Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2465
Gene name
LocationContig_1590:980..1864
Strand+
Gene length (bp)884
Transcript length (bp)624
Coding sequence length (bp)624
Protein length (aa) 208

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P25710|NUJM_NEUCR NADH-ubiquinone oxidoreductase 21.3 kDa subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B13D24.010 PE=4 SV=1 19 201 2.0E-47

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 93 110 17
3 114 136 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2465
MNQRASSGPEALVKAEKPYKPHDVFDETLKTGLGGMGGGFFLAAVRNAMAKGNVGAMSVFTRGAPLIGLCTIGPA
SYAFFSRTMMNLREKDDAWAAAFGGFICGSTLGLPLRRMSAVLGFGAFFSVLEGTFHFLGGRIDSFKDEDDEFER
KEILRRTTRVPLAQTIAEIGEGRGIKPPGYEERRRERIKEKYGIEINPVKATVDGST*
Coding >Hirsu2|2465
ATGAATCAACGGGCGAGCTCCGGCCCCGAGGCGCTCGTGAAGGCCGAGAAGCCGTACAAGCCGCACGATGTCTTC
GACGAGACGCTCAAGACGGGCCTCGGCGGCATGGGCGGCGGCTTCTTCCTCGCCGCCGTGCGCAACGCCATGGCC
AAGGGCAACGTCGGCGCCATGAGCGTCTTCACCCGCGGCGCGCCCCTCATCGGCCTCTGCACCATCGGCCCGGCC
TCGTACGCCTTCTTCTCGCGCACCATGATGAACCTCCGGGAGAAGGATGACGCGTGGGCCGCGGCCTTTGGCGGC
TTCATCTGCGGCAGCACCCTCGGCCTGCCATTACGGAGGATGTCGGCCGTCCTCGGCTTCGGCGCCTTCTTCAGC
GTCCTCGAGGGCACCTTCCACTTCCTCGGCGGCCGTATCGACAGCTTCAAGGACGAGGACGACGAGTTCGAGCGC
AAGGAGATCCTGCGGCGCACCACGCGCGTGCCCCTCGCGCAGACCATCGCCGAGATCGGCGAGGGCCGCGGCATC
AAGCCCCCGGGCTACGAGGAGCGCAGACGAGAGCGGATCAAGGAGAAGTACGGCATCGAGATCAACCCTGTCAAG
GCGACGGTCGACGGGAGCACCTAG
Transcript >Hirsu2|2465
ATGAATCAACGGGCGAGCTCCGGCCCCGAGGCGCTCGTGAAGGCCGAGAAGCCGTACAAGCCGCACGATGTCTTC
GACGAGACGCTCAAGACGGGCCTCGGCGGCATGGGCGGCGGCTTCTTCCTCGCCGCCGTGCGCAACGCCATGGCC
AAGGGCAACGTCGGCGCCATGAGCGTCTTCACCCGCGGCGCGCCCCTCATCGGCCTCTGCACCATCGGCCCGGCC
TCGTACGCCTTCTTCTCGCGCACCATGATGAACCTCCGGGAGAAGGATGACGCGTGGGCCGCGGCCTTTGGCGGC
TTCATCTGCGGCAGCACCCTCGGCCTGCCATTACGGAGGATGTCGGCCGTCCTCGGCTTCGGCGCCTTCTTCAGC
GTCCTCGAGGGCACCTTCCACTTCCTCGGCGGCCGTATCGACAGCTTCAAGGACGAGGACGACGAGTTCGAGCGC
AAGGAGATCCTGCGGCGCACCACGCGCGTGCCCCTCGCGCAGACCATCGCCGAGATCGGCGAGGGCCGCGGCATC
AAGCCCCCGGGCTACGAGGAGCGCAGACGAGAGCGGATCAAGGAGAAGTACGGCATCGAGATCAACCCTGTCAAG
GCGACGGTCGACGGGAGCACCTAG
Gene >Hirsu2|2465
ATGAATCAACGGGCGAGCTCCGGCCCCGAGGCGCTCGTGAAGGCCGAGAAGCCGTACAAGCCGCACGATGTCTTC
GACGAGACGCTCAAGACGGGCCTCGGCGGCATGGGCGGCGGCTTCTTCCTCGCCGCCGTGCGCAACGCCATGGCC
AAGGGCAACGTCGGCGCCATGAGCGTCTTCACCCGCGGCGCGCCCCTCATCGGCCTCTGCAGTACGTGTCTGCGC
GAATTGGGCCCGGCGGGCGGCGTGCAGACGGCGCGCTCGCCTCCCTGCCTGCTTCTCCGTTCCGGCTGACTGGGC
CTTGCTCGCAGCCATCGGCCCGGCCTCGTACGCCTTCTTCTCGCGCACCATGATGAACCTCCGGGAGAAGGATGA
CGCGTGGGCCGCGGCCTTTGGCGGCTTCATCTGCGGCAGCACCCTCGGCCTGCCATGTACGTCTCCCCGCCGAAC
CGCCGCGCCGCGTGTCCCAGGCTGATGGTGACGCCTAGTACGGAGGATGTCGGCCGTCCTCGGCTTCGGCGCCTT
CTTCAGCGTCCTCGAGGGCACCTTCCACTTCCTCGGCGGCCGTATCGACAGCTTCAAGGACGAGGACGACGAGTT
CGAGCGCAAGGAGATCCTGCGGCGCACCACGCGCGTGCCCCTCGCGCAGACCATCGCCGAGATCGGCGAGGGCCG
CGGTGCGTCCCTTCTTCTTCTTCTTCTCCCCCCCCTTCCCCCCCCCCTTGGCCGCCGCGAATCGGCTTTTGCTCT
TCTTGCTGACGCAGCGACCCGCCGTCCCAGGCATCAAGCCCCCGGGCTACGAGGAGCGCAGACGAGAGCGGATCA
AGGAGAAGTACGGCATCGAGATCAACCCTGTCAAGGCGACGGTCGACGGGAGCACCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail