Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2450
Gene name
LocationContig_1587:1674..2910
Strand-
Gene length (bp)1236
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02517 CPBP CPBP intramembrane metalloprotease 4.6E-14 157 260

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94448|RCE1_SCHPO Probable CAAX prenyl protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1687.02 PE=3 SV=1 13 305 8.0E-48
sp|Q8GW19|FACE2_ARATH CAAX prenyl protease 2 OS=Arabidopsis thaliana GN=FACE2 PE=2 SV=2 4 269 1.0E-31
sp|Q9U1H8|FACE2_DROME CAAX prenyl protease 2 OS=Drosophila melanogaster GN=Sras PE=2 SV=3 21 266 8.0E-25
sp|P57791|FACE2_MOUSE CAAX prenyl protease 2 OS=Mus musculus GN=Rce1 PE=2 SV=1 26 271 8.0E-24
sp|Q9Y256|FACE2_HUMAN CAAX prenyl protease 2 OS=Homo sapiens GN=RCE1 PE=1 SV=1 4 271 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94448|RCE1_SCHPO Probable CAAX prenyl protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1687.02 PE=3 SV=1 13 305 8.0E-48
sp|Q8GW19|FACE2_ARATH CAAX prenyl protease 2 OS=Arabidopsis thaliana GN=FACE2 PE=2 SV=2 4 269 1.0E-31
sp|Q9U1H8|FACE2_DROME CAAX prenyl protease 2 OS=Drosophila melanogaster GN=Sras PE=2 SV=3 21 266 8.0E-25
sp|P57791|FACE2_MOUSE CAAX prenyl protease 2 OS=Mus musculus GN=Rce1 PE=2 SV=1 26 271 8.0E-24
sp|Q9Y256|FACE2_HUMAN CAAX prenyl protease 2 OS=Homo sapiens GN=RCE1 PE=1 SV=1 4 271 2.0E-23
sp|Q03530|RCE1_YEAST CAAX prenyl protease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCE1 PE=1 SV=1 26 303 3.0E-19
sp|G5EEP3|FACE2_CAEEL CAAX prenyl protease 2 homolog OS=Caenorhabditis elegans GN=fce-2 PE=2 SV=1 43 273 3.0E-17
sp|A6H7A0|FACE2_BOVIN CAAX prenyl protease 2 OS=Bos taurus GN=RCE1 PE=2 SV=1 4 271 1.0E-12
sp|B0BMW8|FACE2_RAT CAAX prenyl protease 2 OS=Rattus norvegicus GN=Rce1 PE=2 SV=1 5 271 3.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 178 200 22
3 220 242 22
4 247 269 22
5 289 311 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2450
MDSGSEGPGLGHLQAYGLLIVYCLVYVLPLYASSTTRPSPTRSRDSPEAIRARVRAVSLSTSACCTGTLLILCRS
AAAIRSSSGSLSEPATARYLLQSPSHLMGIWPVGFNEIVKSLLLTSLLFAGPLFECLVLDGAWRYIWRLNSLKQV
WYDHPTWRNIIVGPVTEECLFRSATVPLLLLAGSNLSSIVFRSPLVFGLAHLHHFYEFRITHPHSTLTAGIVRSL
LQFSYTSVFGAYATFLFLRTGSLLAVIVVHAFCNCVGLPRLWGSVEPYWTLSRDSRASNSLTKWTALYYMLLLGG
CVSWYANLYYLTQSSLALAAL*
Coding >Hirsu2|2450
ATGGACTCAGGGTCGGAGGGACCTGGCCTCGGCCATTTACAGGCTTACGGTCTTCTGATAGTTTACTGCCTCGTA
TATGTCCTGCCTCTTTATGCCTCGTCCACCACACGGCCCTCGCCCACTCGATCCAGAGATTCTCCTGAGGCCATC
CGAGCCCGAGTACGAGCTGTTTCTCTGTCCACTTCTGCCTGCTGTACTGGCACGCTTCTCATTCTCTGCCGATCC
GCCGCTGCAATCCGCTCTAGCTCCGGCTCGCTCTCTGAACCTGCTACGGCCAGATACCTTCTGCAGTCTCCTTCT
CACCTCATGGGAATTTGGCCTGTGGGTTTCAACGAGATCGTCAAGAGCCTCCTCTTGACGTCATTACTATTCGCC
GGTCCCCTCTTCGAATGCCTTGTCCTGGACGGTGCCTGGAGATACATATGGCGGCTCAACTCTCTCAAGCAGGTT
TGGTACGACCATCCAACTTGGCGAAACATAATTGTGGGTCCTGTCACTGAGGAATGCCTCTTCCGCTCCGCGACA
GTCCCCTTATTACTTCTTGCGGGTTCGAATTTGTCGAGCATCGTTTTTCGGTCTCCCCTTGTCTTCGGTCTTGCA
CACCTACACCACTTCTATGAATTCCGCATCACTCACCCCCATTCAACACTCACCGCCGGCATTGTCCGTTCGCTT
CTCCAGTTCTCGTACACGTCGGTTTTCGGCGCTTATGCTACCTTTCTGTTCTTACGCACGGGCTCTCTGCTTGCT
GTCATCGTTGTACATGCATTTTGCAATTGTGTTGGGCTTCCACGCCTATGGGGTAGTGTGGAGCCCTACTGGACG
CTTAGCCGCGATTCGCGTGCCTCCAATTCTTTGACCAAATGGACCGCACTCTACTATATGCTGCTTCTGGGCGGG
TGTGTATCCTGGTACGCGAACCTCTATTATCTGACACAATCGTCCCTGGCTCTCGCTGCACTTTGA
Transcript >Hirsu2|2450
ATGGACTCAGGGTCGGAGGGACCTGGCCTCGGCCATTTACAGGCTTACGGTCTTCTGATAGTTTACTGCCTCGTA
TATGTCCTGCCTCTTTATGCCTCGTCCACCACACGGCCCTCGCCCACTCGATCCAGAGATTCTCCTGAGGCCATC
CGAGCCCGAGTACGAGCTGTTTCTCTGTCCACTTCTGCCTGCTGTACTGGCACGCTTCTCATTCTCTGCCGATCC
GCCGCTGCAATCCGCTCTAGCTCCGGCTCGCTCTCTGAACCTGCTACGGCCAGATACCTTCTGCAGTCTCCTTCT
CACCTCATGGGAATTTGGCCTGTGGGTTTCAACGAGATCGTCAAGAGCCTCCTCTTGACGTCATTACTATTCGCC
GGTCCCCTCTTCGAATGCCTTGTCCTGGACGGTGCCTGGAGATACATATGGCGGCTCAACTCTCTCAAGCAGGTT
TGGTACGACCATCCAACTTGGCGAAACATAATTGTGGGTCCTGTCACTGAGGAATGCCTCTTCCGCTCCGCGACA
GTCCCCTTATTACTTCTTGCGGGTTCGAATTTGTCGAGCATCGTTTTTCGGTCTCCCCTTGTCTTCGGTCTTGCA
CACCTACACCACTTCTATGAATTCCGCATCACTCACCCCCATTCAACACTCACCGCCGGCATTGTCCGTTCGCTT
CTCCAGTTCTCGTACACGTCGGTTTTCGGCGCTTATGCTACCTTTCTGTTCTTACGCACGGGCTCTCTGCTTGCT
GTCATCGTTGTACATGCATTTTGCAATTGTGTTGGGCTTCCACGCCTATGGGGTAGTGTGGAGCCCTACTGGACG
CTTAGCCGCGATTCGCGTGCCTCCAATTCTTTGACCAAATGGACCGCACTCTACTATATGCTGCTTCTGGGCGGG
TGTGTATCCTGGTACGCGAACCTCTATTATCTGACACAATCGTCCCTGGCTCTCGCTGCACTTTGA
Gene >Hirsu2|2450
ATGGACTCAGGGTCGGAGGGACCTGGCCTCGGCCATTTACAGGCTTACGGTCTTCTGGTAAGTGTCGAGTCATAA
GTTGGGCGGCGTTATAGAAAAGAAAGGCCCATCACGGTCGGGCCTTCGGCGAGAAATCCTCAGCACTGCACAGCT
CATTCTCGCAGTCAGCACAGGCCTGCAATTGCTAACGGAACAATACAGATAGTTTACTGCCTCGTATATGTCCTG
CCTCTTTATGCCTCGTCCACCACACGGCCCTCGCCCACTCGATCCAGAGATTCTCCTGAGGCCATCCGAGCCCGA
GTACGAGCTGTTTCTCTGTCCACTTCTGCCTGCTGTACTGGCACGCTTCTCATTCTCTGCCGATCCGCCGCTGCA
ATCCGCTCTAGCTCCGGCTCGCTCTCTGAACCTGCTACGGCCAGATACCTTCTGCAGTCTCCTTCTCACCTCATG
GGAATTTGGCCTGTGGGTTTCAACGAGATCGTCAAGAGCCTCCTCTTGACGTCATTACTATTCGCCGGTCCCCTC
TTCGAATGCCTTGTCCTGGACGGTGCCTGGAGATACATATGGCGGCTCAACTCTCTCAAGCAGGTTTGGTACGAC
CATCCAACTTGGCGAAACATAATTGTGGTAAGTGCACACATTCAAATCGCCAGCGTTATAACTCATCTGTATGAT
CAATTCTTCATGTATATGGCCAAGGTCACCTGGACCCCGATCATCGTCTATCCTGTTGGCCATGTTCTCACTTTT
CGTTAGGGTCCTGTCACTGAGGAATGCCTCTTCCGCTCCGCGACAGTCCCCTTATTACTTCTTGCGGGTTCGAAT
TTGTCGAGCATCGTTTTTCGGTCTCCCCTTGTCTTCGGTCTTGCACACCTACACCACTTCTATGAATTCCGCATC
ACTCACCCCCATTCAACACTCACCGCCGGCATTGTCCGTTCGCTTCTCCAGTTCTCGTACACGTCGGTTTTCGGC
GCTTATGCTACCTTTCTGTTCTTACGCACGGGCTCTCTGCTTGCTGTCATCGTTGTACATGCATTTTGCAATTGT
GTTGGGCTTCCACGCCTATGGGGTAGTGTGGAGCCCTACTGGACGCTTAGCCGCGATTCGCGTGCCTCCAATTCT
TTGACCAAATGGACCGCACTCTACTATATGCTGCTTCTGGGCGGGTGTGTATCCTGGTACGCGAACCTCTATTAT
CTGACACAATCGTCCCTGGCTCTCGCTGCACTTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail