© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|2447 |
| Gene name | |
| Location | Contig_1586:72..607 |
| Strand | + |
| Gene length (bp) | 535 |
| Transcript length (bp) | 489 |
| Coding sequence length (bp) | 489 |
| Protein length (aa) | 163 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P19541|RDS2_YEAST | Regulator of drug sensitivity 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDS2 PE=1 SV=2 | 19 | 162 | 3.0E-45 |
| sp|Q754V2|ERT1_ASHGO | Transcription activator of gluconeogenesis ERT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERT1 PE=3 SV=2 | 58 | 152 | 1.0E-13 |
| sp|C5E2K7|ERT1_LACTC | Transcription activator of gluconeogenesis ERT1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=ERT1 PE=3 SV=1 | 58 | 152 | 2.0E-13 |
| sp|C5E1J9|ERT1_ZYGRC | Transcription activator of gluconeogenesis OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ERT1 PE=3 SV=1 | 18 | 152 | 8.0E-12 |
| sp|Q6C764|ERT12_YARLI | Transcription activator of gluconeogenesis ERT1-2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERT1-2 PE=3 SV=1 | 56 | 152 | 4.0E-11 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P19541|RDS2_YEAST | Regulator of drug sensitivity 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDS2 PE=1 SV=2 | 19 | 162 | 3.0E-45 |
| sp|Q754V2|ERT1_ASHGO | Transcription activator of gluconeogenesis ERT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERT1 PE=3 SV=2 | 58 | 152 | 1.0E-13 |
| sp|C5E2K7|ERT1_LACTC | Transcription activator of gluconeogenesis ERT1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=ERT1 PE=3 SV=1 | 58 | 152 | 2.0E-13 |
| sp|C5E1J9|ERT1_ZYGRC | Transcription activator of gluconeogenesis OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ERT1 PE=3 SV=1 | 18 | 152 | 8.0E-12 |
| sp|Q6C764|ERT12_YARLI | Transcription activator of gluconeogenesis ERT1-2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERT1-2 PE=3 SV=1 | 56 | 152 | 4.0E-11 |
| sp|P38140|ERT1_YEAST | Transcription activator of gluconeogenesis ERT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERT1 PE=1 SV=1 | 59 | 148 | 3.0E-10 |
| sp|A6ZLH8|ERT1_YEAS7 | Transcription activator of gluconeogenesis OS=Saccharomyces cerevisiae (strain YJM789) GN=ERT1 PE=3 SV=1 | 59 | 148 | 3.0E-10 |
| sp|D3UEY7|ERT1_YEAS8 | Transcription activator of gluconeogenesis OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=ERT1 PE=3 SV=1 | 59 | 148 | 3.0E-10 |
| sp|C7GMR4|ERT1_YEAS2 | Transcription activator of gluconeogenesis OS=Saccharomyces cerevisiae (strain JAY291) GN=ERT1 PE=3 SV=1 | 59 | 148 | 3.0E-10 |
| sp|B3LMS3|ERT1_YEAS1 | Transcription activator of gluconeogenesis OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ERT1 PE=3 SV=1 | 59 | 148 | 3.0E-10 |
| sp|B0D0T8|ERT1_LACBS | Transcription activator of gluconeogenesis ERT1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=ERT1 PE=3 SV=1 | 56 | 160 | 3.0E-10 |
| sp|B8PBQ6|ERT1_POSPM | Transcription activator of gluconeogenesis ERT1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=ERT1 PE=3 SV=1 | 50 | 152 | 4.0E-10 |
| sp|Q2GSA4|ACUK_CHAGB | Transcription activator of gluconeogenesis CHGG_09150 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_09150 PE=3 SV=1 | 58 | 160 | 4.0E-10 |
| sp|C4YLC3|ERT1_CANAW | Transcription activator of gluconeogenesis ERT1 OS=Candida albicans (strain WO-1) GN=ERT1 PE=3 SV=1 | 35 | 160 | 1.0E-09 |
| sp|Q7RUA4|ACUK_NEUCR | Transcription activator of gluconeogenesis NCU03938 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=G17A4.270 PE=3 SV=2 | 52 | 153 | 1.0E-09 |
| sp|A8N767|ERT1_COPC7 | Transcription activator of gluconeogenesis ERT1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ERT1 PE=3 SV=1 | 4 | 160 | 1.0E-09 |
| sp|B9WLA7|ERT1_CANDC | Transcription activator of gluconeogenesis ERT1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ERT1 PE=3 SV=1 | 9 | 160 | 1.0E-09 |
| sp|C4QV17|GSM1_PICPG | Glucose starvation modulator protein 1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=GSM1 PE=3 SV=1 | 52 | 152 | 1.0E-09 |
| sp|D1ZRZ5|ACUK_SORMK | Transcription activator of gluconeogenesis SMAC_06113 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_06113 PE=3 SV=2 | 52 | 153 | 2.0E-09 |
| sp|A5DF43|ERT1_PICGU | Transcription activator of gluconeogenesis ERT1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ERT1 PE=3 SV=2 | 54 | 160 | 2.0E-09 |
| sp|Q6C5G3|ERT11_YARLI | Transcription activator of gluconeogenesis ERT1-1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERT1-1 PE=3 SV=1 | 56 | 152 | 2.0E-09 |
| sp|Q6BY37|ERT1_DEBHA | Transcription activator of gluconeogenesis ERT1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERT1 PE=3 SV=2 | 58 | 147 | 3.0E-09 |
| sp|B2W978|ACUK_PYRTR | Transcription activator of gluconeogenesis PTRG_06536 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_06536 PE=3 SV=1 | 39 | 153 | 6.0E-09 |
| sp|C7YM38|ACUK_NECH7 | Transcription activator of gluconeogenesis NECHADRAFT_59099 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_59099 PE=3 SV=1 | 50 | 153 | 6.0E-09 |
| sp|A7EAG1|ACUK_SCLS1 | Transcription activator of gluconeogenesis SS1G_02293 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_02293 PE=3 SV=1 | 58 | 153 | 7.0E-09 |
| sp|Q4PD88|ERT1_USTMA | Transcription activator of gluconeogenesis ERT1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERT1 PE=3 SV=2 | 59 | 160 | 1.0E-08 |
| sp|D8Q8R5|ERT1_SCHCM | Transcription activator of gluconeogenesis ERT1 OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=ERT1 PE=3 SV=1 | 59 | 160 | 1.0E-08 |
| sp|A3LQV7|ERT1_PICST | Transcription activator of gluconeogenesis ERT1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ERT1 PE=3 SV=2 | 54 | 147 | 1.0E-08 |
| sp|B2AR36|ACUK_PODAN | Transcription activator of gluconeogenesis PODANS_4_8760 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_4_8760 PE=3 SV=1 | 58 | 160 | 1.0E-08 |
| sp|B6Q3B6|ACUK_TALMQ | Transcription activator of gluconeogenesis PMAA_028970 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_028970 PE=3 SV=1 | 37 | 153 | 2.0E-08 |
| sp|Q0U7C8|ACUK_PHANO | Transcription activator of gluconeogenesis SNOG_12336 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_12336 PE=3 SV=2 | 37 | 153 | 3.0E-08 |
| sp|C4JFE4|ACUK_UNCRE | Transcription activator of gluconeogenesis UREG_00958 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_00958 PE=3 SV=2 | 41 | 153 | 8.0E-08 |
| sp|Q6CKI5|ERT1_KLULA | Transcription activator of gluconeogenesis ERT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERT1 PE=3 SV=1 | 60 | 152 | 1.0E-07 |
| sp|A6SP81|ACUK_BOTFB | Transcription activator of gluconeogenesis BC1G_14637 OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_14637 PE=3 SV=1 | 58 | 152 | 2.0E-07 |
| sp|C5JT39|ACUK_AJEDS | Transcription activator of gluconeogenesis BDBG_05438 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_05438 PE=3 SV=1 | 42 | 153 | 2.0E-07 |
| sp|C5GF27|ACUK_AJEDR | Transcription activator of gluconeogenesis BDCG_02812 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_02812 PE=3 SV=1 | 42 | 153 | 2.0E-07 |
| sp|C0NCM1|ACUK_AJECG | Transcription activator of gluconeogenesis HCBG_00867 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_00867 PE=3 SV=1 | 42 | 153 | 2.0E-07 |
| sp|A6R213|ACUK_AJECN | Transcription activator of gluconeogenesis HCAG_03671 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_03671 PE=3 SV=1 | 42 | 153 | 2.0E-07 |
| sp|C1G966|ACUK_PARBD | Transcription activator of gluconeogenesis PADG_03802 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_03802 PE=3 SV=2 | 42 | 153 | 3.0E-07 |
| sp|C5PHH6|ACUK_COCP7 | Transcription activator of gluconeogenesis CPC735_053490 OS=Coccidioides posadasii (strain C735) GN=CPC735_053490 PE=3 SV=1 | 42 | 153 | 4.0E-07 |
| sp|B9W8A8|GSM1_CANDC | Glucose starvation modulator protein 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=GSM1 PE=3 SV=1 | 57 | 153 | 5.0E-07 |
| sp|E4UP58|ACUK_ARTGP | Transcription activator of gluconeogenesis MGYG_02011 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02011 PE=3 SV=1 | 59 | 153 | 7.0E-07 |
| sp|D4AL61|ACUK_ARTBC | Transcription activator of gluconeogenesis ARB_05058 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05058 PE=3 SV=1 | 59 | 153 | 7.0E-07 |
| sp|D4D2Y6|ACUK_TRIVH | Transcription activator of gluconeogenesis TRV_01442 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_01442 PE=3 SV=1 | 59 | 153 | 8.0E-07 |
| sp|C5FP02|ACUK_ARTOC | Transcription activator of gluconeogenesis MCYG_04674 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04674 PE=3 SV=1 | 59 | 153 | 8.0E-07 |
| sp|C4R1K8|ERT1_PICPG | Transcription activator of gluconeogenesis ERT1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ERT1 PE=3 SV=1 | 58 | 160 | 1.0E-06 |
| sp|C4YDV1|GSM1_CANAW | Glucose starvation modulator protein 1 OS=Candida albicans (strain WO-1) GN=GSM1 PE=3 SV=1 | 57 | 153 | 1.0E-06 |
| sp|Q59WB9|GSM1_CANAL | Glucose starvation modulator protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ZCF23 PE=3 SV=1 | 57 | 153 | 1.0E-06 |
| sp|Q6FML7|ERT1_CANGA | Transcription activator of gluconeogenesis ERT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERT1 PE=3 SV=1 | 58 | 162 | 1.0E-06 |
| sp|B8LT44|ACUK_TALSN | Transcription activator of gluconeogenesis TSTA_069700 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_069700 PE=3 SV=1 | 37 | 152 | 3.0E-06 |
| sp|C1GR85|ACUK_PARBA | Transcription activator of gluconeogenesis PAAG_01030 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_01030 PE=3 SV=2 | 42 | 152 | 7.0E-06 |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Nucleus | Nuclear localization signal | 0.4475 | 0.6 | 0.0381 | 0.3638 | 0.1214 | 0.0066 | 0.3942 | 0.1131 | 0.0811 | 0.0003 |
| Orthofinder run ID | 4 |
| Orthogroup | 6069 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|2447 MPPPPSSSKGGDGSKAARSASDKTREYYLQAADPSGNDNAEERMARVLRAKYEAGLLKPFNYINGYARLGKYLDG HIAASSKQKILRTINQFRPKFREKAQGLTDMQLVYVEMWFEKQLMDYDRVFASMAVPACCWRRTGEIFRGNKEMA ELINVPVDQLRD* |
| Coding | >Hirsu2|2447 ATGCCGCCGCCGCCGTCGTCGTCCAAGGGCGGCGACGGCTCCAAGGCGGCCCGCTCGGCGTCGGACAAGACGCGC GAGTACTACCTGCAGGCGGCGGACCCGTCGGGCAACGACAATGCCGAGGAGCGCATGGCGCGCGTGCTGCGGGCC AAGTACGAGGCCGGCCTGCTCAAGCCCTTCAACTACATCAACGGCTACGCCCGGCTGGGCAAGTACCTCGATGGC CACATCGCCGCCTCGTCTAAGCAGAAGATTCTGCGGACCATCAACCAGTTCCGGCCCAAGTTCCGCGAGAAGGCC CAGGGCCTGACGGACATGCAGCTCGTCTACGTCGAGATGTGGTTCGAGAAGCAGCTGATGGACTACGACCGCGTC TTCGCCAGCATGGCCGTCCCGGCCTGCTGCTGGCGGAGGACGGGCGAGATCTTCCGCGGCAACAAGGAGATGGCC GAGCTCATCAACGTGCCCGTCGACCAGCTGCGGGATTAG |
| Transcript | >Hirsu2|2447 ATGCCGCCGCCGCCGTCGTCGTCCAAGGGCGGCGACGGCTCCAAGGCGGCCCGCTCGGCGTCGGACAAGACGCGC GAGTACTACCTGCAGGCGGCGGACCCGTCGGGCAACGACAATGCCGAGGAGCGCATGGCGCGCGTGCTGCGGGCC AAGTACGAGGCCGGCCTGCTCAAGCCCTTCAACTACATCAACGGCTACGCCCGGCTGGGCAAGTACCTCGATGGC CACATCGCCGCCTCGTCTAAGCAGAAGATTCTGCGGACCATCAACCAGTTCCGGCCCAAGTTCCGCGAGAAGGCC CAGGGCCTGACGGACATGCAGCTCGTCTACGTCGAGATGTGGTTCGAGAAGCAGCTGATGGACTACGACCGCGTC TTCGCCAGCATGGCCGTCCCGGCCTGCTGCTGGCGGAGGACGGGCGAGATCTTCCGCGGCAACAAGGAGATGGCC GAGCTCATCAACGTGCCCGTCGACCAGCTGCGGGATTAG |
| Gene | >Hirsu2|2447 ATGCCGCCGCCGCCGTCGTCGTCCAAGGGCGGCGACGGCTCCAAGGCGGCCCGCTCGGCGTCGGACAAGACGCGC GAGTACTACCTGCAGGCGGCGGACCCGTCGGGCAACGACAATGCCGAGGAGCGCATGGCGCGCGTGCTGCGGGCC AAGTACGAGGCCGGCCTGCTCAAGCCCTTCAACTACATCAACGGCTACGCCCGGCTGGGCAAGTACCTCGATGGC CACATCGCCGCCTCGTCTAAGCAGAAGATTCTGCGGACCATCAACCAGTTCCGGCCCAAGTTCCGCGAGAAGGCC CAGGGCCTGACGGACATGCAGCTCGTCTACGTCGAGATGTGGTTCGAGAAGCAGCTGATGGACTACGACCGCGTC TTCGCCAGCATGGCCGTCCCGGCCTGCTGCTGGCGGAGGACGGGCGAGATCTTCCGCGGCAACAAGGAGATGGCC GAGCTCATCAACGTGCCCGTCGACCAGCTGCGGGATGTGAGTCTTTTTTTTTGTCTCGCTCTTCCTCCCTTCTGT CTCCCAGTAG |