.0E-14
sp|Q6BMV2|PFA3_DEBHA Palmitoyltransferase PFA3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFA3 PE=3 SV=2 468 605 4.0E-14
sp|Q52T38|ZDH22_ARATH Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 402 597 9.0E-14
sp|Q14AK4|ZDH11_MOUSE Probable palmitoyltransferase ZDHHC11 OS=Mus musculus GN=Zdhhc11 PE=2 SV=2 468 598 9.0E-14
sp|Q5A861|SWF1_CANAL Palmitoyltransferase SWF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWF1 PE=3 SV=1 468 526 1.0E-13
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 381 594 1.0E-13
sp|Q8I0G4|ZDHC4_CAEEL Zinc finger DHHC domain-containing protein 4 OS=Caenorhabditis elegans GN=dhhc-4 PE=3 SV=1 467 608 1.0E-13
sp|Q4WC37|PFA4_ASPFU Palmitoyltransferase pfa4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfa4 PE=3 SV=2 367 581 1.0E-13
sp|Q4R7E2|ZDH16_MACFA Probable palmitoyltransferase ZDHHC16 OS=Macaca fascicularis GN=ZDHHC16 PE=2 SV=1 450 613 1.0E-13
sp|Q5M757|ZDH15_ARATH Probable protein S-acyltransferase 12 OS=Arabidopsis thaliana GN=PAT12 PE=2 SV=1 394 589 2.0E-13
sp|Q969W1|ZDH16_HUMAN Probable palmitoyltransferase ZDHHC16 OS=Homo sapiens GN=ZDHHC16 PE=2 SV=1 450 613 2.0E-13
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 383 598 2.0E-13
sp|Q5FVR1|ZDHC4_RAT Probable palmitoyltransferase ZDHHC4 OS=Rattus norvegicus GN=Zdhhc4 PE=2 SV=1 470 590 2.0E-13
sp|Q58CU4|ZDH16_BOVIN Probable palmitoyltransferase ZDHHC16 OS=Bos taurus GN=ZDHHC16 PE=2 SV=1 450 613 2.0E-13
sp|P0CS68|PFA4_CRYNJ Palmitoyltransferase PFA4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFA4 PE=3 SV=2 458 618 4.0E-13
sp|P0CS69|PFA4_CRYNB Palmitoyltransferase PFA4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFA4 PE=3 SV=1 458 618 4.0E-13
sp|J9VJ99|PFA4_CRYNH Palmitoyltransferase PFA4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=PFA4 PE=1 SV=2 458 618 5.0E-13
sp|Q3EBC2|ZDHC5_ARATH Probable protein S-acyltransferase 17 OS=Arabidopsis thaliana GN=PAT17 PE=2 SV=1 413 526 6.0E-13
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 370 522 7.0E-13
sp|Q6FW70|PFA3_CANGA Palmitoyltransferase PFA3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFA3 PE=3 SV=1 434 542 9.0E-13
sp|Q8R0N9|ZDHC1_MOUSE Probable palmitoyltransferase ZDHHC1 OS=Mus musculus GN=Zdhhc1 PE=2 SV=2 469 601 1.0E-12
sp|Q6CUB5|PFA4_KLULA Palmitoyltransferase PFA4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFA4 PE=3 SV=1 468 546 1.0E-12
sp|E9PTT0|ZDH17_RAT Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 383 596 1.0E-12
sp|Q6BLY8|PFA4_DEBHA Palmitoyltransferase PFA4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFA4 PE=3 SV=2 375 589 1.0E-12
sp|Q4WN54|SWF1_ASPFU Palmitoyltransferase swf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swf1 PE=3 SV=1 466 589 1.0E-12
sp|Q80TN5|ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 451 596 1.0E-12
sp|Q9NPG8|ZDHC4_HUMAN Probable palmitoyltransferase ZDHHC4 OS=Homo sapiens GN=ZDHHC4 PE=2 SV=1 470 590 1.0E-12
sp|Q6DR03|ZDHC3_ARATH Protein S-acyltransferase 21 OS=Arabidopsis thaliana GN=PAT21 PE=2 SV=1 359 591 1.0E-12
sp|Q9D6H5|ZDHC4_MOUSE Probable palmitoyltransferase ZDHHC4 OS=Mus musculus GN=Zdhhc4 PE=2 SV=1 470 602 2.0E-12
sp|Q9H8X9|ZDH11_HUMAN Probable palmitoyltransferase ZDHHC11 OS=Homo sapiens GN=ZDHHC11 PE=2 SV=1 468 604 2.0E-12
sp|Q04629|SWF1_YEAST Palmitoyltransferase SWF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWF1 PE=1 SV=2 470 614 2.0E-12
sp|Q5B0V6|AKR1_EMENI Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 381 606 2.0E-12
sp|Q5Y5T3|ZDH23_MOUSE Palmitoyltransferase ZDHHC23 OS=Mus musculus GN=Zdhhc23 PE=2 SV=1 448 574 2.0E-12
sp|P0C7U3|ZH11B_HUMAN Probable palmitoyltransferase ZDHHC11B OS=Homo sapiens GN=ZDHHC11B PE=3 SV=1 468 539 3.0E-12
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 400 597 3.0E-12
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 400 597 3.0E-12
sp|Q9M115|ZDH16_ARATH Protein S-acyltransferase 18 OS=Arabidopsis thaliana GN=PAT18 PE=2 SV=2 464 595 3.0E-12
sp|Q4I8B6|AKR1_GIBZE Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 470 591 3.0E-12
sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 451 596 4.0E-12
sp|Q8WTX9|ZDHC1_HUMAN Probable palmitoyltransferase ZDHHC1 OS=Homo sapiens GN=ZDHHC1 PE=2 SV=1 469 635 5.0E-12
sp|Q5FC64|ZDHCS_CAEEL Palmitoyltransferase spe-10 OS=Caenorhabditis elegans GN=spe-10 PE=1 SV=1 467 589 6.0E-12
sp|Q5ADN9|PFA3_CANAL Palmitoyltransferase PFA3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFA3 PE=3 SV=1 468 590 7.0E-12
sp|Q76IC6|ZDH23_RAT Palmitoyltransferase ZDHHC23 OS=Rattus norvegicus GN=Zdhhc23 PE=1 SV=2 448 574 7.0E-12
sp|Q86A83|ZDHC2_DICDI Putative ZDHHC-type palmitoyltransferase 2 OS=Dictyostelium discoideum GN=DDB_G0274739 PE=2 SV=2 468 546 1.0E-11
sp|Q8R173|ZDHC3_MOUSE Palmitoyltransferase ZDHHC3 OS=Mus musculus GN=Zdhhc3 PE=1 SV=1 400 524 1.0E-11
sp|Q9NYG2|ZDHC3_HUMAN Palmitoyltransferase ZDHHC3 OS=Homo sapiens GN=ZDHHC3 PE=1 SV=2 400 524 1.0E-11
sp|Q58DT3|ZDHC4_BOVIN Probable palmitoyltransferase ZDHHC4 OS=Bos taurus GN=ZDHHC4 PE=2 SV=1 470 590 1.0E-11
sp|Q7RWM9|SWF1_NEUCR Palmitoyltransferase SWF1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=swf-1 PE=3 SV=1 402 526 2.0E-11
sp|Q74ZZ2|SWF1_ASHGO Palmitoyltransferase SWF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWF1 PE=3 SV=1 470 526 4.0E-11
sp|Q7SCY6|PFA4_NEUCR Palmitoyltransferase pfa4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-4 PE=3 SV=1 367 562 5.0E-11
sp|Q6FVE6|PFA4_CANGA Palmitoyltransferase PFA4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFA4 PE=3 SV=1 469 527 5.0E-11
sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 363 517 5.0E-11
sp|Q9UVH3|AKR1_MORAP Palmitoyltransferase AKR1 (Fragment) OS=Mortierella alpina PE=3 SV=1 470 595 1.0E-10
sp|Q5BD15|PFA4_EMENI Palmitoyltransferase pfa4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfa4 PE=3 SV=1 367 534 2.0E-10
sp|Q2HJ95|ZDHC6_BOVIN Palmitoyltransferase ZDHHC6 OS=Bos taurus GN=ZDHHC6 PE=2 SV=1 465 532 2.0E-10
sp|Q5BC23|SWF1_EMENI Palmitoyltransferase swf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swf1 PE=3 SV=1 470 589 2.0E-10
sp|Q75CB4|PFA4_ASHGO Palmitoyltransferase PFA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PFA4 PE=3 SV=2 469 528 2.0E-10
sp|Q9CPV7|ZDHC6_MOUSE Palmitoyltransferase ZDHHC6 OS=Mus musculus GN=Zdhhc6 PE=2 SV=1 389 522 3.0E-10
sp|Q5REH2|ZDHC6_PONAB Palmitoyltransferase ZDHHC6 OS=Pongo abelii GN=ZDHHC6 PE=3 SV=1 467 522 4.0E-10
sp|Q9H6R6|ZDHC6_HUMAN Palmitoyltransferase ZDHHC6 OS=Homo sapiens GN=ZDHHC6 PE=1 SV=1 467 522 4.0E-10
sp|O14345|PFA3_SCHPO Palmitoyltransferase pfa3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfa3 PE=3 SV=1 468 593 5.0E-10
sp|Q09701|AKR1_SCHPO Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 469 527 7.0E-10
sp|Q8IYP9|ZDH23_HUMAN Palmitoyltransferase ZDHHC23 OS=Homo sapiens GN=ZDHHC23 PE=1 SV=3 470 574 7.0E-10
sp|Q12006|PFA4_YEAST Palmitoyltransferase PFA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFA4 PE=1 SV=1 470 544 8.0E-10
sp|Q7XA86|ZDH11_ARATH Protein S-acyltransferase 10 OS=Arabidopsis thaliana GN=PAT10 PE=1 SV=1 470 540 1.0E-09
sp|Q8T2Q0|ZDHC6_DICDI Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 452 541 1.0E-09
sp|Q4WUK1|PFA5_ASPFU Palmitoyltransferase pfa5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfa5 PE=3 SV=2 469 567 1.0E-09
sp|Q6BP97|PFA5_DEBHA Palmitoyltransferase PFA5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFA5 PE=3 SV=2 470 602 2.0E-09
sp|Q8VC90|ZDH12_MOUSE Probable palmitoyltransferase ZDHHC12 OS=Mus musculus GN=Zdhhc12 PE=2 SV=1 454 619 2.0E-09
sp|Q5B433|PFA5_EMENI Palmitoyltransferase pfa5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfa5 PE=3 SV=2 469 573 4.0E-09
sp|Q9LIH7|ZDHC7_ARATH Protein S-acyltransferase 11 OS=Arabidopsis thaliana GN=PAT11 PE=2 SV=1 470 544 4.0E-09
sp|Q6CG20|SWF1_YARLI Palmitoyltransferase SWF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWF1 PE=3 SV=1 408 517 7.0E-09
sp|Q554E7|ZDHC5_DICDI Putative ZDHHC-type palmitoyltransferase 5 OS=Dictyostelium discoideum GN=DDB_G0275097 PE=3 SV=1 470 524 2.0E-08
sp|Q6DGF5|ZDH12_RAT Probable palmitoyltransferase ZDHHC12 OS=Rattus norvegicus GN=Zdhhc12 PE=2 SV=1 465 619 2.0E-08
sp|Q4IMZ7|PFA4_GIBZE Palmitoyltransferase PFA4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFA4 PE=3 SV=1 468 560 4.0E-08
sp|Q6C7Q0|PFA4_YARLI Palmitoyltransferase PFA4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFA4 PE=3 SV=1 469 589 6.0E-08
sp|Q96GR4|ZDH12_HUMAN Probable palmitoyltransferase ZDHHC12 OS=Homo sapiens GN=ZDHHC12 PE=2 SV=2 465 619 2.0E-07
sp|Q5NVB9|ZDH13_PONAB Palmitoyltransferase ZDHHC13 OS=Pongo abelii GN=ZDHHC13 PE=2 SV=1 470 532 2.0E-07
sp|Q6UX98|ZDH24_HUMAN Probable palmitoyltransferase ZDHHC24 OS=Homo sapiens GN=ZDHHC24 PE=1 SV=1 469 590 2.0E-07
sp|Q4R690|ZDH13_MACFA Palmitoyltransferase ZDHHC13 OS=Macaca fascicularis GN=ZDHHC13 PE=2 SV=1 470 532 3.0E-07
sp|Q8IUH4|ZDH13_HUMAN Palmitoyltransferase ZDHHC13 OS=Homo sapiens GN=ZDHHC13 PE=1 SV=3 470 535 4.0E-07
sp|Q54VH7|ZDHC8_DICDI Putative ZDHHC-type palmitoyltransferase 8 OS=Dictyostelium discoideum GN=DDB_G0280329 PE=2 SV=1 477 527 7.0E-07
sp|Q6IR37|ZDH24_MOUSE Probable palmitoyltransferase ZDHHC24 OS=Mus musculus GN=Zdhhc24 PE=2 SV=2 469 594 1.0E-06
sp|Q6C4W5|PFA3_YARLI Palmitoyltransferase PFA3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFA3 PE=3 SV=1 467 596 1.0E-06
sp|Q9CWU2|ZDH13_MOUSE Palmitoyltransferase ZDHHC13 OS=Mus musculus GN=Zdhhc13 PE=1 SV=2 470 533 1.0E-06
sp|Q552M6|ZDHC7_DICDI Putative ZDHHC-type palmitoyltransferase 7 OS=Dictyostelium discoideum GN=DDB_G0276017 PE=2 SV=1 470 610 1.0E-06
sp|A0PK84|ZDH22_MOUSE Palmitoyltransferase ZDHHC22 OS=Mus musculus GN=Zdhhc22 PE=2 SV=1 478 535 2.0E-06
sp|Q03289|PFA5_YEAST Palmitoyltransferase PFA5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFA5 PE=1 SV=1 470 612 2.0E-06
sp|Q2TGI8|ZDH22_RAT Palmitoyltransferase ZDHHC22 OS=Rattus norvegicus GN=Zdhhc22 PE=2 SV=1 478 535 2.0E-06
sp|Q6C7D1|PFA5_YARLI Palmitoyltransferase PFA5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFA5 PE=3 SV=1 468 530 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 369 391 22
2 396 418 22
3 516 538 22
4 558 580 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2490
MEHPDSDEQPMARADAADGPPSARHPRPVSVVSSRIADVASEAAGDARPPRYGSSPPPKGPDLASRPDIRPDTAQ
TGASPKAAWPAPQARRTSYASGLPAKRGSIASVSNASAGRAPSLTTKTHVPSITSNAFFHPMSSQKLQAQRAAVS
RPAAALRRPSQPQPHLADLDDAATDLGGSVVNENIVAHHRQLSGADNQRARAPSRGTEMTEHENFDRVTGNTSPS
HGHNPNGSQPDSVRPLRRTSNPRPRLSVTAERGFKDLGSLPSPIKSSRSFRSSFLLPNRSDHGQASQNRSTEGAE
KLSSSNSSPRLRPVDSLGQPAPPSAKAQAQVGRGTPARPEGRVYQYFDGNTVFCLGGRWQNTKHRPINVATGLLV
LVPCVLFYVFEASWLWHNVSPAIPITFAYLTYICLSSFLHASVSDPGILPRNLHRFPPLYEQEDLLRVGPPTNDW
TLIKSVEGSTAAMEVPVKHCRTCNIWRPPRAHHCRLCDNCIETHDHHCVWLNNCVGKRNYRFFFTFVTSATLLAA
YLVATSLAQVLLYMDREHVSFSRAIDHFRVPFALAILGFFEFLYPAALMGYHLFLMARGETTREFMNSHKFAKKQ
RYRAFSQGGIARNLLAVLCRPRPPTYYRFKNRYRHGDQRLGSRRHHHARKNSQGLEMDAVQPGGSSRGFQGPVAL
REPSRG*
Coding >Hirsu2|2490
ATGGAGCACCCAGACTCGGACGAACAGCCCATGGCTCGCGCCGACGCCGCCGACGGTCCGCCGTCCGCGCGCCAC
CCCCGGCCCGTCAGCGTCGTTTCGTCCCGCATCGCCGACGTCGCCAGCGAAGCCGCCGGCGATGCGAGACCGCCG
CGCTACGGCTCGAGCCCGCCGCCCAAGGGTCCCGACCTTGCCTCGCGCCCCGACATCCGCCCCGACACGGCCCAG
ACGGGAGCCTCGCCCAAGGCCGCCTGGCCCGCTCCTCAGGCCCGGCGCACGAGCTACGCCTCCGGCTTGCCCGCC
AAGAGAGGCAGCATCGCCAGCGTGTCCAACGCATCCGCCGGCCGCGCCCCCAGCCTGACGACCAAGACGCACGTC
CCCTCCATCACCTCCAACGCCTTCTTCCATCCCATGAGCTCGCAGAAGCTGCAGGCCCAGCGCGCTGCCGTCTCG
AGGCCCGCCGCCGCCCTCCGCCGCCCCTCGCAGCCGCAACCCCATCTCGCCGACCTGGACGATGCCGCCACCGAC
CTGGGCGGCAGCGTCGTCAACGAGAATATCGTCGCCCATCACCGCCAGCTGAGCGGCGCCGACAACCAGCGCGCG
CGCGCGCCCTCGCGCGGCACCGAGATGACCGAGCACGAGAACTTCGATCGCGTCACGGGAAACACGAGCCCCTCG
CACGGCCACAACCCCAACGGCAGCCAGCCGGATAGTGTCCGGCCGCTGCGCCGCACCTCGAACCCCCGCCCCCGT
CTCAGCGTCACGGCCGAAAGAGGTTTCAAGGATCTCGGGAGTCTGCCGAGCCCCATCAAATCCTCGCGCTCCTTC
CGCTCCAGCTTTCTCCTCCCCAACCGCAGCGACCACGGCCAGGCCAGCCAGAACCGGAGCACCGAGGGCGCCGAG
AAGCTCTCGTCCAGCAACTCGTCTCCTCGCCTGCGGCCCGTCGACTCCCTCGGCCAGCCCGCGCCGCCGTCCGCC
AAGGCCCAGGCCCAGGTTGGGCGCGGCACCCCGGCTCGGCCGGAGGGCCGCGTCTACCAGTACTTCGATGGCAAC
ACCGTCTTCTGCCTCGGCGGCCGCTGGCAAAACACCAAACACAGGCCCATCAACGTCGCGACCGGCCTCCTGGTC
CTGGTGCCCTGTGTGCTCTTCTACGTCTTCGAGGCCTCCTGGTTGTGGCACAACGTCTCGCCCGCCATCCCAATC
ACCTTTGCCTACCTGACCTACATCTGCCTCTCCTCCTTCCTGCACGCCTCCGTCTCGGATCCCGGAATCCTCCCT
CGCAACCTTCACCGGTTCCCCCCCCTCTACGAGCAGGAGGACCTGCTGCGCGTCGGGCCGCCCACCAACGACTGG
ACGCTCATCAAGTCGGTCGAGGGAAGCACGGCGGCCATGGAGGTGCCCGTCAAGCACTGTCGCACCTGCAACATC
TGGCGGCCGCCCCGCGCCCACCACTGCCGCCTCTGCGACAACTGCATCGAGACGCACGACCACCACTGCGTCTGG
CTCAACAACTGTGTCGGGAAGCGCAACTATCGCTTCTTCTTCACCTTTGTCACGTCGGCCACCCTGCTGGCCGCC
TACCTCGTCGCCACCAGTCTGGCCCAGGTGCTCCTGTACATGGATCGCGAGCACGTTTCCTTCTCCAGGGCCATC
GACCACTTCCGCGTGCCCTTCGCCCTCGCCATCCTCGGCTTCTTCGAGTTCCTCTACCCGGCCGCCCTGATGGGC
TACCACCTGTTCCTGATGGCGCGAGGCGAGACGACGCGCGAGTTCATGAACTCGCACAAGTTCGCCAAGAAGCAG
CGATACCGCGCCTTCAGCCAGGGCGGCATCGCGAGAAACCTGCTTGCCGTCCTCTGCCGTCCGCGCCCGCCGACC
TACTACCGCTTCAAGAACCGGTACCGGCACGGCGACCAGCGGCTCGGCTCCCGGCGACACCACCACGCCAGGAAG
AATTCTCAGGGGCTCGAGATGGACGCGGTCCAGCCCGGCGGCTCGTCCCGAGGATTCCAAGGCCCGGTAGCGCTA
AGAGAGCCGAGCCGAGGATGA
Transcript >Hirsu2|2490
ATGGAGCACCCAGACTCGGACGAACAGCCCATGGCTCGCGCCGACGCCGCCGACGGTCCGCCGTCCGCGCGCCAC
CCCCGGCCCGTCAGCGTCGTTTCGTCCCGCATCGCCGACGTCGCCAGCGAAGCCGCCGGCGATGCGAGACCGCCG
CGCTACGGCTCGAGCCCGCCGCCCAAGGGTCCCGACCTTGCCTCGCGCCCCGACATCCGCCCCGACACGGCCCAG
ACGGGAGCCTCGCCCAAGGCCGCCTGGCCCGCTCCTCAGGCCCGGCGCACGAGCTACGCCTCCGGCTTGCCCGCC
AAGAGAGGCAGCATCGCCAGCGTGTCCAACGCATCCGCCGGCCGCGCCCCCAGCCTGACGACCAAGACGCACGTC
CCCTCCATCACCTCCAACGCCTTCTTCCATCCCATGAGCTCGCAGAAGCTGCAGGCCCAGCGCGCTGCCGTCTCG
AGGCCCGCCGCCGCCCTCCGCCGCCCCTCGCAGCCGCAACCCCATCTCGCCGACCTGGACGATGCCGCCACCGAC
CTGGGCGGCAGCGTCGTCAACGAGAATATCGTCGCCCATCACCGCCAGCTGAGCGGCGCCGACAACCAGCGCGCG
CGCGCGCCCTCGCGCGGCACCGAGATGACCGAGCACGAGAACTTCGATCGCGTCACGGGAAACACGAGCCCCTCG
CACGGCCACAACCCCAACGGCAGCCAGCCGGATAGTGTCCGGCCGCTGCGCCGCACCTCGAACCCCCGCCCCCGT
CTCAGCGTCACGGCCGAAAGAGGTTTCAAGGATCTCGGGAGTCTGCCGAGCCCCATCAAATCCTCGCGCTCCTTC
CGCTCCAGCTTTCTCCTCCCCAACCGCAGCGACCACGGCCAGGCCAGCCAGAACCGGAGCACCGAGGGCGCCGAG
AAGCTCTCGTCCAGCAACTCGTCTCCTCGCCTGCGGCCCGTCGACTCCCTCGGCCAGCCCGCGCCGCCGTCCGCC
AAGGCCCAGGCCCAGGTTGGGCGCGGCACCCCGGCTCGGCCGGAGGGCCGCGTCTACCAGTACTTCGATGGCAAC
ACCGTCTTCTGCCTCGGCGGCCGCTGGCAAAACACCAAACACAGGCCCATCAACGTCGCGACCGGCCTCCTGGTC
CTGGTGCCCTGTGTGCTCTTCTACGTCTTCGAGGCCTCCTGGTTGTGGCACAACGTCTCGCCCGCCATCCCAATC
ACCTTTGCCTACCTGACCTACATCTGCCTCTCCTCCTTCCTGCACGCCTCCGTCTCGGATCCCGGAATCCTCCCT
CGCAACCTTCACCGGTTCCCCCCCCTCTACGAGCAGGAGGACCTGCTGCGCGTCGGGCCGCCCACCAACGACTGG
ACGCTCATCAAGTCGGTCGAGGGAAGCACGGCGGCCATGGAGGTGCCCGTCAAGCACTGTCGCACCTGCAACATC
TGGCGGCCGCCCCGCGCCCACCACTGCCGCCTCTGCGACAACTGCATCGAGACGCACGACCACCACTGCGTCTGG
CTCAACAACTGTGTCGGGAAGCGCAACTATCGCTTCTTCTTCACCTTTGTCACGTCGGCCACCCTGCTGGCCGCC
TACCTCGTCGCCACCAGTCTGGCCCAGGTGCTCCTGTACATGGATCGCGAGCACGTTTCCTTCTCCAGGGCCATC
GACCACTTCCGCGTGCCCTTCGCCCTCGCCATCCTCGGCTTCTTCGAGTTCCTCTACCCGGCCGCCCTGATGGGC
TACCACCTGTTCCTGATGGCGCGAGGCGAGACGACGCGCGAGTTCATGAACTCGCACAAGTTCGCCAAGAAGCAG
CGATACCGCGCCTTCAGCCAGGGCGGCATCGCGAGAAACCTGCTTGCCGTCCTCTGCCGTCCGCGCCCGCCGACC
TACTACCGCTTCAAGAACCGGTACCGGCACGGCGACCAGCGGCTCGGCTCCCGGCGACACCACCACGCCAGGAAG
AATTCTCAGGGGCTCGAGATGGACGCGGTCCAGCCCGGCGGCTCGTCCCGAGGATTCCAAGGCCCGGTAGCGCTA
AGAGAGCCGAGCCGAGGATGA
Gene >Hirsu2|2490
ATGGAGCACCCAGACTCGGACGAACAGCCCATGGCTCGCGCCGACGCCGCCGACGGTCCGCCGTCCGCGCGCCAC
CCCCGGCCCGTCAGCGTCGTTTCGTCCCGCATCGCCGACGTCGCCAGCGAAGCCGCCGGCGATGCGAGACCGCCG
CGCTACGGCTCGAGCCCGCCGCCCAAGGGTCCCGACCTTGCCTCGCGCCCCGACATCCGCCCCGACACGGCCCAG
ACGGGAGCCTCGCCCAAGGCCGCCTGGCCCGCTCCTCAGGCCCGGCGCACGAGCTACGCCTCCGGCTTGCCCGCC
AAGAGAGGCAGCATCGCCAGCGTGTCCAACGCATCCGCCGGCCGCGCCCCCAGCCTGACGACCAAGACGCACGTC
CCCTCCATCACCTCCAACGCCTTCTTCCATCCCATGAGCTCGCAGAAGCTGCAGGCCCAGCGCGCTGCCGTCTCG
AGGCCCGCCGCCGCCCTCCGCCGCCCCTCGCAGCCGCAACCCCATCTCGCCGACCTGGACGATGCCGCCACCGAC
CTGGGCGGCAGCGTCGTCAACGAGAATATCGTCGCCCATCACCGCCAGCTGAGCGGCGCCGACAACCAGCGCGCG
CGCGCGCCCTCGCGCGGCACCGAGATGACCGAGCACGAGAACTTCGATCGCGTCACGGGAAACACGAGCCCCTCG
CACGGCCACAACCCCAACGGCAGCCAGCCGGATAGTGTCCGGCCGCTGCGCCGCACCTCGAACCCCCGCCCCCGT
CTCAGCGTCACGGCCGAAAGAGGTTTCAAGGATCTCGGGAGTCTGCCGAGCCCCATCAAATCCTCGCGCTCCTTC
CGCTCCAGCTTTCTCCTCCCCAACCGCAGCGACCACGGCCAGGCCAGCCAGAACCGGAGCACCGAGGGCGCCGAG
AAGCTCTCGTCCAGCAACTCGTCTCCTCGCCTGCGGCCCGTCGACTCCCTCGGCCAGCCCGCGCCGCCGTCCGCC
AAGGCCCAGGCCCAGGTTGGGCGCGGCACCCCGGCTCGGCCGGAGGGCCGCGTCTACCAGTACTTCGATGGCAAC
ACCGTCTTCTGCCTCGGCGGCCGCTGGCAAAACACCAAACACAGGCCCATCAACGTCGCGACCGGCCTCCTGGTC
CTGGTGCCCTGTGTGCTCTTCTACGTCTTCGAGGCCTCCTGGTTGTGGCACAACGTCTCGCCCGCCATCCCAATC
ACCTTTGCCTACCTGACCTACATCTGCCTCTCCTCCTTCCTGCACGCCTCCGTCTCGGATCCCGGAGTAAGTGGC
ACGCCCCTCGCCTGTCAGCTTGGATGCCCGTCGTCGAGGAGTGGCTAACGTGACGGACAGATCCTCCCTCGCAAC
CTTCACCGGTTCCCCCCCCTCTACGAGCAGGAGGACCTGCTGCGCGTCGGGCCGCCCACCAACGACTGGACGCTC
ATCAAGTCGGTCGAGGGAAGCACGGCGGCCATGGAGGTGCCCGTCAAGCACTGTCGCACCTGCAACATCTGGCGG
CCGCCCCGCGCCCACCACTGCCGCCTCTGCGACAACTGCATCGAGACGCACGACCACCACTGCGTCTGGCTCAAC
AACTGTGTCGGGAAGCGCAACTATCGCTTCTTCTTCACCTTTGTCACGTCGGCCACCCTGCTGGCCGCCTACCTC
GTCGCCACCAGTCTGGCCCAGGTGCTCCTGTACATGGATCGCGAGCACGTTTCCTTCTCCAGGGCCATCGACCAC
TTCCGCGTGCCCTTCGCCCTCGCCATCCTCGGCTTCTTCGAGTTCCTCTACCCGGCCGCCCTGATGGGCTACCAC
CTGTTCCTGATGGCGCGAGGCGAGACGACGCGCGAGTTCATGAACTCGCACAAGTTCGCCAAGAAGCAGCGATAC
CGCGCCTTCAGCCAGGGCGGCATCGCGAGAAACCTGCTTGCCGTCCTCTGCCGTCCGCGCCCGCCGACCTACTAC
CGCTTCAAGAACCGGTACCGGCACGGCGACCAGCGGCTCGGCTCCCGGCGACACCACCACGCCAGGAAGAATTCT
CAGGGGCTCGAGATGGACGCGGTCCAGCCCGGCGGCTCGTCCCGAGGATTCCAAGGCCCGGTAGCGCTAAGAGAG
CCGAGCCGAGGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail