Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|248
Gene name
LocationContig_1045:30..954
Strand-
Gene length (bp)924
Transcript length (bp)756
Coding sequence length (bp)756
Protein length (aa) 252

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 6.1E-27 9 203

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q07651|FMP45_YEAST SUR7 family protein FMP45 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP45 PE=1 SV=1 22 203 2.0E-19
sp|Q5A4M8|SUR7_CANAL Protein SUR7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SUR7 PE=1 SV=1 10 199 2.0E-18
sp|P54003|SUR7_YEAST Protein SUR7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR7 PE=1 SV=1 17 242 5.0E-15
sp|P40169|YNT4_YEAST Uncharacterized plasma membrane protein YNL194C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL194C PE=1 SV=1 9 203 3.0E-14

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0005575 cellular_component No
GO:0044464 cell part No
GO:0016020 membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 113 135 22
3 140 162 22
4 183 205 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|248
MKNIPAGMVGLVLMAVSIMFLWWVILSGVTSSTPIRHVYFLRADTSGIDGARDVSQWNYWFICGYKNRDCGDTYA
APPFGYAWNANANNVPDGLGGRHGHHTTSYHMYYMWRFGWVFLLMTLFFEHLALFASLVACCGRLGAAVASFMCY
IALFWYTLAVSIITAVFCQARHRFHRAGRSARIGAWCFGFLWASYAGLLFASILFSFGIRRGKEAAVATGASRGR
TGGGMWRRRSNRSQSYDGRRVKEEYS*
Coding >Hirsu2|248
ATGAAGAACATCCCCGCCGGCATGGTGGGCCTCGTCCTGATGGCCGTCTCCATCATGTTCCTGTGGTGGGTCATC
CTGTCGGGCGTGACGAGCTCGACGCCCATCCGACACGTCTACTTCCTGCGCGCCGACACCAGCGGCATCGACGGC
GCCCGCGACGTCTCGCAGTGGAACTACTGGTTCATCTGCGGCTACAAGAACCGCGACTGCGGCGACACGTACGCC
GCCCCGCCCTTCGGCTACGCCTGGAATGCCAACGCCAACAACGTGCCGGACGGCCTCGGCGGCCGCCACGGCCAC
CACACCACCTCGTACCACATGTACTACATGTGGCGCTTCGGCTGGGTCTTCCTCCTCATGACCCTCTTCTTCGAG
CACCTGGCCCTGTTCGCCAGCCTCGTCGCCTGCTGCGGCCGCCTCGGCGCCGCCGTCGCCTCCTTCATGTGCTAC
ATCGCCCTCTTCTGGTACACGCTCGCCGTCTCCATCATCACTGCCGTCTTCTGCCAGGCCCGCCACCGCTTCCAC
AGGGCCGGCCGCAGCGCCCGCATCGGCGCCTGGTGCTTCGGCTTCCTGTGGGCCTCGTACGCCGGCCTGCTCTTC
GCCTCCATCCTCTTCAGCTTCGGCATCCGCCGCGGCAAGGAGGCCGCCGTCGCCACGGGCGCCTCGCGCGGCCGC
ACCGGCGGCGGCATGTGGCGCCGCCGCAGTAACCGCAGCCAGTCGTACGACGGCCGCCGCGTCAAGGAGGAGTAC
TCGTAA
Transcript >Hirsu2|248
ATGAAGAACATCCCCGCCGGCATGGTGGGCCTCGTCCTGATGGCCGTCTCCATCATGTTCCTGTGGTGGGTCATC
CTGTCGGGCGTGACGAGCTCGACGCCCATCCGACACGTCTACTTCCTGCGCGCCGACACCAGCGGCATCGACGGC
GCCCGCGACGTCTCGCAGTGGAACTACTGGTTCATCTGCGGCTACAAGAACCGCGACTGCGGCGACACGTACGCC
GCCCCGCCCTTCGGCTACGCCTGGAATGCCAACGCCAACAACGTGCCGGACGGCCTCGGCGGCCGCCACGGCCAC
CACACCACCTCGTACCACATGTACTACATGTGGCGCTTCGGCTGGGTCTTCCTCCTCATGACCCTCTTCTTCGAG
CACCTGGCCCTGTTCGCCAGCCTCGTCGCCTGCTGCGGCCGCCTCGGCGCCGCCGTCGCCTCCTTCATGTGCTAC
ATCGCCCTCTTCTGGTACACGCTCGCCGTCTCCATCATCACTGCCGTCTTCTGCCAGGCCCGCCACCGCTTCCAC
AGGGCCGGCCGCAGCGCCCGCATCGGCGCCTGGTGCTTCGGCTTCCTGTGGGCCTCGTACGCCGGCCTGCTCTTC
GCCTCCATCCTCTTCAGCTTCGGCATCCGCCGCGGCAAGGAGGCCGCCGTCGCCACGGGCGCCTCGCGCGGCCGC
ACCGGCGGCGGCATGTGGCGCCGCCGCAGTAACCGCAGCCAGTCGTACGACGGCCGCCGCGTCAAGGAGGAGTAC
TCGTAA
Gene >Hirsu2|248
ATGAAGAGTGAGTCGATCGCGCGTGCCTCTCGGACCGTCCGCCGGCTTCCTTGGGCTGACCCGGCCTGTCCGTCC
GTTTCGCAGACATCCCCGCCGGCATGGTGGGCCTCGTCCTGATGGCCGTCTCCATCATGTTCCTGTGGTGGGTCA
TCCTGTCGGGCGTGACGAGCTCGACGCCCATCCGACACGTCTACTTCCTGCGCGCCGACACCAGCGGCATCGACG
GCGCCCGCGACGTCTCGCAGTGGAACTACTGGTTCATCTGCGGCTACAAGAACCGCGACTGCGGCGACACGTACG
CCGCCCCGCCCTTCGGCTACGCCTGGAATGCCAACGCCAACAACGTGCCGGACGGCCTCGGCGGCCGCCACGGCC
ACCACACCACCTCGTACCACATGTACTACATGTGGCGCTTCGGCTGGGTCTTCCTCCTCATGACCCTCTTCTTCG
AGCACCTGGCCCTGTTCGCCAGCCTCGTCGCCTGCTGCGGCCGCCTCGGCGCCGCCGTCGCCTCCTTCATGTGCT
ACATCGCCCTCTTCTGGTACACGCTCGCCGTCTCCATCATCACGTACGTTGTGCCCCCCCCCCCCCCTCTTTCCT
CCTCGCCCACGTCCGCCGGAGATGATGGTGGTAGCGGTAGCTGACGCCGTCCGCAACAGTGCCGTCTTCTGCCAG
GCCCGCCACCGCTTCCACAGGGCCGGCCGCAGCGCCCGCATCGGCGCCTGGTGCTTCGGCTTCCTGTGGGCCTCG
TACGCCGGCCTGCTCTTCGCCTCCATCCTCTTCAGCTTCGGCATCCGCCGCGGCAAGGAGGCCGCCGTCGCCACG
GGCGCCTCGCGCGGCCGCACCGGCGGCGGCATGTGGCGCCGCCGCAGTAACCGCAGCCAGTCGTACGACGGCCGC
CGCGTCAAGGAGGAGTACTCGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail