Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2459
Gene name
LocationContig_159:5233..8615
Strand-
Gene length (bp)3382
Transcript length (bp)3315
Coding sequence length (bp)3315
Protein length (aa) 1105

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05879 RHD3 Root hair defective 3 GTP-binding protein (RHD3) 7.1E-181 492 1075
PF01585 G-patch G-patch domain 3.8E-13 228 270
PF12457 TIP_N Tuftelin interacting protein N terminal 8.1E-12 39 117
PF12656 G-patch_2 G-patch domain 2.1E-06 229 272

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B2B1M4|SEY1_PODAN Protein SEY1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=SEY1 PE=3 SV=1 490 1101 0.0E+00
sp|Q2GUT7|SEY1_CHAGB Protein SEY1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEY1 PE=3 SV=2 492 1104 0.0E+00
sp|Q9P5X6|SEY1_NEUCR Protein sey1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sey1 PE=3 SV=1 492 1102 0.0E+00
sp|Q525S7|SEY1_MAGO7 Protein SEY1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SEY1 PE=3 SV=1 472 1088 0.0E+00
sp|A7ERA6|SEY1_SCLS1 Protein sey1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sey1 PE=3 SV=1 492 1104 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B2B1M4|SEY1_PODAN Protein SEY1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=SEY1 PE=3 SV=1 490 1101 0.0E+00
sp|Q2GUT7|SEY1_CHAGB Protein SEY1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEY1 PE=3 SV=2 492 1104 0.0E+00
sp|Q9P5X6|SEY1_NEUCR Protein sey1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sey1 PE=3 SV=1 492 1102 0.0E+00
sp|Q525S7|SEY1_MAGO7 Protein SEY1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SEY1 PE=3 SV=1 472 1088 0.0E+00
sp|A7ERA6|SEY1_SCLS1 Protein sey1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sey1 PE=3 SV=1 492 1104 0.0E+00
sp|A6S544|SEY1_BOTFB Protein sey1 OS=Botryotinia fuckeliana (strain B05.10) GN=sey1 PE=3 SV=1 472 1094 0.0E+00
sp|C5FJT2|SEY1_ARTOC Protein SEY1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SEY1 PE=3 SV=1 492 1092 0.0E+00
sp|B2W244|SEY1_PYRTR Protein sey1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=sey1 PE=3 SV=2 492 1102 0.0E+00
sp|Q0V302|SEY1_PHANO Protein SEY1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SEY1 PE=3 SV=2 492 1104 0.0E+00
sp|C5K3E1|SEY1_AJEDS Protein SEY1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=SEY1 PE=3 SV=1 492 1081 0.0E+00
sp|C5GMK3|SEY1_AJEDR Protein SEY1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=SEY1 PE=3 SV=1 492 1081 0.0E+00
sp|C1G4S9|SEY1_PARBD Protein SEY1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=SEY1 PE=3 SV=1 492 1089 0.0E+00
sp|C0S6S4|SEY1_PARBP Protein SEY1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=SEY1 PE=3 SV=1 492 1089 0.0E+00
sp|B6GX67|SEY1_PENRW Protein sey1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sey1 PE=3 SV=1 522 1102 0.0E+00
sp|C1GWM2|SEY1_PARBA Protein SEY1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=SEY1 PE=3 SV=2 492 1089 0.0E+00
sp|Q2UNK6|SEY1_ASPOR Protein sey1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sey1 PE=3 SV=2 492 1101 0.0E+00
sp|B8NJL4|SEY1_ASPFN Protein sey1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sey1 PE=3 SV=1 492 1101 0.0E+00
sp|C4JQN4|SEY1_UNCRE Protein SEY1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=SEY1 PE=3 SV=1 492 1067 0.0E+00
sp|Q0D0W7|SEY1_ASPTN Protein sey1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sey1 PE=3 SV=1 492 1101 0.0E+00
sp|C0NJ57|SEY1_AJECG Protein SEY1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=SEY1 PE=3 SV=1 492 1098 0.0E+00
sp|A6R1D5|SEY1_AJECN Protein SEY1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SEY1 PE=3 SV=1 492 1098 0.0E+00
sp|Q5BEE5|SEY1_EMENI Protein sey1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sey1 PE=3 SV=1 492 1104 0.0E+00
sp|Q8TGG5|SEY1_ASPFU Protein sey1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sey1 PE=3 SV=1 492 1101 0.0E+00
sp|B0XQZ0|SEY1_ASPFC Protein sey1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sey1 PE=3 SV=1 492 1101 0.0E+00
sp|A1D2K1|SEY1_NEOFI Protein sey1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sey1 PE=3 SV=1 492 1101 0.0E+00
sp|B6QIM3|SEY1_TALMQ Protein sey1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sey1 PE=3 SV=2 492 1102 0.0E+00
sp|Q1DL22|SEY1_COCIM Protein SEY1 OS=Coccidioides immitis (strain RS) GN=SEY1 PE=3 SV=1 495 1076 0.0E+00
sp|B8MK20|SEY1_TALSN Protein sey1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sey1 PE=3 SV=1 492 1102 0.0E+00
sp|A2QR20|SEY1_ASPNC Protein sey1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sey1 PE=3 SV=1 492 1102 0.0E+00
sp|A1CPP3|SEY1_ASPCL Protein sey1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sey1 PE=3 SV=2 522 1104 0.0E+00
sp|Q4PEQ0|SEY1_USTMA Protein SEY1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SEY1 PE=3 SV=2 492 1055 1.0E-107
sp|A8N5E5|SEY1_COPC7 Protein SEY1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=SEY1 PE=3 SV=1 493 1068 1.0E-103
sp|P0CQ46|SEY1_CRYNJ Protein SEY1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SEY1 PE=3 SV=1 493 1077 2.0E-97
sp|P0CQ47|SEY1_CRYNB Protein SEY1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SEY1 PE=3 SV=1 493 1077 2.0E-97
sp|B0D0N9|SEY1_LACBS Protein SEY1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=SEY1 PE=3 SV=1 495 1077 9.0E-96
sp|A8QAN4|SEY1_MALGO Protein SEY1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=SEY1 PE=3 SV=1 522 1058 4.0E-88
sp|Q6BK59|SEY1_DEBHA Protein SEY1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEY1 PE=3 SV=2 492 1089 2.0E-69
sp|C4Y2Z9|SEY1_CLAL4 Protein SEY1 OS=Clavispora lusitaniae (strain ATCC 42720) GN=SEY1 PE=3 SV=1 513 1086 7.0E-69
sp|B6K0N7|SEY1_SCHJY Protein sey1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=sey1 PE=3 SV=1 525 1081 7.0E-65
sp|Q6C3B0|SEY1_YARLI Protein SEY1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEY1 PE=3 SV=1 490 1086 1.0E-64
sp|A5DB26|SEY1_PICGU Protein SEY1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SEY1 PE=3 SV=3 492 1058 2.0E-64
sp|Q9UTE0|SEY1_SCHPO Protein sey1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sey1 PE=1 SV=1 525 1050 9.0E-64
sp|C5DEL5|SEY1_LACTC Protein SEY1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=SEY1 PE=3 SV=1 492 1055 2.0E-61
sp|A3LWM9|SEY1_PICST Protein SEY1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SEY1 PE=3 SV=2 487 1074 4.0E-61
sp|C4YS65|SEY1_CANAW Protein SEY1 OS=Candida albicans (strain WO-1) GN=SEY1 PE=3 SV=1 525 1066 4.0E-61
sp|Q9C0L9|SEY1_CANAL Protein SEY1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEY1 PE=1 SV=2 525 1066 5.0E-61
sp|B9WJF2|SEY1_CANDC Protein SEY1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=SEY1 PE=3 SV=1 525 1066 2.0E-58
sp|C4R432|SEY1_PICPG Protein SEY1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=SEY1 PE=3 SV=1 490 1060 1.0E-57
sp|Q74ZD5|SEY1_ASHGO Protein SEY1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEY1 PE=3 SV=1 490 1072 9.0E-57
sp|Q6FLC5|SEY1_CANGA Protein SEY1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEY1 PE=3 SV=1 490 1058 8.0E-53
sp|C5MCD3|SEY1_CANTT Protein SEY1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=SEY1 PE=3 SV=2 517 1060 7.0E-52
sp|B5VS52|SEY1_YEAS6 Protein SEY1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SEY1 PE=3 SV=1 490 1068 2.0E-50
sp|Q99287|SEY1_YEAST Protein SEY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEY1 PE=1 SV=1 490 1068 2.0E-50
sp|B3LJJ8|SEY1_YEAS1 Protein SEY1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SEY1 PE=3 SV=1 490 1068 5.0E-50
sp|Q6CJ97|SEY1_KLULA Protein SEY1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEY1 PE=3 SV=1 492 1071 6.0E-50
sp|A6ZP10|SEY1_YEAS7 Protein SEY1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SEY1 PE=3 SV=1 490 1068 2.0E-49
sp|A7TJY3|SEY1_VANPO Protein SEY1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SEY1 PE=3 SV=1 490 1077 1.0E-47
sp|A5E240|SEY1_LODEL Protein SEY1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SEY1 PE=3 SV=1 509 1060 3.0E-47
sp|C5DTA7|SEY1_ZYGRC Protein SEY1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=SEY1 PE=3 SV=1 526 1068 8.0E-46
sp|C4M6U3|SEY12_ENTHI Protein SEY1 homolog 2 OS=Entamoeba histolytica GN=EHI_054180 PE=3 SV=1 526 1055 5.0E-37
sp|Q54W90|SEY1_DICDI Protein SEY1 homolog OS=Dictyostelium discoideum GN=DDB_0206311 PE=3 SV=1 493 1056 2.0E-32
sp|B0EKR0|SEY12_ENTDS Protein SEY1 homolog 2 OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760) GN=EDI_026070 PE=3 SV=1 526 1055 1.0E-30
sp|A2FJ32|SEY13_TRIVA Protein SEY1 homolog 3 OS=Trichomonas vaginalis GN=TVAG_204380 PE=3 SV=1 492 1083 3.0E-20
sp|Q9FKE9|RHD32_ARATH Protein ROOT HAIR DEFECTIVE 3 homolog 2 OS=Arabidopsis thaliana GN=At5g45160 PE=2 SV=1 506 1030 2.0E-19
sp|Q2QMH2|RHD31_ORYSJ Protein ROOT HAIR DEFECTIVE 3 homolog 1 OS=Oryza sativa subsp. japonica GN=Os12g0604600 PE=2 SV=1 491 1031 5.0E-19
sp|A2EI35|SEY11_TRIVA Protein SEY1 homolog 1 OS=Trichomonas vaginalis GN=TVAG_273580 PE=3 SV=1 496 1073 1.0E-17
sp|A7AT07|SEY1_BABBO Protein SEY1 homolog OS=Babesia bovis GN=BBOV_II001090 PE=3 SV=1 490 1032 6.0E-17
sp|Q2R224|RHD32_ORYSJ Protein ROOT HAIR DEFECTIVE 3 homolog 2 OS=Oryza sativa subsp. japonica GN=Os11g0582300 PE=2 SV=1 534 1027 1.0E-16
sp|A2EK80|SEY12_TRIVA Protein SEY1 homolog 2 OS=Trichomonas vaginalis GN=TVAG_100140 PE=3 SV=1 495 1033 2.0E-16
sp|Q0JLS6|RHD3_ORYSJ Protein ROOT HAIR DEFECTIVE 3 OS=Oryza sativa subsp. japonica GN=RHD3 PE=2 SV=1 534 1031 2.0E-16
sp|B0E843|SEY11_ENTDS Protein SEY1 homolog 1 OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760) GN=EDI_213660 PE=3 SV=1 518 1010 4.0E-15
sp|Q4U9I8|SEY1_THEAN Protein SEY1 homolog OS=Theileria annulata GN=TA08650 PE=3 SV=1 487 1034 1.0E-14
sp|Q9UTK6|YKR3_SCHPO G-patch domain-containing protein C1486.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1486.03c PE=3 SV=1 203 442 2.0E-14
sp|Q9SSN0|RHD31_ARATH Protein ROOT HAIR DEFECTIVE 3 homolog 1 OS=Arabidopsis thaliana GN=At1g72960 PE=2 SV=2 534 1029 3.0E-14
sp|P93042|RHD3_ARATH Protein ROOT HAIR DEFECTIVE 3 OS=Arabidopsis thaliana GN=RHD3 PE=1 SV=1 506 1033 4.0E-14
sp|C4LTM1|SEY11_ENTHI Protein SEY1 homolog 1 OS=Entamoeba histolytica GN=EHI_012280 PE=3 SV=1 522 660 1.0E-12
sp|Q4XZY3|SEY1_PLACH Protein SEY1 homolog OS=Plasmodium chabaudi GN=PC000321.02.0 PE=3 SV=1 530 670 2.0E-10
sp|Q4N280|SEY1_THEPA Protein SEY1 homolog OS=Theileria parva GN=TP04_0477 PE=3 SV=2 488 578 1.0E-09
sp|B3LAJ9|SEY1_PLAKH Protein SEY1 homolog OS=Plasmodium knowlesi (strain H) GN=PKH_133110 PE=3 SV=1 529 578 3.0E-09
sp|A5K168|SEY1_PLAVS Protein SEY1 homolog OS=Plasmodium vivax (strain Salvador I) GN=PVX_085645 PE=3 SV=1 529 578 4.0E-09
sp|Q8ILT5|SEY1_PLAF7 Protein SEY1 homolog OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0159 PE=3 SV=2 529 689 7.0E-08
sp|A4HK17|SEY1_LEIBR Protein SEY1 homolog OS=Leishmania braziliensis GN=LbrM32_V2.0440 PE=3 SV=2 526 652 3.0E-07
sp|A4I7K1|SEY1_LEIIN Protein SEY1 homolog OS=Leishmania infantum GN=LinJ32.0740 PE=3 SV=2 532 677 1.0E-06
sp|Q17784|TFP11_CAEEL Septin and tuftelin-interacting protein 1 homolog OS=Caenorhabditis elegans GN=stip-1 PE=1 SV=2 49 551 1.0E-06
sp|Q4DHA1|SEY1_TRYCC Protein SEY1 homolog OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053511285.50 PE=3 SV=1 532 581 2.0E-06
sp|Q66J74|TFP11_XENLA Tuftelin-interacting protein 11 OS=Xenopus laevis GN=tfip11 PE=2 SV=1 226 507 2.0E-06
sp|Q9Y103|TFP11_DROME Septin-interacting protein 1 OS=Drosophila melanogaster GN=sip1 PE=1 SV=1 226 507 3.0E-06
sp|Q4Q5P8|SEY1_LEIMA Protein SEY1 homolog OS=Leishmania major GN=LmjF32.0370 PE=3 SV=2 532 677 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

Domain # Start End Length
1 982 1004 22
2 1011 1033 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2459
MENSAQPSFDPSRLTKASAADYSSSASDDDDEYLMPGVNVDDDDFGDHNPRKRRRIGGKSKEKAALGIFGSDSDD
DRPGQRWKSKTLRRKGVDFVSTAVQEGQGQDQGEGEGEDTSDGKAGLGNGAASSDDDEDDDDAGLGLGFGNRSKA
PAWAGTADGMQHQGAPTLKSPVAAVETTFDGKSVLGRGFVPSSATEPVLKEPEADSTPPARNKPQVSAFGPKGKV
NAKSFGARMMAKMGYVNGMGLGKEGQGRNVIIEANLRPQGIGLGAVKEKTERERQEEKRQARLRGDDVVDSDEEE
KRRRKAKKKSLGIANGSASSTPRRQKTKYMTAEEVRAAAPGLHIPDAFTPILDMTGPGSKLLTSTSGVMTPNSGV
FESSEVVEARKLVRRAHADLLAFTEEWKSLEERKSWLNLELREREQEVEDVRSDFERLQAFSTLVTEQLMQASEW
DQVIACLVKAAELGSINPETADVAVAAIHPFLKAGDWDPLEEPGRFASDLKRLRGLFATPGPGSSNGDQELEGGV
FLPEYHRRIPADGLAVYAEGIWDQIVNNKDLDLPTQQELLAQFRCDEISREVLVAFDLVVAPLEEQQTEATKLGR
ALVLVDLGLTGSRAREACAGAFEAQASRYHKPTYARKKLELEAKVDARLKALYHGQLSAAHKAGVAAFSEAVANK
VKAGQKAGGAYEFAEIVAAEKKKTLDVFEAEAEALAIHGVAWTDFKPQYQLFEAELDEVSARLRKEEMRRLATRV
ERWVKSRLGDSVGLEFNKLGSGRGGSGAPETGDKPPAEKDLWDRIWAVFTGVVAEAEGRFAERAKSFDASDDETE
VGMWRLRRKSWVGLREKIDEEVMEGNILLKLRENFEDKFRYDEAGVPRIWLPTDDIEGIYTKARESTLTLIPLLS
RFRLSETYAPPDLPGFVGPQPRGVEVGDEEDLAPIGGVDEEEGKSLEEEMTVLGEGKRQDLVVRFKKTADGVYVE
AKRGAIGGVAQVPWYFYALLLALGWNEFFMVLRNPFLFILLIMMMGGTYVAYTLNLLGPMMQMGNAAVNQGLDIA
KHQLREFIANSETARQALAVPASNGTSGNDIDMDRLDSRGKRTAGTRDEEDDEI*
Coding >Hirsu2|2459
ATGGAAAACTCCGCGCAGCCATCGTTCGACCCGTCGCGTCTCACGAAAGCCTCTGCAGCAGATTACTCGTCCTCG
GCATCCGACGATGACGACGAATACCTCATGCCCGGCGTCAACGTCGACGACGATGATTTCGGCGACCATAACCCC
CGAAAGCGACGTCGCATCGGAGGCAAAAGCAAGGAAAAGGCGGCCCTGGGCATCTTCGGCTCCGACAGCGACGAT
GACCGTCCTGGCCAAAGATGGAAGAGCAAGACTCTGAGGCGCAAAGGGGTGGATTTCGTGTCGACGGCCGTACAA
GAAGGCCAAGGCCAAGACCAGGGCGAAGGCGAAGGCGAAGATACCAGTGACGGAAAGGCCGGTCTTGGCAACGGA
GCGGCTTCTTCGGATGACGATGAAGATGATGACGATGCCGGCCTGGGCCTGGGCTTTGGCAACCGATCGAAGGCA
CCAGCTTGGGCCGGCACGGCGGATGGGATGCAGCATCAAGGCGCGCCTACTCTCAAGTCACCTGTCGCCGCAGTC
GAGACAACGTTTGATGGAAAAAGTGTCCTCGGCCGCGGCTTTGTGCCTTCATCGGCCACGGAGCCAGTGTTGAAA
GAGCCAGAGGCCGACAGTACGCCGCCTGCCCGCAACAAGCCTCAGGTCAGCGCGTTCGGCCCCAAGGGCAAGGTC
AACGCCAAGTCGTTTGGTGCCCGGATGATGGCAAAGATGGGCTACGTCAACGGCATGGGCCTCGGCAAGGAAGGC
CAGGGCCGAAATGTCATCATCGAAGCCAACCTGCGGCCCCAAGGAATCGGTTTGGGTGCGGTCAAGGAAAAGACG
GAGCGGGAACGACAGGAAGAAAAGAGACAGGCGCGGTTGCGTGGCGATGACGTCGTGGATTCCGACGAGGAGGAG
AAACGGCGGCGGAAAGCCAAGAAGAAGTCGTTGGGCATCGCCAACGGCAGCGCCAGCAGCACGCCGCGGAGGCAG
AAGACGAAATACATGACGGCAGAAGAGGTCCGGGCCGCGGCACCGGGACTGCACATCCCGGACGCCTTCACGCCC
ATCTTGGACATGACGGGCCCGGGTAGCAAGCTTCTCACCTCGACAAGTGGCGTGATGACGCCCAACTCTGGCGTT
TTCGAGTCGAGCGAGGTCGTCGAAGCCAGGAAGTTGGTGAGACGGGCCCACGCAGACCTGTTGGCCTTCACGGAG
GAGTGGAAGAGTCTGGAGGAGCGAAAGTCGTGGCTCAACCTGGAGCTGCGAGAGAGGGAGCAGGAGGTGGAGGAC
GTCCGGTCCGACTTTGAGCGGCTGCAAGCATTCTCGACGCTGGTCACAGAGCAGCTGATGCAGGCCTCGGAATGG
GACCAGGTCATTGCCTGCCTCGTCAAGGCGGCCGAGCTCGGCTCCATCAATCCGGAGACGGCCGACGTCGCCGTC
GCAGCCATCCACCCATTTTTGAAGGCGGGCGACTGGGACCCGCTGGAAGAACCCGGCCGGTTTGCTTCCGATCTG
AAGCGGCTGCGCGGTCTGTTTGCCACGCCGGGCCCGGGCAGCAGCAACGGCGACCAGGAGCTCGAGGGGGGCGTC
TTCCTGCCCGAGTATCATCGGCGGATCCCCGCCGACGGGCTCGCCGTCTACGCCGAGGGCATCTGGGACCAGATC
GTCAACAACAAGGATCTCGACCTGCCCACCCAGCAGGAGCTCCTGGCCCAGTTCCGATGCGACGAGATCTCGCGC
GAGGTCCTCGTCGCCTTCGACCTCGTCGTCGCGCCCCTCGAGGAGCAGCAGACCGAGGCGACGAAGCTGGGCAGG
GCCCTGGTCCTCGTCGACCTCGGCCTCACCGGCAGCCGCGCGCGCGAGGCCTGCGCCGGCGCCTTCGAGGCCCAG
GCCAGCCGCTACCACAAGCCGACCTACGCGCGCAAGAAGCTGGAGCTCGAGGCCAAGGTCGACGCCAGGCTCAAG
GCCCTCTACCACGGGCAGCTGTCCGCCGCCCACAAGGCCGGCGTCGCCGCCTTCAGCGAGGCCGTCGCCAACAAG
GTAAAGGCCGGCCAGAAGGCAGGCGGCGCCTACGAGTTCGCCGAGATCGTGGCCGCCGAGAAGAAGAAGACGCTC
GACGTGTTCGAGGCCGAGGCCGAGGCCCTGGCCATCCACGGCGTCGCCTGGACCGACTTCAAGCCGCAGTACCAG
CTGTTCGAGGCCGAGCTGGACGAGGTCAGCGCGAGGCTGCGCAAGGAGGAGATGCGACGGCTCGCGACGCGCGTC
GAGCGCTGGGTCAAGTCGCGACTCGGCGACTCCGTCGGCCTCGAGTTCAACAAGCTGGGCTCCGGCCGGGGCGGC
TCCGGCGCTCCCGAGACGGGCGACAAGCCGCCGGCGGAGAAGGACCTCTGGGACAGGATCTGGGCCGTCTTCACC
GGCGTCGTCGCCGAGGCCGAGGGCCGGTTCGCCGAGCGCGCGAAGAGCTTCGACGCCAGCGACGACGAGACCGAG
GTCGGCATGTGGCGTCTGCGCCGCAAGAGCTGGGTCGGCCTCCGCGAGAAGATTGACGAGGAGGTCATGGAGGGC
AACATCCTCCTGAAGCTTCGCGAGAACTTTGAGGATAAGTTCCGATACGACGAGGCGGGCGTGCCGCGGATATGG
CTCCCGACCGACGACATTGAGGGCATCTACACCAAGGCCAGGGAGTCGACGCTGACGCTCATCCCGCTGCTCTCG
AGATTTCGCCTCTCCGAGACGTACGCGCCGCCCGACCTGCCCGGCTTCGTCGGGCCCCAGCCCCGCGGCGTCGAG
GTCGGCGACGAGGAGGACCTGGCCCCCATCGGCGGCGTCGACGAGGAAGAGGGCAAGAGCCTGGAGGAGGAGATG
ACGGTCCTCGGCGAGGGCAAGCGGCAAGACCTGGTGGTGCGGTTCAAGAAGACGGCCGACGGCGTCTACGTCGAG
GCCAAGCGCGGCGCCATCGGCGGCGTCGCGCAAGTTCCGTGGTACTTTTACGCGCTGCTCCTCGCGCTGGGGTGG
AACGAATTCTTCATGGTCCTGCGAAATCCCTTCTTGTTCATCCTGCTCATCATGATGATGGGCGGGACGTACGTG
GCTTACACGCTCAACCTGCTGGGCCCCATGATGCAGATGGGCAATGCGGCCGTCAACCAGGGGCTCGACATCGCC
AAGCACCAGCTCCGCGAGTTCATCGCCAACTCGGAGACGGCGAGACAGGCGCTGGCCGTGCCGGCGTCCAACGGG
ACGAGCGGAAACGACATTGACATGGATCGACTCGACAGCCGGGGGAAGAGGACGGCCGGGACCCGAGACGAGGAG
GATGACGAGATCTGA
Transcript >Hirsu2|2459
ATGGAAAACTCCGCGCAGCCATCGTTCGACCCGTCGCGTCTCACGAAAGCCTCTGCAGCAGATTACTCGTCCTCG
GCATCCGACGATGACGACGAATACCTCATGCCCGGCGTCAACGTCGACGACGATGATTTCGGCGACCATAACCCC
CGAAAGCGACGTCGCATCGGAGGCAAAAGCAAGGAAAAGGCGGCCCTGGGCATCTTCGGCTCCGACAGCGACGAT
GACCGTCCTGGCCAAAGATGGAAGAGCAAGACTCTGAGGCGCAAAGGGGTGGATTTCGTGTCGACGGCCGTACAA
GAAGGCCAAGGCCAAGACCAGGGCGAAGGCGAAGGCGAAGATACCAGTGACGGAAAGGCCGGTCTTGGCAACGGA
GCGGCTTCTTCGGATGACGATGAAGATGATGACGATGCCGGCCTGGGCCTGGGCTTTGGCAACCGATCGAAGGCA
CCAGCTTGGGCCGGCACGGCGGATGGGATGCAGCATCAAGGCGCGCCTACTCTCAAGTCACCTGTCGCCGCAGTC
GAGACAACGTTTGATGGAAAAAGTGTCCTCGGCCGCGGCTTTGTGCCTTCATCGGCCACGGAGCCAGTGTTGAAA
GAGCCAGAGGCCGACAGTACGCCGCCTGCCCGCAACAAGCCTCAGGTCAGCGCGTTCGGCCCCAAGGGCAAGGTC
AACGCCAAGTCGTTTGGTGCCCGGATGATGGCAAAGATGGGCTACGTCAACGGCATGGGCCTCGGCAAGGAAGGC
CAGGGCCGAAATGTCATCATCGAAGCCAACCTGCGGCCCCAAGGAATCGGTTTGGGTGCGGTCAAGGAAAAGACG
GAGCGGGAACGACAGGAAGAAAAGAGACAGGCGCGGTTGCGTGGCGATGACGTCGTGGATTCCGACGAGGAGGAG
AAACGGCGGCGGAAAGCCAAGAAGAAGTCGTTGGGCATCGCCAACGGCAGCGCCAGCAGCACGCCGCGGAGGCAG
AAGACGAAATACATGACGGCAGAAGAGGTCCGGGCCGCGGCACCGGGACTGCACATCCCGGACGCCTTCACGCCC
ATCTTGGACATGACGGGCCCGGGTAGCAAGCTTCTCACCTCGACAAGTGGCGTGATGACGCCCAACTCTGGCGTT
TTCGAGTCGAGCGAGGTCGTCGAAGCCAGGAAGTTGGTGAGACGGGCCCACGCAGACCTGTTGGCCTTCACGGAG
GAGTGGAAGAGTCTGGAGGAGCGAAAGTCGTGGCTCAACCTGGAGCTGCGAGAGAGGGAGCAGGAGGTGGAGGAC
GTCCGGTCCGACTTTGAGCGGCTGCAAGCATTCTCGACGCTGGTCACAGAGCAGCTGATGCAGGCCTCGGAATGG
GACCAGGTCATTGCCTGCCTCGTCAAGGCGGCCGAGCTCGGCTCCATCAATCCGGAGACGGCCGACGTCGCCGTC
GCAGCCATCCACCCATTTTTGAAGGCGGGCGACTGGGACCCGCTGGAAGAACCCGGCCGGTTTGCTTCCGATCTG
AAGCGGCTGCGCGGTCTGTTTGCCACGCCGGGCCCGGGCAGCAGCAACGGCGACCAGGAGCTCGAGGGGGGCGTC
TTCCTGCCCGAGTATCATCGGCGGATCCCCGCCGACGGGCTCGCCGTCTACGCCGAGGGCATCTGGGACCAGATC
GTCAACAACAAGGATCTCGACCTGCCCACCCAGCAGGAGCTCCTGGCCCAGTTCCGATGCGACGAGATCTCGCGC
GAGGTCCTCGTCGCCTTCGACCTCGTCGTCGCGCCCCTCGAGGAGCAGCAGACCGAGGCGACGAAGCTGGGCAGG
GCCCTGGTCCTCGTCGACCTCGGCCTCACCGGCAGCCGCGCGCGCGAGGCCTGCGCCGGCGCCTTCGAGGCCCAG
GCCAGCCGCTACCACAAGCCGACCTACGCGCGCAAGAAGCTGGAGCTCGAGGCCAAGGTCGACGCCAGGCTCAAG
GCCCTCTACCACGGGCAGCTGTCCGCCGCCCACAAGGCCGGCGTCGCCGCCTTCAGCGAGGCCGTCGCCAACAAG
GTAAAGGCCGGCCAGAAGGCAGGCGGCGCCTACGAGTTCGCCGAGATCGTGGCCGCCGAGAAGAAGAAGACGCTC
GACGTGTTCGAGGCCGAGGCCGAGGCCCTGGCCATCCACGGCGTCGCCTGGACCGACTTCAAGCCGCAGTACCAG
CTGTTCGAGGCCGAGCTGGACGAGGTCAGCGCGAGGCTGCGCAAGGAGGAGATGCGACGGCTCGCGACGCGCGTC
GAGCGCTGGGTCAAGTCGCGACTCGGCGACTCCGTCGGCCTCGAGTTCAACAAGCTGGGCTCCGGCCGGGGCGGC
TCCGGCGCTCCCGAGACGGGCGACAAGCCGCCGGCGGAGAAGGACCTCTGGGACAGGATCTGGGCCGTCTTCACC
GGCGTCGTCGCCGAGGCCGAGGGCCGGTTCGCCGAGCGCGCGAAGAGCTTCGACGCCAGCGACGACGAGACCGAG
GTCGGCATGTGGCGTCTGCGCCGCAAGAGCTGGGTCGGCCTCCGCGAGAAGATTGACGAGGAGGTCATGGAGGGC
AACATCCTCCTGAAGCTTCGCGAGAACTTTGAGGATAAGTTCCGATACGACGAGGCGGGCGTGCCGCGGATATGG
CTCCCGACCGACGACATTGAGGGCATCTACACCAAGGCCAGGGAGTCGACGCTGACGCTCATCCCGCTGCTCTCG
AGATTTCGCCTCTCCGAGACGTACGCGCCGCCCGACCTGCCCGGCTTCGTCGGGCCCCAGCCCCGCGGCGTCGAG
GTCGGCGACGAGGAGGACCTGGCCCCCATCGGCGGCGTCGACGAGGAAGAGGGCAAGAGCCTGGAGGAGGAGATG
ACGGTCCTCGGCGAGGGCAAGCGGCAAGACCTGGTGGTGCGGTTCAAGAAGACGGCCGACGGCGTCTACGTCGAG
GCCAAGCGCGGCGCCATCGGCGGCGTCGCGCAAGTTCCGTGGTACTTTTACGCGCTGCTCCTCGCGCTGGGGTGG
AACGAATTCTTCATGGTCCTGCGAAATCCCTTCTTGTTCATCCTGCTCATCATGATGATGGGCGGGACGTACGTG
GCTTACACGCTCAACCTGCTGGGCCCCATGATGCAGATGGGCAATGCGGCCGTCAACCAGGGGCTCGACATCGCC
AAGCACCAGCTCCGCGAGTTCATCGCCAACTCGGAGACGGCGAGACAGGCGCTGGCCGTGCCGGCGTCCAACGGG
ACGAGCGGAAACGACATTGACATGGATCGACTCGACAGCCGGGGGAAGAGGACGGCCGGGACCCGAGACGAGGAG
GATGACGAGATCTGA
Gene >Hirsu2|2459
ATGGAAAACTCCGCGCAGCCATCGTTCGACCCGTCGCGTCTCACGAAAGCCTCTGCAGCAGATTACTCGTCCTCG
GCATCCGACGATGACGACGAATACCTCATGCCCGGCGTCAACGTCGACGACGATGATTTCGGCGACCATAACCCC
CGAAAGCGACGTCGCATCGGAGGCAAAAGCAAGGAAAAGGCGGCCCTGGGCATCTTCGGCTCCGACAGCGACGAT
GACCGTCCTGGCCAAAGATGGAAGAGCAAGACTCTGAGGCGCAAAGGGGTGGATTTCGTGTCGACGGCCGTACAA
GAAGGCCAAGGCCAAGACCAGGGCGAAGGCGAAGGCGAAGATACCAGTGACGGAAAGGCCGGTCTTGGCAACGGA
GCGGCTTCTTCGGATGACGATGAAGATGATGACGATGCCGGCCTGGGCCTGGGCTTTGGCAACCGATCGAAGGCA
CCAGCTTGGGCCGGCACGGCGGATGGGATGCAGCATCAAGGCGCGCCTACTCTCAAGTCACCTGTCGCCGCAGTC
GAGACAACGTTTGATGGAAAAAGTGTCCTCGGCCGCGGCTTTGTGCCTTCATCGGCCACGGAGCCAGTGTTGAAA
GAGCCAGAGGCCGACAGTACGCCGCCTGCCCGCAACAAGCCTCAGGTCAGCGCGTTCGGCCCCAAGGGCAAGGTC
AACGCCAAGTCGTTTGGTGCCCGGATGATGGCAAAGATGGGCTACGTCAACGGCATGGGCCTCGGCAAGGAAGGC
CAGGGCCGAAATGTCATCATCGAAGCCAACCTGCGGCCCCAAGGAATCGGTTTGGGTGCGGTCAAGGAAAAGACG
GAGCGGGAACGACAGGAAGAAAAGAGACAGGCGCGGTTGCGTGGCGATGACGTCGTGGATTCCGACGAGGAGGAG
AAACGGCGGCGGAAAGCCAAGAAGAAGTCGTTGGGCATCGCCAACGGCAGCGCCAGCAGCACGCCGCGGAGGCAG
AAGACGAAATACATGACGGCAGAAGAGGTCCGGGCCGCGGCACCGGGACTGCACATCCCGGACGCCTTCACGCCC
ATCTTGGACATGACGGGCCCGGGTAGCAAGCTTCTCACCTCGACAAGTGGCGTGATGACGCCCAACTCTGGCGTT
TTCGAGTCGAGCGAGGTCGTCGAAGCCAGGAAGTTGGTGAGACGGGCCCACGCAGACCTGTTGGCCTTCACGGAG
GAGTGGAAGAGTCTGGAGGAGCGAAAGTCGTGGCTCAACCTGGAGCTGCGAGAGAGGGAGCAGGAGGTGGAGGAC
GTCCGGTCCGACTTTGAGCGGCTGCAAGCATTCTCGACGCTGGTCACAGAGCAGCTGATGCAGGCCTCGGAATGG
GACCAGGTCATTGCCTGCCTCGTCAAGGCGGCCGAGCTCGGCTCCATCAATCCGGAGACGGCCGACGTCGCCGTC
GCAGCCATCCACCCATTTTTGAAGGCGGGCGACTGGGACCCGCTGGAAGAACCCGGCCGGTTTGCTTCCGATCTG
AAGCGGCTGCGCGGTCTGTTTGCCACGCCGGGCCCGGGCAGCAGCAACGGCGACCAGGAGCTCGAGGGGGGCGTC
TTCCTGCCCGAGTATCATCGGCGGATCCCCGCCGACGGGCTCGCCGTCTACGCCGAGGGCATCTGGGACCAGATC
GTCAACAACAAGGATCTCGACCTGCCCACCCAGCAGGAGCTCCTGGCCCAGTTCCGATGCGACGAGATCTCGCGC
GAGGTCCTCGTCGCCTTCGACCTCGTCGTCGCGCCCCTCGAGGAGCAGCAGACCGAGGCGACGAAGCTGGGCAGG
GCCCTGGTCCTCGTCGACCTCGGCCTCACCGGCAGCCGCGCGCGCGAGGCCTGCGCCGGCGCCTTCGAGGCCCAG
GCCAGCCGCTACCACAAGCCGACCTACGCGCGCAAGAAGCTGGAGCTCGAGGCCAAGGTCGACGCCAGGCTCAAG
GCCCTCTACCACGGGCAGCTGTCCGCCGCCCACAAGGCCGGCGTCGCCGCCTTCAGCGAGGCCGTCGCCAACAAG
GTAAAGGCCGGCCAGAAGGCAGGCGGCGCCTACGAGTTCGCCGAGATCGTGGCCGCCGAGAAGAAGAAGACGCTC
GACGTGTTCGAGGCCGAGGCCGAGGCCCTGGCCATCCACGGCGTCGCCTGGACCGACTTCAAGCCGCAGTACCAG
CTGTTCGAGGCCGAGCTGGACGAGGTCAGCGCGAGGCTGCGCAAGGAGGAGATGCGACGGCTCGCGACGCGCGTC
GAGCGCTGGGTCAAGTCGCGACTCGGCGACTCCGTCGGCCTCGAGTTCAACAAGCTGGGCTCCGGCCGGGGCGGC
TCCGGCGCTCCCGAGACGGGCGACAAGCCGCCGGCGGAGAAGGACCTCTGGGACAGGATCTGGGCCGTCTTCACC
GGCGTCGTCGCCGAGGCCGAGGGCCGGTTCGCCGAGCGCGCGAAGAGCTTCGACGCCAGCGACGACGAGACCGAG
GTCGGCATGTGGCGTCTGCGCCGCAAGAGCTGGGTCGGCCTCCGCGAGAAGATTGACGAGGAGGTCATGGAGGGC
AACATCCTCCTGAAGCTTCGCGAGAACTTTGAGGATAAGTTCCGATACGACGAGGCGGGCGTGCCGCGGATATGG
CTCCCGACCGACGACATTGAGGGCATCTACACCAAGGCCAGGGAGTCGACGCTGACGCTCATCCCGCTGCTCTCG
AGATTTCGCCTCTCCGAGACGTACGCGCCGCCCGACCTGCCCGGCTTCGTCGGGCCCCAGCCCCGCGGCGTCGAG
GTCGGCGACGAGGAGGACCTGGCCCCCATCGGCGGCGTCGACGAGGAAGAGGGCAAGAGCCTGGAGGAGGAGATG
ACGGTCCTCGGCGAGGGCAAGCGGCAAGACCTGGTGGTGCGGTTCAAGAAGACGGCCGACGGCGTCTACGTCGAG
GCCAAGCGCGGCGCCATCGGCGGCGTCGCGCAAGTTCCGTGGTACTTTTACGCGCTGCTCCTCGCGCTGGGGTGG
AACGAATTCTTCATGGGTAAGGATGAGCGCCCCCCCCCTCCCCTGGCCCTCTCGACGCACTGCTGACGCACCATC
GCCACCAGTCCTGCGAAATCCCTTCTTGTTCATCCTGCTCATCATGATGATGGGCGGGACGTACGTGGCTTACAC
GCTCAACCTGCTGGGCCCCATGATGCAGATGGGCAATGCGGCCGTCAACCAGGGGCTCGACATCGCCAAGCACCA
GCTCCGCGAGTTCATCGCCAACTCGGAGACGGCGAGACAGGCGCTGGCCGTGCCGGCGTCCAACGGGACGAGCGG
AAACGACATTGACATGGATCGACTCGACAGCCGGGGGAAGAGGACGGCCGGGACCCGAGACGAGGAGGATGACGA
GATCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail