Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2452
Gene name
LocationContig_1588:2688..3682
Strand+
Gene length (bp)994
Transcript length (bp)897
Coding sequence length (bp)897
Protein length (aa) 299

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 7.7E-07 86 253

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P23903|E13B_BACCI Glucan endo-1,3-beta-glucosidase A1 OS=Bacillus circulans GN=glcA PE=1 SV=1 2 257 2.0E-17
sp|P45798|GUB_RHOMR Beta-glucanase OS=Rhodothermus marinus GN=bglA PE=1 SV=1 52 259 4.0E-15
sp|Q9Z3Q2|EGLC_RHIME Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) GN=eglC PE=3 SV=2 66 249 4.0E-08
sp|O33680|EXSH_RHIME Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) GN=exsH PE=1 SV=1 54 263 4.0E-07

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2452
MPFRDRLIKRVRNEWDSLTSPSRPDQPPPEPQPQPDCVYWRPRFHPDVAVTDDWDAKIGNGPDGWGNQELQHYTA
APANSFHTDDGKLVLRAVAVNSSADASTRYTSARLVSRQTLARDRGALTAVVLSPCADGIWPAFWLLPQEPFSWP
VDGEVDIAETWNGDGENKSCLHWGFHHEPHKHRVLGTRIPDMHCRPVRYDFAWDQPGGRPGQGRMLWYIDGRPVM
KAPIPEGTRPIRDMTVLLNVAMGGNVCGGKTPADGSYDMVVSTLFLATELEDGGWDRFERDWQSDATPHGNTY*
Coding >Hirsu2|2452
ATGCCCTTCCGAGACCGTCTGATCAAGCGGGTCAGGAATGAATGGGACAGCCTGACCTCGCCGTCCCGCCCCGAC
CAGCCGCCGCCCGAGCCCCAGCCTCAGCCCGACTGCGTCTACTGGCGGCCGCGCTTCCATCCCGACGTCGCCGTC
ACCGATGACTGGGACGCCAAGATCGGCAACGGCCCGGACGGCTGGGGGAACCAGGAGCTCCAGCACTACACGGCC
GCTCCCGCCAACTCATTCCACACCGATGACGGCAAGCTCGTCCTCCGCGCCGTGGCCGTCAACAGCTCGGCCGAC
GCCTCGACGCGCTACACGTCGGCCCGGCTGGTCAGCCGCCAGACGCTGGCGCGCGACCGGGGCGCGCTGACGGCC
GTCGTGCTCAGCCCCTGCGCCGACGGCATCTGGCCGGCCTTCTGGCTGCTTCCGCAGGAGCCCTTTTCGTGGCCG
GTCGATGGCGAGGTCGACATCGCCGAGACGTGGAACGGCGACGGCGAGAACAAGTCGTGCCTGCACTGGGGCTTC
CACCACGAGCCGCACAAGCACCGCGTCCTCGGCACCCGCATCCCCGACATGCACTGCCGCCCCGTCCGCTACGAC
TTCGCCTGGGACCAGCCCGGCGGCCGGCCCGGCCAGGGCCGCATGCTCTGGTACATCGACGGCCGGCCCGTCATG
AAGGCGCCCATCCCGGAGGGCACCCGGCCCATCCGCGACATGACCGTCCTGCTCAACGTGGCCATGGGCGGCAAC
GTCTGCGGCGGCAAGACGCCGGCCGACGGCTCCTACGACATGGTCGTTTCCACCCTCTTCCTCGCGACCGAGCTC
GAGGACGGCGGATGGGATCGCTTCGAGCGCGACTGGCAGAGCGATGCCACGCCCCACGGCAACACGTACTGA
Transcript >Hirsu2|2452
ATGCCCTTCCGAGACCGTCTGATCAAGCGGGTCAGGAATGAATGGGACAGCCTGACCTCGCCGTCCCGCCCCGAC
CAGCCGCCGCCCGAGCCCCAGCCTCAGCCCGACTGCGTCTACTGGCGGCCGCGCTTCCATCCCGACGTCGCCGTC
ACCGATGACTGGGACGCCAAGATCGGCAACGGCCCGGACGGCTGGGGGAACCAGGAGCTCCAGCACTACACGGCC
GCTCCCGCCAACTCATTCCACACCGATGACGGCAAGCTCGTCCTCCGCGCCGTGGCCGTCAACAGCTCGGCCGAC
GCCTCGACGCGCTACACGTCGGCCCGGCTGGTCAGCCGCCAGACGCTGGCGCGCGACCGGGGCGCGCTGACGGCC
GTCGTGCTCAGCCCCTGCGCCGACGGCATCTGGCCGGCCTTCTGGCTGCTTCCGCAGGAGCCCTTTTCGTGGCCG
GTCGATGGCGAGGTCGACATCGCCGAGACGTGGAACGGCGACGGCGAGAACAAGTCGTGCCTGCACTGGGGCTTC
CACCACGAGCCGCACAAGCACCGCGTCCTCGGCACCCGCATCCCCGACATGCACTGCCGCCCCGTCCGCTACGAC
TTCGCCTGGGACCAGCCCGGCGGCCGGCCCGGCCAGGGCCGCATGCTCTGGTACATCGACGGCCGGCCCGTCATG
AAGGCGCCCATCCCGGAGGGCACCCGGCCCATCCGCGACATGACCGTCCTGCTCAACGTGGCCATGGGCGGCAAC
GTCTGCGGCGGCAAGACGCCGGCCGACGGCTCCTACGACATGGTCGTTTCCACCCTCTTCCTCGCGACCGAGCTC
GAGGACGGCGGATGGGATCGCTTCGAGCGCGACTGGCAGAGCGATGCCACGCCCCACGGCAACACGTACTGA
Gene >Hirsu2|2452
ATGCCCTTCCGAGACCGTCTGATCAAGCGGGTCAGGAATGAATGGGACAGCCTGACCTCGCCGTCCCGCCCCGAC
CAGCCGCCGCCCGAGCCCCAGCCTCAGCCCGACTGCGTCTACTGGCGGCCGCGCTTCCATCCCGACGTCGCCGTC
ACCGATGACTGGGACGCCAAGATCGGCAACGGCCCGGACGGCTGGGGGAACCAGGAGCTCCAGCACTACACGGCC
GCTCCCGCCAACTCATTCCAGTGCGTCTCTCTCTCTCTCCTTCTCTGCGCCGCGGCATCGCTCCGGCATGCCTTC
GCTCTGCTGTCCCAAAAGCGCTGCTGACCCGCCCATAAACAGCACCGATGACGGCAAGCTCGTCCTCCGCGCCGT
GGCCGTCAACAGCTCGGCCGACGCCTCGACGCGCTACACGTCGGCCCGGCTGGTCAGCCGCCAGACGCTGGCGCG
CGACCGGGGCGCGCTGACGGCCGTCGTGCTCAGCCCCTGCGCCGACGGCATCTGGCCGGCCTTCTGGCTGCTTCC
GCAGGAGCCCTTTTCGTGGCCGGTCGATGGCGAGGTCGACATCGCCGAGACGTGGAACGGCGACGGCGAGAACAA
GTCGTGCCTGCACTGGGGCTTCCACCACGAGCCGCACAAGCACCGCGTCCTCGGCACCCGCATCCCCGACATGCA
CTGCCGCCCCGTCCGCTACGACTTCGCCTGGGACCAGCCCGGCGGCCGGCCCGGCCAGGGCCGCATGCTCTGGTA
CATCGACGGCCGGCCCGTCATGAAGGCGCCCATCCCGGAGGGCACCCGGCCCATCCGCGACATGACCGTCCTGCT
CAACGTGGCCATGGGCGGCAACGTCTGCGGCGGCAAGACGCCGGCCGACGGCTCCTACGACATGGTCGTTTCCAC
CCTCTTCCTCGCGACCGAGCTCGAGGACGGCGGATGGGATCGCTTCGAGCGCGACTGGCAGAGCGATGCCACGCC
CCACGGCAACACGTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail