Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2436
Gene name
LocationContig_1581:4266..5751
Strand-
Gene length (bp)1485
Transcript length (bp)1485
Coding sequence length (bp)1485
Protein length (aa) 495

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.2E-13 6 145
PF08386 Abhydrolase_4 TAP-like protein 1.6E-13 357 444

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34211|YUAR_ECOLI Putative hydrolase YuaR OS=Escherichia coli (strain K12) GN=yuaR PE=3 SV=3 18 441 4.0E-17
sp|P65822|Y2247_MYCBO Putative hydrolase Mb2247c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2247c PE=3 SV=1 18 437 9.0E-17
sp|P9WHR5|CAEB_MYCTU Carboxylesterase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeB PE=1 SV=1 18 437 9.0E-17
sp|P9WHR4|CAEB_MYCTO Carboxylesterase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=caeB PE=3 SV=1 18 437 9.0E-17
sp|P65824|Y2248_MYCBO Putative hydrolase Mb2248c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2248c PE=3 SV=1 17 437 1.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34211|YUAR_ECOLI Putative hydrolase YuaR OS=Escherichia coli (strain K12) GN=yuaR PE=3 SV=3 18 441 4.0E-17
sp|P65822|Y2247_MYCBO Putative hydrolase Mb2247c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2247c PE=3 SV=1 18 437 9.0E-17
sp|P9WHR5|CAEB_MYCTU Carboxylesterase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeB PE=1 SV=1 18 437 9.0E-17
sp|P9WHR4|CAEB_MYCTO Carboxylesterase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=caeB PE=3 SV=1 18 437 9.0E-17
sp|P65824|Y2248_MYCBO Putative hydrolase Mb2248c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2248c PE=3 SV=1 17 437 1.0E-13
sp|P9WHR3|CAEA_MYCTU Carboxylesterase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeA PE=1 SV=1 17 437 1.0E-13
sp|P9WHR2|CAEA_MYCTO Carboxylesterase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=caeA PE=3 SV=1 17 437 1.0E-13
sp|Q9FCD7|TAP_STRCO Tripeptidyl aminopeptidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tap PE=3 SV=1 18 450 2.0E-11
sp|Q54410|TAP_STRLI Tripeptidyl aminopeptidase OS=Streptomyces lividans GN=tap PE=1 SV=1 18 450 3.0E-11
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2285 0.1166 0.7312 0.069 0.2601 0.0624 0.2023 0.2269 0.1753 0.1662

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7520
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|2436 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2436
MAWRSAEAVSRRLSGGRYDVLGWDPRGVNASLPAVSCFPYDADRDHWSLKTTEYRAVSPSPPAQLAFADAMSDAT
FEACRRLWGDVGRFVSTAFVARDLERIRLALGEDELTGYLVSYGTGIGQTYANMFPRSVGRLVLDGTEYVRDHRL
LGGFGWTALDNVTDAWHDGFLGECVAAGPEHCALARPRPPTVDGAAEDKGEDEVEVEVEALERRMERLMASLVER
PVPGYTREAGPSLVTYSALVQAIYGALYNARSWPALARMLAELEAGNSTLAAAMLERAAWEYDPARPAPLKNRPS
SDELGQLVICADAYDAPEPPGGLRWWDALWRNMTAQSWIAGDSRFYTVLPCRRFARYWPRPAEVYRGDLNHTLRH
PVLLIAETYDPATPLRNGRRLLAEMGRNARLIAHHGYGHSSRDTSRCTDGLAKAFILHGALPDDQETACYADEKP
YRYGLGKHAALSDRSADPVELWRQHLAELAVLNPTLLPRRRRLL*
Coding >Hirsu2|2436
ATGGCCTGGCGGTCGGCCGAGGCCGTCAGCCGGCGCCTCAGCGGCGGGCGGTACGACGTGCTGGGCTGGGACCCG
CGCGGCGTCAACGCGTCGCTGCCGGCCGTCTCGTGCTTCCCCTACGACGCCGACCGCGACCACTGGAGCCTCAAG
ACGACCGAGTACCGGGCCGTGTCGCCGTCGCCGCCGGCGCAGCTGGCCTTCGCCGACGCCATGAGCGACGCCACC
TTCGAGGCCTGCCGCCGCCTCTGGGGCGACGTCGGCCGCTTCGTCTCGACCGCCTTCGTGGCCCGCGACCTGGAG
CGGATCCGGCTGGCGCTCGGCGAGGACGAGCTGACGGGCTACCTCGTCAGCTACGGCACCGGCATCGGCCAGACC
TACGCCAACATGTTCCCGCGCAGCGTCGGCCGCCTGGTCCTCGACGGCACCGAGTACGTGCGCGACCACCGCCTG
CTCGGCGGCTTCGGCTGGACCGCCCTCGACAACGTCACCGACGCCTGGCACGACGGCTTCCTGGGCGAGTGCGTC
GCCGCCGGACCGGAGCACTGCGCCCTGGCGCGCCCGCGGCCGCCGACGGTCGACGGCGCCGCCGAGGACAAGGGG
GAGGACGAGGTCGAGGTCGAAGTCGAGGCGCTGGAGCGGCGCATGGAGCGCCTCATGGCCTCGCTCGTCGAGCGG
CCGGTGCCCGGCTACACCAGGGAGGCGGGCCCGTCGCTCGTCACCTACTCGGCCCTGGTGCAGGCCATCTACGGC
GCGCTGTACAACGCCCGGTCGTGGCCGGCGCTGGCCCGCATGCTGGCCGAGCTCGAGGCCGGCAACTCGACGCTG
GCGGCGGCCATGCTGGAGCGGGCGGCGTGGGAGTACGACCCGGCCCGGCCGGCGCCGCTCAAGAACCGGCCGAGC
TCGGACGAGCTGGGCCAGCTGGTCATCTGCGCCGACGCCTACGACGCGCCCGAGCCGCCCGGCGGCCTGCGCTGG
TGGGACGCGCTGTGGCGCAACATGACGGCCCAGTCGTGGATCGCCGGCGACTCGCGCTTCTACACCGTCCTGCCC
TGCCGCCGCTTCGCCCGCTACTGGCCCCGGCCGGCCGAGGTCTACCGCGGCGACCTCAACCACACGCTGCGGCAC
CCGGTCCTGCTCATCGCCGAGACCTACGACCCGGCCACGCCGCTGCGCAACGGCCGCCGCCTGCTCGCCGAGATG
GGCCGCAACGCCCGCCTCATCGCCCACCACGGCTACGGCCACTCCTCGCGTGACACCTCCCGCTGCACCGACGGC
CTCGCCAAGGCCTTCATCCTGCACGGCGCCCTCCCCGACGACCAGGAGACGGCCTGCTACGCCGACGAGAAGCCG
TACCGGTACGGCCTCGGCAAGCACGCCGCCCTCTCCGACCGCTCCGCAGACCCCGTCGAGCTTTGGCGCCAGCAT
CTCGCCGAGCTGGCCGTGTTGAATCCGACTCTGCTCCCGCGCAGGAGACGACTTCTGTAG
Transcript >Hirsu2|2436
ATGGCCTGGCGGTCGGCCGAGGCCGTCAGCCGGCGCCTCAGCGGCGGGCGGTACGACGTGCTGGGCTGGGACCCG
CGCGGCGTCAACGCGTCGCTGCCGGCCGTCTCGTGCTTCCCCTACGACGCCGACCGCGACCACTGGAGCCTCAAG
ACGACCGAGTACCGGGCCGTGTCGCCGTCGCCGCCGGCGCAGCTGGCCTTCGCCGACGCCATGAGCGACGCCACC
TTCGAGGCCTGCCGCCGCCTCTGGGGCGACGTCGGCCGCTTCGTCTCGACCGCCTTCGTGGCCCGCGACCTGGAG
CGGATCCGGCTGGCGCTCGGCGAGGACGAGCTGACGGGCTACCTCGTCAGCTACGGCACCGGCATCGGCCAGACC
TACGCCAACATGTTCCCGCGCAGCGTCGGCCGCCTGGTCCTCGACGGCACCGAGTACGTGCGCGACCACCGCCTG
CTCGGCGGCTTCGGCTGGACCGCCCTCGACAACGTCACCGACGCCTGGCACGACGGCTTCCTGGGCGAGTGCGTC
GCCGCCGGACCGGAGCACTGCGCCCTGGCGCGCCCGCGGCCGCCGACGGTCGACGGCGCCGCCGAGGACAAGGGG
GAGGACGAGGTCGAGGTCGAAGTCGAGGCGCTGGAGCGGCGCATGGAGCGCCTCATGGCCTCGCTCGTCGAGCGG
CCGGTGCCCGGCTACACCAGGGAGGCGGGCCCGTCGCTCGTCACCTACTCGGCCCTGGTGCAGGCCATCTACGGC
GCGCTGTACAACGCCCGGTCGTGGCCGGCGCTGGCCCGCATGCTGGCCGAGCTCGAGGCCGGCAACTCGACGCTG
GCGGCGGCCATGCTGGAGCGGGCGGCGTGGGAGTACGACCCGGCCCGGCCGGCGCCGCTCAAGAACCGGCCGAGC
TCGGACGAGCTGGGCCAGCTGGTCATCTGCGCCGACGCCTACGACGCGCCCGAGCCGCCCGGCGGCCTGCGCTGG
TGGGACGCGCTGTGGCGCAACATGACGGCCCAGTCGTGGATCGCCGGCGACTCGCGCTTCTACACCGTCCTGCCC
TGCCGCCGCTTCGCCCGCTACTGGCCCCGGCCGGCCGAGGTCTACCGCGGCGACCTCAACCACACGCTGCGGCAC
CCGGTCCTGCTCATCGCCGAGACCTACGACCCGGCCACGCCGCTGCGCAACGGCCGCCGCCTGCTCGCCGAGATG
GGCCGCAACGCCCGCCTCATCGCCCACCACGGCTACGGCCACTCCTCGCGTGACACCTCCCGCTGCACCGACGGC
CTCGCCAAGGCCTTCATCCTGCACGGCGCCCTCCCCGACGACCAGGAGACGGCCTGCTACGCCGACGAGAAGCCG
TACCGGTACGGCCTCGGCAAGCACGCCGCCCTCTCCGACCGCTCCGCAGACCCCGTCGAGCTTTGGCGCCAGCAT
CTCGCCGAGCTGGCCGTGTTGAATCCGACTCTGCTCCCGCGCAGGAGACGACTTCTGTAG
Gene >Hirsu2|2436
ATGGCCTGGCGGTCGGCCGAGGCCGTCAGCCGGCGCCTCAGCGGCGGGCGGTACGACGTGCTGGGCTGGGACCCG
CGCGGCGTCAACGCGTCGCTGCCGGCCGTCTCGTGCTTCCCCTACGACGCCGACCGCGACCACTGGAGCCTCAAG
ACGACCGAGTACCGGGCCGTGTCGCCGTCGCCGCCGGCGCAGCTGGCCTTCGCCGACGCCATGAGCGACGCCACC
TTCGAGGCCTGCCGCCGCCTCTGGGGCGACGTCGGCCGCTTCGTCTCGACCGCCTTCGTGGCCCGCGACCTGGAG
CGGATCCGGCTGGCGCTCGGCGAGGACGAGCTGACGGGCTACCTCGTCAGCTACGGCACCGGCATCGGCCAGACC
TACGCCAACATGTTCCCGCGCAGCGTCGGCCGCCTGGTCCTCGACGGCACCGAGTACGTGCGCGACCACCGCCTG
CTCGGCGGCTTCGGCTGGACCGCCCTCGACAACGTCACCGACGCCTGGCACGACGGCTTCCTGGGCGAGTGCGTC
GCCGCCGGACCGGAGCACTGCGCCCTGGCGCGCCCGCGGCCGCCGACGGTCGACGGCGCCGCCGAGGACAAGGGG
GAGGACGAGGTCGAGGTCGAAGTCGAGGCGCTGGAGCGGCGCATGGAGCGCCTCATGGCCTCGCTCGTCGAGCGG
CCGGTGCCCGGCTACACCAGGGAGGCGGGCCCGTCGCTCGTCACCTACTCGGCCCTGGTGCAGGCCATCTACGGC
GCGCTGTACAACGCCCGGTCGTGGCCGGCGCTGGCCCGCATGCTGGCCGAGCTCGAGGCCGGCAACTCGACGCTG
GCGGCGGCCATGCTGGAGCGGGCGGCGTGGGAGTACGACCCGGCCCGGCCGGCGCCGCTCAAGAACCGGCCGAGC
TCGGACGAGCTGGGCCAGCTGGTCATCTGCGCCGACGCCTACGACGCGCCCGAGCCGCCCGGCGGCCTGCGCTGG
TGGGACGCGCTGTGGCGCAACATGACGGCCCAGTCGTGGATCGCCGGCGACTCGCGCTTCTACACCGTCCTGCCC
TGCCGCCGCTTCGCCCGCTACTGGCCCCGGCCGGCCGAGGTCTACCGCGGCGACCTCAACCACACGCTGCGGCAC
CCGGTCCTGCTCATCGCCGAGACCTACGACCCGGCCACGCCGCTGCGCAACGGCCGCCGCCTGCTCGCCGAGATG
GGCCGCAACGCCCGCCTCATCGCCCACCACGGCTACGGCCACTCCTCGCGTGACACCTCCCGCTGCACCGACGGC
CTCGCCAAGGCCTTCATCCTGCACGGCGCCCTCCCCGACGACCAGGAGACGGCCTGCTACGCCGACGAGAAGCCG
TACCGGTACGGCCTCGGCAAGCACGCCGCCCTCTCCGACCGCTCCGCAGACCCCGTCGAGCTTTGGCGCCAGCAT
CTCGCCGAGCTGGCCGTGTTGAATCCGACTCTGCTCCCGCGCAGGAGACGACTTCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail