Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|248
Gene name
LocationContig_1045:30..954
Strand-
Gene length (bp)924
Transcript length (bp)756
Coding sequence length (bp)756
Protein length (aa) 252

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 6.7E-27 9 203

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q07651|FMP45_YEAST SUR7 family protein FMP45 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP45 PE=1 SV=1 22 203 2.0E-19
sp|Q5A4M8|SUR7_CANAL Protein SUR7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SUR7 PE=1 SV=1 10 199 2.0E-18
sp|P54003|SUR7_YEAST Protein SUR7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR7 PE=1 SV=1 17 242 5.0E-15
sp|P40169|YNT4_YEAST Uncharacterized plasma membrane protein YNL194C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL194C PE=1 SV=1 9 203 3.0E-14

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0005575 cellular_component No
GO:0016020 membrane No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1244 0.1063 0.2385 0.7243 0.1033 0.0107 0.2136 0.592 0.3919 0.0015

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 113 135 22
3 140 162 22
4 183 205 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2103
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2791
Ophiocordyceps australis map64 (Brazil) OphauB2|2817
Ophiocordyceps camponoti-floridani Ophcf2|00807
Ophiocordyceps camponoti-rufipedis Ophun1|1752
Ophiocordyceps kimflemingae Ophio5|6450
Ophiocordyceps subramaniannii Hirsu2|248 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|248
MKNIPAGMVGLVLMAVSIMFLWWVILSGVTSSTPIRHVYFLRADTSGIDGARDVSQWNYWFICGYKNRDCGDTYA
APPFGYAWNANANNVPDGLGGRHGHHTTSYHMYYMWRFGWVFLLMTLFFEHLALFASLVACCGRLGAAVASFMCY
IALFWYTLAVSIITAVFCQARHRFHRAGRSARIGAWCFGFLWASYAGLLFASILFSFGIRRGKEAAVATGASRGR
TGGGMWRRRSNRSQSYDGRRVKEEYS*
Coding >Hirsu2|248
ATGAAGAACATCCCCGCCGGCATGGTGGGCCTCGTCCTGATGGCCGTCTCCATCATGTTCCTGTGGTGGGTCATC
CTGTCGGGCGTGACGAGCTCGACGCCCATCCGACACGTCTACTTCCTGCGCGCCGACACCAGCGGCATCGACGGC
GCCCGCGACGTCTCGCAGTGGAACTACTGGTTCATCTGCGGCTACAAGAACCGCGACTGCGGCGACACGTACGCC
GCCCCGCCCTTCGGCTACGCCTGGAATGCCAACGCCAACAACGTGCCGGACGGCCTCGGCGGCCGCCACGGCCAC
CACACCACCTCGTACCACATGTACTACATGTGGCGCTTCGGCTGGGTCTTCCTCCTCATGACCCTCTTCTTCGAG
CACCTGGCCCTGTTCGCCAGCCTCGTCGCCTGCTGCGGCCGCCTCGGCGCCGCCGTCGCCTCCTTCATGTGCTAC
ATCGCCCTCTTCTGGTACACGCTCGCCGTCTCCATCATCACTGCCGTCTTCTGCCAGGCCCGCCACCGCTTCCAC
AGGGCCGGCCGCAGCGCCCGCATCGGCGCCTGGTGCTTCGGCTTCCTGTGGGCCTCGTACGCCGGCCTGCTCTTC
GCCTCCATCCTCTTCAGCTTCGGCATCCGCCGCGGCAAGGAGGCCGCCGTCGCCACGGGCGCCTCGCGCGGCCGC
ACCGGCGGCGGCATGTGGCGCCGCCGCAGTAACCGCAGCCAGTCGTACGACGGCCGCCGCGTCAAGGAGGAGTAC
TCGTAA
Transcript >Hirsu2|248
ATGAAGAACATCCCCGCCGGCATGGTGGGCCTCGTCCTGATGGCCGTCTCCATCATGTTCCTGTGGTGGGTCATC
CTGTCGGGCGTGACGAGCTCGACGCCCATCCGACACGTCTACTTCCTGCGCGCCGACACCAGCGGCATCGACGGC
GCCCGCGACGTCTCGCAGTGGAACTACTGGTTCATCTGCGGCTACAAGAACCGCGACTGCGGCGACACGTACGCC
GCCCCGCCCTTCGGCTACGCCTGGAATGCCAACGCCAACAACGTGCCGGACGGCCTCGGCGGCCGCCACGGCCAC
CACACCACCTCGTACCACATGTACTACATGTGGCGCTTCGGCTGGGTCTTCCTCCTCATGACCCTCTTCTTCGAG
CACCTGGCCCTGTTCGCCAGCCTCGTCGCCTGCTGCGGCCGCCTCGGCGCCGCCGTCGCCTCCTTCATGTGCTAC
ATCGCCCTCTTCTGGTACACGCTCGCCGTCTCCATCATCACTGCCGTCTTCTGCCAGGCCCGCCACCGCTTCCAC
AGGGCCGGCCGCAGCGCCCGCATCGGCGCCTGGTGCTTCGGCTTCCTGTGGGCCTCGTACGCCGGCCTGCTCTTC
GCCTCCATCCTCTTCAGCTTCGGCATCCGCCGCGGCAAGGAGGCCGCCGTCGCCACGGGCGCCTCGCGCGGCCGC
ACCGGCGGCGGCATGTGGCGCCGCCGCAGTAACCGCAGCCAGTCGTACGACGGCCGCCGCGTCAAGGAGGAGTAC
TCGTAA
Gene >Hirsu2|248
ATGAAGAGTGAGTCGATCGCGCGTGCCTCTCGGACCGTCCGCCGGCTTCCTTGGGCTGACCCGGCCTGTCCGTCC
GTTTCGCAGACATCCCCGCCGGCATGGTGGGCCTCGTCCTGATGGCCGTCTCCATCATGTTCCTGTGGTGGGTCA
TCCTGTCGGGCGTGACGAGCTCGACGCCCATCCGACACGTCTACTTCCTGCGCGCCGACACCAGCGGCATCGACG
GCGCCCGCGACGTCTCGCAGTGGAACTACTGGTTCATCTGCGGCTACAAGAACCGCGACTGCGGCGACACGTACG
CCGCCCCGCCCTTCGGCTACGCCTGGAATGCCAACGCCAACAACGTGCCGGACGGCCTCGGCGGCCGCCACGGCC
ACCACACCACCTCGTACCACATGTACTACATGTGGCGCTTCGGCTGGGTCTTCCTCCTCATGACCCTCTTCTTCG
AGCACCTGGCCCTGTTCGCCAGCCTCGTCGCCTGCTGCGGCCGCCTCGGCGCCGCCGTCGCCTCCTTCATGTGCT
ACATCGCCCTCTTCTGGTACACGCTCGCCGTCTCCATCATCACGTACGTTGTGCCCCCCCCCCCCCCTCTTTCCT
CCTCGCCCACGTCCGCCGGAGATGATGGTGGTAGCGGTAGCTGACGCCGTCCGCAACAGTGCCGTCTTCTGCCAG
GCCCGCCACCGCTTCCACAGGGCCGGCCGCAGCGCCCGCATCGGCGCCTGGTGCTTCGGCTTCCTGTGGGCCTCG
TACGCCGGCCTGCTCTTCGCCTCCATCCTCTTCAGCTTCGGCATCCGCCGCGGCAAGGAGGCCGCCGTCGCCACG
GGCGCCTCGCGCGGCCGCACCGGCGGCGGCATGTGGCGCCGCCGCAGTAACCGCAGCCAGTCGTACGACGGCCGC
CGCGTCAAGGAGGAGTACTCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail