Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2464
Gene name
LocationContig_159:30464..32377
Strand+
Gene length (bp)1913
Transcript length (bp)1851
Coding sequence length (bp)1851
Protein length (aa) 617

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07662 Nucleos_tra2_C Na+ dependent nucleoside transporter C-terminus 1.6E-69 386 601
PF01773 Nucleos_tra2_N Na+ dependent nucleoside transporter N-terminus 1.4E-22 201 271

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UA35|S28A3_EPTST Solute carrier family 28 member 3 OS=Eptatretus stoutii GN=SLC28A3 PE=2 SV=1 194 606 4.0E-83
sp|Q9ERH8|S28A3_MOUSE Solute carrier family 28 member 3 OS=Mus musculus GN=Slc28a3 PE=2 SV=1 198 604 1.0E-78
sp|Q62773|S28A2_RAT Sodium/nucleoside cotransporter 2 OS=Rattus norvegicus GN=Slc28a2 PE=1 SV=1 193 601 1.0E-78
sp|Q8VIH3|S28A3_RAT Solute carrier family 28 member 3 OS=Rattus norvegicus GN=Slc28a3 PE=2 SV=1 195 604 7.0E-78
sp|O43868|S28A2_HUMAN Sodium/nucleoside cotransporter 2 OS=Homo sapiens GN=SLC28A2 PE=2 SV=2 193 601 2.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UA35|S28A3_EPTST Solute carrier family 28 member 3 OS=Eptatretus stoutii GN=SLC28A3 PE=2 SV=1 194 606 4.0E-83
sp|Q9ERH8|S28A3_MOUSE Solute carrier family 28 member 3 OS=Mus musculus GN=Slc28a3 PE=2 SV=1 198 604 1.0E-78
sp|Q62773|S28A2_RAT Sodium/nucleoside cotransporter 2 OS=Rattus norvegicus GN=Slc28a2 PE=1 SV=1 193 601 1.0E-78
sp|Q8VIH3|S28A3_RAT Solute carrier family 28 member 3 OS=Rattus norvegicus GN=Slc28a3 PE=2 SV=1 195 604 7.0E-78
sp|O43868|S28A2_HUMAN Sodium/nucleoside cotransporter 2 OS=Homo sapiens GN=SLC28A2 PE=2 SV=2 193 601 2.0E-77
sp|Q62674|S28A1_RAT Sodium/nucleoside cotransporter 1 OS=Rattus norvegicus GN=Slc28a1 PE=1 SV=1 172 601 4.0E-77
sp|Q9MZT2|S28A1_RABIT Sodium/nucleoside cotransporter 1 OS=Oryctolagus cuniculus GN=SLC28A1 PE=2 SV=1 193 601 2.0E-76
sp|O62667|S28A1_PIG Sodium/nucleoside cotransporter 1 OS=Sus scrofa GN=SLC28A1 PE=2 SV=1 193 601 2.0E-76
sp|O88627|S28A2_MOUSE Sodium/nucleoside cotransporter 2 OS=Mus musculus GN=Slc28a2 PE=1 SV=2 193 601 9.0E-76
sp|Q9HAS3|S28A3_HUMAN Solute carrier family 28 member 3 OS=Homo sapiens GN=SLC28A3 PE=1 SV=1 195 604 1.0E-75
sp|O00337|S28A1_HUMAN Sodium/nucleoside cotransporter 1 OS=Homo sapiens GN=SLC28A1 PE=1 SV=2 191 601 2.0E-74
sp|P44742|Y519_HAEIN Uncharacterized transporter HI_0519 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0519 PE=3 SV=1 199 602 7.0E-74
sp|O32115|YUTK_BACSU Uncharacterized transporter YutK OS=Bacillus subtilis (strain 168) GN=yutK PE=3 SV=1 200 602 1.0E-68
sp|O25792|NUPC_HELPY Nucleoside permease NupC OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=nupC PE=3 SV=1 199 602 9.0E-58
sp|P33021|NUPX_ECOLI Putative nucleoside permease NupX OS=Escherichia coli (strain K12) GN=nupX PE=1 SV=1 199 602 2.0E-47
sp|P33024|PSUT_ECOLI Putative pseudouridine transporter OS=Escherichia coli (strain K12) GN=psuT PE=1 SV=1 199 602 4.0E-43
sp|P0AFF2|NUPC_ECOLI Nucleoside permease NupC OS=Escherichia coli (strain K12) GN=nupC PE=1 SV=1 212 602 6.0E-26
sp|P0AFF3|NUPC_ECOL6 Nucleoside permease NupC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nupC PE=3 SV=1 212 602 6.0E-26
sp|P39141|NUPC_BACSU Nucleoside permease NupC OS=Bacillus subtilis (strain 168) GN=nupC PE=2 SV=4 198 601 1.0E-24
sp|P42312|NUPG_BACSU Purine nucleoside transport protein NupG OS=Bacillus subtilis (strain 168) GN=nupG PE=1 SV=2 198 602 2.0E-22
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

Domain # Start End Length
1 92 111 19
2 118 135 17
3 198 215 17
4 222 244 22
5 280 302 22
6 315 337 22
7 357 379 22
8 449 471 22
9 481 500 19
10 543 565 22
11 580 602 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2464
MAPDSAVPELAGDGMRNPPLKQQHDAVVYAQTGLDRHGVEKAPVVTPPDYSDTEKAEAGHGSTELTSAPGPDDDD
GRRPAPLRLLVRHRRLLVQLLLFLVFTGWWIASLVLHRNDKNWVVPFLLWLAITLRLVFYHVPIRYVSGPIRWLW
HHSAVVVYNAIPPRFRTPAGAAAAVSVILLGSFVSEESADNTRANRAVSLFGMLVIIFVFWLTSAARSHVNWRTV
VGGMLAQYVIGLFVLRTTVGFDIFKFIADRAGDLLGFAKDGLAFLTDDEVPKSTWFLLTVIPAIIFFISLVQVLY
YIGFLQWFIRKFAAFVFWALGVSGAEAVVAAATPFIGQGESAMLVRPFVPHMTKAEIHQIMTCGFATISGSVLVG
YIGLGLNPEALVSSCIMSIPASLAISKLRYPETEETLTAGRVVLPDDDEEGRAENALHAFANGAWLGIKIGGTIV
ASLLCTLAAVGLINGLLSWWGRYLNITNPDLTLQLMLSYILYPVAFLLGVPRNGDILKVAKLIAEKVVTNEFKAF
QKMAKDPEFAPMSARSQLIATYALCGFGNIGSMGVQIGILGQLAPSRGGDVSRLALSALISGVMSTLTSATVAGL
VVTTQLSSFTRGGAPS*
Coding >Hirsu2|2464
ATGGCCCCCGACTCGGCCGTGCCCGAACTGGCCGGCGACGGGATGCGCAACCCCCCTCTCAAACAGCAGCACGAT
GCCGTCGTCTACGCGCAGACCGGCCTGGACCGCCACGGCGTCGAAAAGGCGCCCGTCGTCACGCCGCCCGACTAC
AGCGACACGGAAAAGGCCGAGGCCGGCCATGGCTCGACGGAGCTGACGTCGGCCCCCGGCCCCGACGACGACGAC
GGCCGCCGCCCCGCGCCCCTCCGCCTCCTCGTCCGCCACCGCCGCCTCCTCGTCCAGCTCTTGCTCTTCCTCGTC
TTCACCGGCTGGTGGATCGCCTCCCTCGTCCTCCACCGCAACGACAAGAACTGGGTCGTGCCCTTCCTGCTGTGG
CTCGCCATCACCCTCCGCCTCGTCTTCTACCACGTCCCCATCCGCTACGTCTCGGGCCCCATCCGCTGGCTGTGG
CACCACTCGGCCGTCGTCGTCTACAACGCCATCCCCCCCCGCTTCCGCACCCCCGCCGGCGCCGCCGCCGCCGTC
TCCGTCATCCTCCTCGGCTCCTTCGTCTCCGAGGAGAGCGCCGACAACACGCGCGCCAACCGCGCCGTCAGCCTC
TTCGGCATGCTCGTCATCATCTTCGTCTTCTGGCTCACCAGCGCCGCCCGCTCCCACGTCAACTGGCGCACCGTC
GTCGGCGGCATGCTGGCCCAGTACGTCATCGGCCTCTTCGTCCTGCGCACCACGGTCGGCTTCGACATCTTCAAG
TTCATCGCCGACCGCGCCGGCGACCTGCTCGGCTTCGCCAAGGACGGCCTCGCCTTCCTCACCGACGACGAGGTG
CCCAAGTCGACCTGGTTCCTGCTGACCGTCATCCCCGCCATCATCTTCTTCATCTCGCTCGTCCAGGTGCTCTAC
TACATCGGCTTCCTCCAGTGGTTCATCCGCAAGTTCGCCGCCTTCGTCTTCTGGGCCCTCGGCGTCTCGGGCGCC
GAGGCCGTCGTCGCCGCCGCCACCCCCTTCATCGGCCAGGGCGAGTCGGCCATGCTCGTCCGCCCCTTCGTCCCG
CACATGACCAAGGCCGAGATCCACCAGATCATGACGTGCGGCTTCGCCACCATCTCCGGCTCCGTCCTCGTCGGC
TACATCGGCCTCGGCCTCAACCCCGAGGCCCTCGTCTCGTCGTGCATCATGTCCATCCCGGCCTCGCTCGCCATC
TCCAAGCTGCGCTACCCGGAGACGGAGGAGACGCTGACGGCCGGCCGCGTCGTCCTGCCCGACGACGACGAGGAG
GGCCGCGCCGAGAACGCGCTGCACGCCTTCGCCAACGGCGCCTGGCTCGGCATCAAGATTGGCGGCACCATCGTC
GCCTCGCTGCTGTGCACCCTTGCCGCCGTCGGCCTCATCAACGGCCTGCTGAGCTGGTGGGGCCGCTACCTCAAC
ATCACCAACCCGGACCTGACGCTGCAGCTGATGCTGTCGTACATCCTGTACCCCGTCGCCTTCCTCCTCGGCGTC
CCGCGCAACGGCGACATCCTCAAGGTCGCCAAGCTCATTGCCGAAAAGGTGGTTACCAACGAGTTCAAGGCCTTT
CAGAAGATGGCCAAGGACCCCGAGTTTGCCCCGATGTCGGCTCGGTCGCAGCTCATCGCCACCTACGCCCTGTGC
GGCTTCGGCAACATCGGCTCCATGGGCGTCCAGATCGGCATCCTCGGCCAGCTGGCGCCGTCGCGCGGCGGCGAC
GTGTCGAGGCTCGCGCTGTCGGCCCTCATCTCGGGCGTCATGTCGACGCTGACGTCGGCCACCGTCGCCGGCCTC
GTCGTCACCACGCAGCTCAGCTCCTTTACCAGGGGCGGCGCGCCGTCGTAG
Transcript >Hirsu2|2464
ATGGCCCCCGACTCGGCCGTGCCCGAACTGGCCGGCGACGGGATGCGCAACCCCCCTCTCAAACAGCAGCACGAT
GCCGTCGTCTACGCGCAGACCGGCCTGGACCGCCACGGCGTCGAAAAGGCGCCCGTCGTCACGCCGCCCGACTAC
AGCGACACGGAAAAGGCCGAGGCCGGCCATGGCTCGACGGAGCTGACGTCGGCCCCCGGCCCCGACGACGACGAC
GGCCGCCGCCCCGCGCCCCTCCGCCTCCTCGTCCGCCACCGCCGCCTCCTCGTCCAGCTCTTGCTCTTCCTCGTC
TTCACCGGCTGGTGGATCGCCTCCCTCGTCCTCCACCGCAACGACAAGAACTGGGTCGTGCCCTTCCTGCTGTGG
CTCGCCATCACCCTCCGCCTCGTCTTCTACCACGTCCCCATCCGCTACGTCTCGGGCCCCATCCGCTGGCTGTGG
CACCACTCGGCCGTCGTCGTCTACAACGCCATCCCCCCCCGCTTCCGCACCCCCGCCGGCGCCGCCGCCGCCGTC
TCCGTCATCCTCCTCGGCTCCTTCGTCTCCGAGGAGAGCGCCGACAACACGCGCGCCAACCGCGCCGTCAGCCTC
TTCGGCATGCTCGTCATCATCTTCGTCTTCTGGCTCACCAGCGCCGCCCGCTCCCACGTCAACTGGCGCACCGTC
GTCGGCGGCATGCTGGCCCAGTACGTCATCGGCCTCTTCGTCCTGCGCACCACGGTCGGCTTCGACATCTTCAAG
TTCATCGCCGACCGCGCCGGCGACCTGCTCGGCTTCGCCAAGGACGGCCTCGCCTTCCTCACCGACGACGAGGTG
CCCAAGTCGACCTGGTTCCTGCTGACCGTCATCCCCGCCATCATCTTCTTCATCTCGCTCGTCCAGGTGCTCTAC
TACATCGGCTTCCTCCAGTGGTTCATCCGCAAGTTCGCCGCCTTCGTCTTCTGGGCCCTCGGCGTCTCGGGCGCC
GAGGCCGTCGTCGCCGCCGCCACCCCCTTCATCGGCCAGGGCGAGTCGGCCATGCTCGTCCGCCCCTTCGTCCCG
CACATGACCAAGGCCGAGATCCACCAGATCATGACGTGCGGCTTCGCCACCATCTCCGGCTCCGTCCTCGTCGGC
TACATCGGCCTCGGCCTCAACCCCGAGGCCCTCGTCTCGTCGTGCATCATGTCCATCCCGGCCTCGCTCGCCATC
TCCAAGCTGCGCTACCCGGAGACGGAGGAGACGCTGACGGCCGGCCGCGTCGTCCTGCCCGACGACGACGAGGAG
GGCCGCGCCGAGAACGCGCTGCACGCCTTCGCCAACGGCGCCTGGCTCGGCATCAAGATTGGCGGCACCATCGTC
GCCTCGCTGCTGTGCACCCTTGCCGCCGTCGGCCTCATCAACGGCCTGCTGAGCTGGTGGGGCCGCTACCTCAAC
ATCACCAACCCGGACCTGACGCTGCAGCTGATGCTGTCGTACATCCTGTACCCCGTCGCCTTCCTCCTCGGCGTC
CCGCGCAACGGCGACATCCTCAAGGTCGCCAAGCTCATTGCCGAAAAGGTGGTTACCAACGAGTTCAAGGCCTTT
CAGAAGATGGCCAAGGACCCCGAGTTTGCCCCGATGTCGGCTCGGTCGCAGCTCATCGCCACCTACGCCCTGTGC
GGCTTCGGCAACATCGGCTCCATGGGCGTCCAGATCGGCATCCTCGGCCAGCTGGCGCCGTCGCGCGGCGGCGAC
GTGTCGAGGCTCGCGCTGTCGGCCCTCATCTCGGGCGTCATGTCGACGCTGACGTCGGCCACCGTCGCCGGCCTC
GTCGTCACCACGCAGCTCAGCTCCTTTACCAGGGGCGGCGCGCCGTCGTAG
Gene >Hirsu2|2464
ATGGCCCCCGACTCGGCCGTGCCCGAACTGGCCGGCGACGGGATGCGCAACCCCCCTCTCAAACAGCAGCACGAT
GCCGTCGTCTACGCGCAGACCGGCCTGGACCGCCACGGCGTCGAAAAGGCGCCCGTCGTCACGCCGCCCGACTAC
AGCGACACGGAAAAGGCCGAGGCCGGCCATGGCTCGACGGAGCTGACGTCGGCCCCCGGCCCCGACGACGACGAC
GGCCGCCGCCCCGCGCCCCTCCGCCTCCTCGTCCGCCACCGCCGCCTCCTCGTCCAGCTCTTGCTCTTCCTCGTC
TTCACCGGCTGGTGGATCGCCTCCCTCGTCCTCCACCGCAACGACAAGAACTGGGTCGTGCCCTTCCTGCTGTGG
CTCGCCATCACCCTCCGCCTCGTCTTCTACCACGTCCCCATCCGCTACGTCTCGGGCCCCATCCGCTGGCTGTGG
CACCACTCGGCCGTCGTCGTCTACAACGCCATCCCCCCCCGCTTCCGCACCCCCGCCGGCGCCGCCGCCGCCGTC
TCCGTCATCCTCCTCGGCTCCTTCGTCTCCGAGGAGAGCGCCGACAACACGCGCGCCAACCGCGCCGTCAGCCTC
TTCGGCATGCTCGTCATCATCTTCGTCTTCTGGCTCACCAGCGCCGCCCGCTCCCACGTCAACTGGCGCACCGTC
GTCGGCGGCATGCTGGCCCAGTACGTCATCGGCCTCTTCGTCCTGCGCACCACGGTCGGCTTCGACATCTTCAAG
TTCATCGCCGACCGCGCCGGCGACCTGCTCGGCTTCGCCAAGGACGGCCTCGCCTTCCTCACCGACGACGAGGTG
CCCAAGTCGACCTGGTTCCTGCTGACCGTCATCCCCGCCATCATCTTCTTCATCTCGCTCGTCCAGGTGCTCTAC
TACATCGGCTTCCTCCAGTGGTTCATCCGCAAGTTCGCCGCCTTCGTCTTCTGGGCCCTCGGCGTCTCGGGCGCC
GAGGCCGTCGTCGCCGCCGCCACCCCCTTCATCGGCCAGGGCGAGTCGGCCATGCTCGTCCGCCCCTTCGTCCCG
CACATGACCAAGGCCGAGATCCACCAGATCATGACGTGCGGCTTCGCCACCATCTCCGGCTCCGTCCTCGTCGGC
TACATCGGCCTCGGCCTCAACCCCGAGGCCCTCGTCTCGTCGTGCATCATGTCCATCCCGGCCTCGCTCGCCATC
TCCAAGCTGCGCTACCCGGAGACGGAGGAGACGCTGACGGCCGGCCGCGTCGTCCTGCCCGACGACGACGAGGAG
GGCCGCGCCGAGAACGCGCTGCACGCCTTCGCCAACGGCGCCTGGCTCGGCATCAAGATTGGCGGCACCATCGTC
GCCTCGCTGCTGTGCACCCTTGCCGCCGTCGGCCTCATCAACGGCCTGCTGAGCTGGTGGGGCCGCTACCTCAAC
ATCACCAACCCGGACCTGACGCTGCAGCTGATGCTGTCGTACATCCTGTACCCCGTCGCCTTCCTCCTCGGCGTC
CCGCGCAACGGCGACATCCTCAAGGTCGCCAAGCTCATTGCCGAAAAGGTGGTTACCGTAGGTCGCTCTAGCCCG
ACCGCCGCAGGTGAGAGCCGTGTCTTGCTGACGCCCGCGCGCAGAACGAGTTCAAGGCCTTTCAGAAGATGGCCA
AGGACCCCGAGTTTGCCCCGATGTCGGCTCGGTCGCAGCTCATCGCCACCTACGCCCTGTGCGGCTTCGGCAACA
TCGGCTCCATGGGCGTCCAGATCGGCATCCTCGGCCAGCTGGCGCCGTCGCGCGGCGGCGACGTGTCGAGGCTCG
CGCTGTCGGCCCTCATCTCGGGCGTCATGTCGACGCTGACGTCGGCCACCGTCGCCGGCCTCGTCGTCACCACGC
AGCTCAGCTCCTTTACCAGGGGCGGCGCGCCGTCGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail