Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2454
Gene name
LocationContig_1589:52..3488
Strand+
Gene length (bp)3436
Transcript length (bp)3150
Coding sequence length (bp)3150
Protein length (aa) 1050

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13832 zf-HC5HC2H_2 PHD-zinc-finger like domain 3.5E-33 310 426
PF10513 EPL1 Enhancer of polycomb-like 8.9E-27 41 214
PF13771 zf-HC5HC2H PHD-like zinc-binding domain 6.5E-26 331 426
PF13831 PHD_2 PHD-finger 9.9E-15 268 301
PF00628 PHD PHD-finger 6.7E-08 257 303

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P55201|BRPF1_HUMAN Peregrin OS=Homo sapiens GN=BRPF1 PE=1 SV=2 172 662 1.0E-83
sp|O74759|NTO1_SCHPO Mst2 complex subunit nto1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nto1 PE=1 SV=1 172 664 1.0E-82
sp|Q12311|NTO1_YEAST NuA3 HAT complex component NTO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTO1 PE=1 SV=1 173 621 3.0E-82
sp|Q9ULD4|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2 141 683 2.0E-77
sp|O95696|BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens GN=BRD1 PE=1 SV=1 172 656 3.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P55201|BRPF1_HUMAN Peregrin OS=Homo sapiens GN=BRPF1 PE=1 SV=2 172 662 1.0E-83
sp|O74759|NTO1_SCHPO Mst2 complex subunit nto1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nto1 PE=1 SV=1 172 664 1.0E-82
sp|Q12311|NTO1_YEAST NuA3 HAT complex component NTO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTO1 PE=1 SV=1 173 621 3.0E-82
sp|Q9ULD4|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2 141 683 2.0E-77
sp|O95696|BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens GN=BRD1 PE=1 SV=1 172 656 3.0E-76
sp|Q20318|LIN49_CAEEL Protein lin-49 OS=Caenorhabditis elegans GN=lin-49 PE=1 SV=1 172 453 1.0E-53
sp|Q7YZH1|RNO_DROME PHD finger protein rhinoceros OS=Drosophila melanogaster GN=rno PE=1 SV=1 174 436 1.0E-50
sp|Q803A0|JADE1_DANRE Protein Jade-1 OS=Danio rerio GN=jade1 PE=2 SV=1 170 436 6.0E-49
sp|Q9NQC1|JADE2_HUMAN Protein Jade-2 OS=Homo sapiens GN=JADE2 PE=1 SV=2 170 692 5.0E-48
sp|Q6GQJ2|JADE1_XENLA Protein Jade-1 OS=Xenopus laevis GN=jade1 PE=2 SV=1 174 426 2.0E-47
sp|Q6IE82|JADE3_MOUSE Protein Jade-3 OS=Mus musculus GN=Jade3 PE=1 SV=1 174 426 1.0E-46
sp|Q7ZVP1|JADE3_DANRE Protein Jade-3 OS=Danio rerio GN=jade3 PE=2 SV=1 174 426 1.0E-46
sp|Q5E9T7|JADE1_BOVIN Protein Jade-1 OS=Bos taurus GN=JADE1 PE=2 SV=1 125 426 3.0E-46
sp|Q6ZPI0|JADE1_MOUSE Protein Jade-1 OS=Mus musculus GN=Jade1 PE=1 SV=2 125 426 3.0E-46
sp|Q6IE81|JADE1_HUMAN Protein Jade-1 OS=Homo sapiens GN=JADE1 PE=1 SV=1 125 426 4.0E-46
sp|Q6ZQF7|JADE2_MOUSE Protein Jade-2 OS=Mus musculus GN=Jade2 PE=1 SV=2 170 633 4.0E-46
sp|Q92613|JADE3_HUMAN Protein Jade-3 OS=Homo sapiens GN=JADE3 PE=1 SV=1 174 426 5.0E-45
sp|Q0P4S5|JADE3_XENTR Protein Jade-3 OS=Xenopus tropicalis GN=jade3 PE=2 SV=1 254 432 7.0E-45
sp|Q29EQ3|RNO_DROPS PHD finger protein rhinoceros OS=Drosophila pseudoobscura pseudoobscura GN=rno PE=3 SV=2 174 380 4.0E-42
sp|P55197|AF10_HUMAN Protein AF-10 OS=Homo sapiens GN=MLLT10 PE=1 SV=2 257 400 2.0E-36
sp|O54826|AF10_MOUSE Protein AF-10 OS=Mus musculus GN=Mllt10 PE=1 SV=2 257 400 2.0E-36
sp|P55198|AF17_HUMAN Protein AF-17 OS=Homo sapiens GN=MLLT6 PE=1 SV=2 257 400 7.0E-35
sp|P34447|YM2A_CAEEL Uncharacterized protein F54F2.2, isoform a OS=Caenorhabditis elegans GN=F54F2.2/F54F2.3/F54F2.4 PE=3 SV=2 257 426 2.0E-33
sp|Q9C5X4|ATX1_ARATH Histone-lysine N-methyltransferase ATX1 OS=Arabidopsis thaliana GN=ATX1 PE=1 SV=2 256 447 3.0E-31
sp|P0CB22|ATX2_ARATH Histone-lysine N-methyltransferase ATX2 OS=Arabidopsis thaliana GN=ATX2 PE=2 SV=1 256 426 1.0E-30
sp|Q91VY5|KDM4B_MOUSE Lysine-specific demethylase 4B OS=Mus musculus GN=Kdm4b PE=2 SV=1 266 489 9.0E-24
sp|Q9D4H9|PHF14_MOUSE PHD finger protein 14 OS=Mus musculus GN=Phf14 PE=1 SV=1 257 455 6.0E-23
sp|O94880|PHF14_HUMAN PHD finger protein 14 OS=Homo sapiens GN=PHF14 PE=1 SV=2 257 455 6.0E-23
sp|O94953|KDM4B_HUMAN Lysine-specific demethylase 4B OS=Homo sapiens GN=KDM4B PE=1 SV=4 261 489 5.0E-22
sp|Q8VCD7|KDM4C_MOUSE Lysine-specific demethylase 4C OS=Mus musculus GN=Kdm4c PE=1 SV=1 266 402 2.0E-20
sp|Q8BW72|KDM4A_MOUSE Lysine-specific demethylase 4A OS=Mus musculus GN=Kdm4a PE=1 SV=3 266 503 2.0E-20
sp|Q9H3R0|KDM4C_HUMAN Lysine-specific demethylase 4C OS=Homo sapiens GN=KDM4C PE=1 SV=2 266 402 2.0E-20
sp|Q5RD88|KDM4A_PONAB Lysine-specific demethylase 4A OS=Pongo abelii GN=KDM4A PE=2 SV=1 266 503 3.0E-20
sp|O75164|KDM4A_HUMAN Lysine-specific demethylase 4A OS=Homo sapiens GN=KDM4A PE=1 SV=2 266 503 3.0E-20
sp|Q9SUE7|ATX4_ARATH Histone-lysine N-methyltransferase ATX4 OS=Arabidopsis thaliana GN=ATX4 PE=2 SV=3 256 397 1.0E-19
sp|Q9M364|ATX3_ARATH Histone-lysine N-methyltransferase ATX3 OS=Arabidopsis thaliana GN=ATX3 PE=2 SV=2 256 397 1.0E-19
sp|Q8GZ42|ATX5_ARATH Histone-lysine N-methyltransferase ATX5 OS=Arabidopsis thaliana GN=ATX5 PE=2 SV=1 256 397 3.0E-19
sp|P53127|SNT2_YEAST E3 ubiquitin-protein ligase SNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNT2 PE=1 SV=1 257 403 1.0E-11
sp|Q10077|SNT2_SCHPO Lid2 complex component snt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snt2 PE=3 SV=1 246 422 6.0E-08
sp|Q8BRH4|KMT2C_MOUSE Histone-lysine N-methyltransferase 2C OS=Mus musculus GN=Kmt2c PE=1 SV=2 298 405 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2454
MTPSRQLNPASTGNTPNPQDRNEANAPDAPNGGGGSGGNNNNNNGTPSRARPRRQPRDVVSFYGTRPADPAATPK
TPKILPIQNQTPKERLDLKLPSYRKTNRIELFESKTFGQARYVDKSMSNVGYQESDHFLRPDSTLIKAVDGNAED
EADAPPAAKVEDQPIHYRLGRVEYDMDEQDDMWLEHYNGQRKQNELEAITREVFEITMTKIEKEWHALEKRIPKP
NPKPPQTHRPRSSSAAAVNGETQAAEEPDSKCAVCDDGDCENTNAIVFCDGCNLAVHQECYGVPFIPEGQWLCRK
CQLCGRGVPTCIFCPNTDGAFKQTNSSKWAHLLCAMWIPEISLGNHTFMEPVMDVEKVPKTRWKLSCYICHQKMG
ACIQCGNKNCYQAFHVTCARRARLFLKMKTSQGALAVLDGGMVLKAFCDKHCPADYGQENGVRQATRAAKKFYKR
NMRGRIWADNHAMANVIAAQHRNAITEHPPDESQMTGVKNSAVLGDKKKGGQPPKNLWKLPSGAPIIPQAVFDVV
EASIQRFPFRKRKDFLSEACRYWTLKREARRGAALLKRLQLQMETFSSMELTRRNFASMGPAGRARLARRIEFAE
GVIRDLEQLKVLSEELVQREQIKVDAVELEQDFVDECYFPVAKLLIPAIEKATSLDKNLFADGLAEIQGRVEQRF
YVTALSFAQELGDVINGGITTAPRTEEVPEQRFEAADVAPPKNVFTDIRERRKLGKRILKAVQPFLETALRVEAE
ISNKPFENLQRELENLIDTSIDTSRTPVDADPKREAEGEEEDTIMVDAPNSSEITVKSAFRSHVTARSADGDGDG
GRDDGGGGGGNGNGNGGGNGGDAMDTTEDGGNIEVNTSGLGIVHHHHHHHHQGASSSSTTADAIEVSPRKSRTRG
GGAATNGIKPSETPSESDEFAPAGGALARAGQTGPPTPPQSNGSFGKEPGDPLVEGGVLWYLKAMEPAGTSILSE
HWAAGRDAVRMLSEDLTDLDDEELRGLGADVDDAVTAAALDNETVAETTANATATKSKASSSRVRKRRASGRRR*
Coding >Hirsu2|2454
ATGACGCCCTCGAGGCAGCTGAACCCGGCCTCGACCGGCAACACGCCCAACCCCCAGGATAGGAACGAGGCGAAC
GCGCCCGACGCGCCAAACGGCGGCGGCGGCAGCGGCGGCAACAATAACAATAACAACGGCACCCCCTCGAGGGCC
CGGCCCCGGCGCCAGCCCCGCGACGTCGTCAGCTTCTACGGCACCCGCCCCGCCGACCCGGCCGCCACGCCCAAG
ACGCCCAAGATCCTGCCGATACAGAACCAGACGCCCAAGGAGCGGCTGGACCTCAAGCTGCCGTCGTACCGCAAG
ACGAACCGCATCGAGCTCTTCGAGAGCAAGACGTTCGGCCAGGCGCGCTACGTCGACAAGTCGATGAGCAACGTC
GGCTACCAGGAGAGCGACCACTTCCTCCGCCCGGACTCGACCCTCATCAAGGCCGTCGACGGCAACGCCGAGGAC
GAGGCCGACGCGCCGCCCGCCGCCAAGGTCGAGGACCAGCCCATCCACTACCGCCTCGGCCGCGTCGAGTACGAC
ATGGACGAGCAGGACGACATGTGGCTCGAGCACTACAACGGCCAGCGCAAGCAGAACGAGCTCGAGGCCATCACG
CGCGAGGTCTTCGAGATCACCATGACCAAGATCGAGAAGGAGTGGCACGCGCTCGAGAAGCGGATCCCGAAGCCG
AACCCGAAGCCGCCCCAGACGCACCGGCCGCGCTCCAGCTCCGCCGCCGCCGTCAACGGCGAGACGCAGGCGGCC
GAGGAGCCGGACAGCAAGTGCGCCGTCTGCGACGACGGCGACTGTGAGAACACCAACGCCATCGTCTTCTGCGAC
GGCTGCAACCTGGCCGTCCACCAGGAGTGCTACGGCGTGCCCTTCATCCCCGAGGGCCAGTGGCTCTGCCGCAAG
TGCCAGCTCTGCGGACGGGGCGTGCCAACGTGCATCTTCTGCCCCAACACGGACGGCGCCTTTAAGCAGACCAAC
TCATCCAAGTGGGCGCATCTGCTCTGCGCCATGTGGATCCCCGAGATCTCGCTCGGCAACCACACCTTCATGGAA
CCCGTCATGGACGTCGAAAAGGTGCCCAAGACGCGCTGGAAGCTGTCGTGCTACATCTGCCACCAGAAGATGGGC
GCCTGCATCCAGTGCGGCAACAAGAACTGCTACCAGGCCTTCCACGTCACCTGCGCCCGCCGCGCCCGCCTCTTC
CTCAAGATGAAGACGAGCCAGGGCGCGCTCGCCGTCCTCGACGGCGGCATGGTGCTCAAGGCCTTCTGCGACAAG
CACTGCCCGGCCGACTACGGGCAGGAGAACGGCGTGCGGCAGGCGACGCGCGCGGCCAAGAAGTTTTACAAGCGC
AACATGCGCGGCCGCATCTGGGCCGACAACCACGCCATGGCCAACGTCATCGCCGCCCAGCACCGCAACGCCATC
ACCGAGCACCCGCCCGACGAGTCGCAGATGACGGGCGTCAAGAACTCGGCCGTGCTGGGCGACAAGAAGAAGGGC
GGCCAGCCGCCCAAGAACCTGTGGAAGCTGCCGTCGGGCGCCCCCATCATCCCGCAGGCCGTCTTCGACGTCGTC
GAGGCCTCCATCCAGCGCTTCCCCTTCCGCAAGCGCAAGGACTTCCTCAGCGAGGCCTGCCGCTACTGGACGCTG
AAGCGCGAGGCCCGCCGCGGCGCCGCCCTGCTCAAGCGCCTGCAGCTGCAGATGGAGACGTTCTCCTCGATGGAG
CTGACGCGCCGCAACTTCGCCTCGATGGGGCCCGCCGGCCGCGCCCGCCTGGCCCGCCGAATCGAGTTCGCCGAG
GGCGTCATCCGCGACCTCGAGCAGCTCAAGGTGCTGTCGGAGGAGCTCGTCCAGCGCGAGCAGATCAAGGTCGAC
GCCGTCGAGCTCGAGCAGGACTTTGTCGACGAATGCTACTTTCCCGTTGCCAAGCTGCTGATACCGGCGATTGAG
AAGGCGACCTCTCTAGACAAGAACCTGTTCGCGGACGGGCTCGCGGAGATACAGGGCCGCGTGGAGCAGCGCTTC
TACGTGACGGCCCTCTCCTTCGCCCAGGAGCTGGGCGACGTCATCAACGGGGGCATCACGACGGCGCCCAGGACG
GAGGAGGTGCCCGAGCAGCGGTTCGAGGCAGCGGACGTGGCGCCGCCCAAGAACGTCTTCACCGACATACGCGAG
CGCCGAAAGCTGGGCAAGCGCATCCTCAAGGCGGTCCAGCCCTTTCTCGAGACGGCGCTGCGGGTCGAGGCGGAG
ATCTCGAACAAGCCGTTCGAGAACCTGCAGAGGGAGCTGGAGAACCTGATCGACACGAGCATAGACACGTCGCGG
ACGCCCGTTGACGCGGACCCGAAGCGCGAGGCGGAGGGCGAGGAGGAAGACACCATCATGGTCGACGCGCCCAAC
TCGTCCGAGATTACGGTCAAGAGCGCGTTCCGGAGCCACGTCACGGCCAGGTCGGCCGACGGTGACGGCGACGGC
GGGCGCGACGATGGCGGCGGAGGCGGAGGCAACGGTAACGGCAACGGCGGCGGCAACGGCGGCGACGCCATGGAC
ACGACCGAGGACGGCGGGAACATCGAGGTCAACACGTCGGGCCTGGGCATCGTGCATCACCACCACCACCACCAC
CACCAAGGCGCGTCGTCGTCGTCGACGACGGCGGACGCGATCGAGGTGTCGCCCCGCAAGAGCAGGACTCGAGGC
GGCGGGGCGGCGACCAACGGCATCAAGCCGTCCGAGACGCCGTCGGAGAGCGACGAGTTCGCGCCGGCGGGCGGG
GCGCTGGCCAGGGCGGGCCAGACGGGGCCGCCGACGCCGCCGCAGTCCAACGGCAGCTTCGGCAAGGAGCCCGGC
GACCCGCTGGTGGAGGGGGGCGTGCTGTGGTACCTCAAGGCGATGGAGCCGGCGGGCACGTCGATCCTCAGCGAG
CACTGGGCGGCGGGCCGGGACGCGGTGCGGATGCTCAGCGAGGACCTGACAGACCTGGACGACGAGGAGCTGCGG
GGCCTCGGAGCCGACGTGGACGACGCGGTGACGGCGGCGGCGCTCGACAACGAGACGGTGGCGGAGACGACGGCC
AACGCGACGGCGACGAAGAGCAAGGCGAGCAGCAGCCGGGTGAGGAAGCGGAGGGCATCGGGCAGGCGGCGATGA
Transcript >Hirsu2|2454
ATGACGCCCTCGAGGCAGCTGAACCCGGCCTCGACCGGCAACACGCCCAACCCCCAGGATAGGAACGAGGCGAAC
GCGCCCGACGCGCCAAACGGCGGCGGCGGCAGCGGCGGCAACAATAACAATAACAACGGCACCCCCTCGAGGGCC
CGGCCCCGGCGCCAGCCCCGCGACGTCGTCAGCTTCTACGGCACCCGCCCCGCCGACCCGGCCGCCACGCCCAAG
ACGCCCAAGATCCTGCCGATACAGAACCAGACGCCCAAGGAGCGGCTGGACCTCAAGCTGCCGTCGTACCGCAAG
ACGAACCGCATCGAGCTCTTCGAGAGCAAGACGTTCGGCCAGGCGCGCTACGTCGACAAGTCGATGAGCAACGTC
GGCTACCAGGAGAGCGACCACTTCCTCCGCCCGGACTCGACCCTCATCAAGGCCGTCGACGGCAACGCCGAGGAC
GAGGCCGACGCGCCGCCCGCCGCCAAGGTCGAGGACCAGCCCATCCACTACCGCCTCGGCCGCGTCGAGTACGAC
ATGGACGAGCAGGACGACATGTGGCTCGAGCACTACAACGGCCAGCGCAAGCAGAACGAGCTCGAGGCCATCACG
CGCGAGGTCTTCGAGATCACCATGACCAAGATCGAGAAGGAGTGGCACGCGCTCGAGAAGCGGATCCCGAAGCCG
AACCCGAAGCCGCCCCAGACGCACCGGCCGCGCTCCAGCTCCGCCGCCGCCGTCAACGGCGAGACGCAGGCGGCC
GAGGAGCCGGACAGCAAGTGCGCCGTCTGCGACGACGGCGACTGTGAGAACACCAACGCCATCGTCTTCTGCGAC
GGCTGCAACCTGGCCGTCCACCAGGAGTGCTACGGCGTGCCCTTCATCCCCGAGGGCCAGTGGCTCTGCCGCAAG
TGCCAGCTCTGCGGACGGGGCGTGCCAACGTGCATCTTCTGCCCCAACACGGACGGCGCCTTTAAGCAGACCAAC
TCATCCAAGTGGGCGCATCTGCTCTGCGCCATGTGGATCCCCGAGATCTCGCTCGGCAACCACACCTTCATGGAA
CCCGTCATGGACGTCGAAAAGGTGCCCAAGACGCGCTGGAAGCTGTCGTGCTACATCTGCCACCAGAAGATGGGC
GCCTGCATCCAGTGCGGCAACAAGAACTGCTACCAGGCCTTCCACGTCACCTGCGCCCGCCGCGCCCGCCTCTTC
CTCAAGATGAAGACGAGCCAGGGCGCGCTCGCCGTCCTCGACGGCGGCATGGTGCTCAAGGCCTTCTGCGACAAG
CACTGCCCGGCCGACTACGGGCAGGAGAACGGCGTGCGGCAGGCGACGCGCGCGGCCAAGAAGTTTTACAAGCGC
AACATGCGCGGCCGCATCTGGGCCGACAACCACGCCATGGCCAACGTCATCGCCGCCCAGCACCGCAACGCCATC
ACCGAGCACCCGCCCGACGAGTCGCAGATGACGGGCGTCAAGAACTCGGCCGTGCTGGGCGACAAGAAGAAGGGC
GGCCAGCCGCCCAAGAACCTGTGGAAGCTGCCGTCGGGCGCCCCCATCATCCCGCAGGCCGTCTTCGACGTCGTC
GAGGCCTCCATCCAGCGCTTCCCCTTCCGCAAGCGCAAGGACTTCCTCAGCGAGGCCTGCCGCTACTGGACGCTG
AAGCGCGAGGCCCGCCGCGGCGCCGCCCTGCTCAAGCGCCTGCAGCTGCAGATGGAGACGTTCTCCTCGATGGAG
CTGACGCGCCGCAACTTCGCCTCGATGGGGCCCGCCGGCCGCGCCCGCCTGGCCCGCCGAATCGAGTTCGCCGAG
GGCGTCATCCGCGACCTCGAGCAGCTCAAGGTGCTGTCGGAGGAGCTCGTCCAGCGCGAGCAGATCAAGGTCGAC
GCCGTCGAGCTCGAGCAGGACTTTGTCGACGAATGCTACTTTCCCGTTGCCAAGCTGCTGATACCGGCGATTGAG
AAGGCGACCTCTCTAGACAAGAACCTGTTCGCGGACGGGCTCGCGGAGATACAGGGCCGCGTGGAGCAGCGCTTC
TACGTGACGGCCCTCTCCTTCGCCCAGGAGCTGGGCGACGTCATCAACGGGGGCATCACGACGGCGCCCAGGACG
GAGGAGGTGCCCGAGCAGCGGTTCGAGGCAGCGGACGTGGCGCCGCCCAAGAACGTCTTCACCGACATACGCGAG
CGCCGAAAGCTGGGCAAGCGCATCCTCAAGGCGGTCCAGCCCTTTCTCGAGACGGCGCTGCGGGTCGAGGCGGAG
ATCTCGAACAAGCCGTTCGAGAACCTGCAGAGGGAGCTGGAGAACCTGATCGACACGAGCATAGACACGTCGCGG
ACGCCCGTTGACGCGGACCCGAAGCGCGAGGCGGAGGGCGAGGAGGAAGACACCATCATGGTCGACGCGCCCAAC
TCGTCCGAGATTACGGTCAAGAGCGCGTTCCGGAGCCACGTCACGGCCAGGTCGGCCGACGGTGACGGCGACGGC
GGGCGCGACGATGGCGGCGGAGGCGGAGGCAACGGTAACGGCAACGGCGGCGGCAACGGCGGCGACGCCATGGAC
ACGACCGAGGACGGCGGGAACATCGAGGTCAACACGTCGGGCCTGGGCATCGTGCATCACCACCACCACCACCAC
CACCAAGGCGCGTCGTCGTCGTCGACGACGGCGGACGCGATCGAGGTGTCGCCCCGCAAGAGCAGGACTCGAGGC
GGCGGGGCGGCGACCAACGGCATCAAGCCGTCCGAGACGCCGTCGGAGAGCGACGAGTTCGCGCCGGCGGGCGGG
GCGCTGGCCAGGGCGGGCCAGACGGGGCCGCCGACGCCGCCGCAGTCCAACGGCAGCTTCGGCAAGGAGCCCGGC
GACCCGCTGGTGGAGGGGGGCGTGCTGTGGTACCTCAAGGCGATGGAGCCGGCGGGCACGTCGATCCTCAGCGAG
CACTGGGCGGCGGGCCGGGACGCGGTGCGGATGCTCAGCGAGGACCTGACAGACCTGGACGACGAGGAGCTGCGG
GGCCTCGGAGCCGACGTGGACGACGCGGTGACGGCGGCGGCGCTCGACAACGAGACGGTGGCGGAGACGACGGCC
AACGCGACGGCGACGAAGAGCAAGGCGAGCAGCAGCCGGGTGAGGAAGCGGAGGGCATCGGGCAGGCGGCGATGA
Gene >Hirsu2|2454
ATGACGCCCTCGAGGCAGCTGAACCCGGCCTCGACCGGCAACACGCCCAACCCCCAGGATAGGAACGAGGCGAAC
GCGCCCGACGCGCCAAACGGCGGCGGCGGCAGCGGCGGCAACAATAACAATAACAACGGCACCCCCTCGAGGGCC
CGGCCCCGGCGCCAGCCCCGCGACGTCGTCAGCTTCTACGGCACCCGCCCCGCCGACCCGGCCGCCACGCCCAAG
ACGCCCAAGATCCTGCCGATACAGAACCAGACGCCCAAGGAGCGGCTGGACCTCAAGCTGCCGTCGTACCGCAAG
ACGAACCGCATCGAGCTCTTCGAGAGCAAGACGTTCGGCCAGGCGCGCTACGTCGACAAGTCGATGAGCAACGTC
GGCTACCAGGAGAGCGACCACTTCCTCCGCCCGGACTCGACCCTCATCAAGGCCGTCGACGGCAACGCCGAGGAC
GAGGCCGACGCGCCGCCCGCCGCCAAGGTCGAGGACCAGCCCATCCACTACCGCCTCGGCCGCGTCGAGTACGAC
ATGGACGAGCAGGACGACATGTGGCTCGAGCACTACAACGGCCAGCGCAAGCAGAACGAGCTCGAGGCCATCACG
CGCGAGGTCTTCGAGATCACCATGACCAAGATCGAGAAGGAGTGGCACGCGCTCGAGAAGCGGATCCCGAAGCCG
AACCCGAAGCCGCCCCAGACGCACCGGCCGCGCTCCAGCTCCGCCGCCGCCGTCAACGGCGAGACGCAGGCGGCC
GAGGAGCCGGACAGCAAGTGCGCCGTCTGCGACGACGGCGACTGTGAGAACACCAACGCCATCGTCTTCTGCGAC
GGCTGCAACCTGGCCGTCCACCAGGAGTGCTACGGCGTGCCCTTCATCCCCGAGGGCCAGTGGCTCTGCCGCAAG
TGCCAGCTCTGCGGACGGGGCGTGCCAGTCAGACTCCCCCTCCTCCCCCCCCTCCCCCCTCCCCTGTGCTCTTCT
TCCCGTCGTCCTGTACATGCGCTGACCCGTGACGGCCTGCCTCCTTGTGTGCGCCTCGGCCCTCCGTCTCTCTCT
CTCTCTCTTACAGACGTGCATCTTCTGCCCCAACACGGACGGCGCCTTTAAGCAGACCAACTCATCCAAGTGGGC
GCATCTGCTCTGCGCCATGTGGATCCCCGAGATCTCGCTCGGCAACCACACCTTCATGGAACCCGTCATGGACGT
CGAAAAGGTGCCCAAGACGCGCTGGAAGCTGTCGTGCTACATCTGCCACCAGAAGATGGGCGCCTGCATCCAGTG
CGGCAACAAGAACTGCTACCAGGCCTTCCACGTCACCTGCGCCCGCCGCGCCCGCCTCTTCCTCAAGATGAAGAC
GAGCCAGGGCGCGCTCGCCGTCCTCGACGGCGGCATGGTGCTCAAGGCCTTCTGCGACAAGCACTGCCCGGCCGA
CTACGGGCAGGAGAACGGCGTGCGGCAGGCGACGCGCGCGGCCAAGAAGTTTTACAAGCGCAACATGCGCGGCCG
CATCTGGGCCGACAACCACGCCATGGCCAACGTCATCGCCGCCCAGCACCGCAACGCCATCACCGAGCACCCGCC
CGACGAGTCGCAGATGACGGGCGTCAAGAACTCGGCCGTGCTGGGCGACAAGAAGAAGGGCGGCCAGCCGCCCAA
GAACCTGTGGAAGCTGCCGTCGGGCGCCCCCATCATCCCGCAGGCCGTCTTCGACGTCGTCGAGGCCTCCATCCA
GCGCTTCCCCTTCCGCAAGCGCAAGGACTTCCTCAGCGAGGCCTGCCGCTACTGGACGCTGAAGCGCGAGGCCCG
CCGCGGCGCCGCCCTGCTCAAGCGCCTGCAGCTGCAGATGGAGACGTTCTCCTCGATGGAGCTGACGCGCCGCAA
CTTCGCCTCGATGGGGCCCGCCGGCCGCGCCCGCCTGGCCCGCCGAATCGAGTTCGCCGAGGGCGTCATCCGCGA
CCTCGAGCAGCTCAAGGTGCTGTCGGAGGAGCTCGTCCAGCGCGAGCAGATCAAGGTCGACGCCGTCGAGCTCGA
GCAGGACTTTGTCGACGAATGCTACTTTCCCGTTGCCAAGCTGCTGATACCGGCGATTGAGAAGGCGACCTCGTA
TGTTTTCCCTCCTTTCCCCTTTCCCCCCCCCGTTTTCCCCCGCGTTGTTGCGTCTGCCGCCGGGGGGATAGGGAG
ACAGACGAACGGAGGAGGAAGAGACGAGAAAGCAAGCGAAGAGAGAACTAACTCTAATCCCGCGCTCGCCAGTCT
AGACAAGAACCTGTTCGCGGACGGGCTCGCGGAGATACAGGGCCGCGTGGAGCAGCGCTTCTACGTGACGGCCCT
CTCCTTCGCCCAGGAGCTGGGCGACGTCATCAACGGGGGCATCACGACGGCGCCCAGGACGGAGGAGGTGCCCGA
GCAGCGGTTCGAGGCAGCGGACGTGGCGCCGCCCAAGAACGTCTTCACCGACATACGCGAGCGCCGAAAGCTGGG
CAAGCGCATCCTCAAGGCGGTCCAGCCCTTTCTCGAGACGGCGCTGCGGGTCGAGGCGGAGATCTCGAACAAGCC
GTTCGAGAACCTGCAGAGGGAGCTGGAGAACCTGATCGACACGAGCATAGACACGTCGCGGACGCCCGTTGACGC
GGACCCGAAGCGCGAGGCGGAGGGCGAGGAGGAAGACACCATCATGGTCGACGCGCCCAACTCGTCCGAGATTAC
GGTCAAGAGCGCGTTCCGGAGCCACGTCACGGCCAGGTCGGCCGACGGTGACGGCGACGGCGGGCGCGACGATGG
CGGCGGAGGCGGAGGCAACGGTAACGGCAACGGCGGCGGCAACGGCGGCGACGCCATGGACACGACCGAGGACGG
CGGGAACATCGAGGTCAACACGTCGGGCCTGGGCATCGTGCATCACCACCACCACCACCACCACCAAGGCGCGTC
GTCGTCGTCGACGACGGCGGACGCGATCGAGGTGTCGCCCCGCAAGAGCAGGACTCGAGGCGGCGGGGCGGCGAC
CAACGGCATCAAGCCGTCCGAGACGCCGTCGGAGAGCGACGAGTTCGCGCCGGCGGGCGGGGCGCTGGCCAGGGC
GGGCCAGACGGGGCCGCCGACGCCGCCGCAGTCCAACGGCAGCTTCGGCAAGGAGCCCGGCGACCCGCTGGTGGA
GGGGGGCGTGCTGTGGTACCTCAAGGCGATGGAGCCGGCGGGCACGTCGATCCTCAGCGAGCACTGGGCGGCGGG
CCGGGACGCGGTGCGGATGCTCAGCGAGGACCTGACAGACCTGGACGACGAGGAGCTGCGGGGCCTCGGAGCCGA
CGTGGACGACGCGGTGACGGCGGCGGCGCTCGACAACGAGACGGTGGCGGAGACGACGGCCAACGCGACGGCGAC
GAAGAGCAAGGCGAGCAGCAGCCGGGTGAGGAAGCGGAGGGCATCGGGCAGGCGGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail