Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|243
Gene name
LocationContig_1043:4596..5022
Strand-
Gene length (bp)426
Transcript length (bp)426
Coding sequence length (bp)426
Protein length (aa) 142

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6369 0.4452 0.3072 0.1472 0.3946 0.0959 0.2024 0.2292 0.3256 0.0802

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup9061
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|243 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|243
MSSCTGAERCNASDGPASASPPVALASHLCHELCFSKARALACQDRGRPWAAIVDMTTLLDPCFGPPSPRPFPRV
PNNTWLFITGFISFPPNHSLPDLRWERRGPVPAEGRTLADDPSSDDGPQNGNKAVPGRGPPERAAD*
Coding >Hirsu2|243
ATGTCCAGCTGCACCGGTGCGGAGCGCTGCAACGCTTCGGACGGCCCAGCATCAGCATCTCCACCCGTGGCCCTG
GCATCCCATCTCTGCCACGAGCTTTGCTTCTCGAAGGCACGAGCTCTCGCTTGCCAGGACCGAGGTCGGCCGTGG
GCGGCCATCGTCGACATGACCACGCTCCTCGACCCCTGCTTTGGGCCGCCCTCACCACGTCCTTTTCCACGCGTT
CCCAACAACACATGGTTATTCATCACCGGATTCATCTCTTTCCCGCCGAACCACTCTTTGCCTGACCTCCGATGG
GAACGACGGGGCCCAGTTCCCGCTGAGGGGCGGACCTTGGCTGACGATCCTTCTTCCGACGACGGGCCGCAGAAC
GGAAACAAGGCTGTCCCTGGTCGTGGTCCGCCGGAACGAGCCGCCGACTAG
Transcript >Hirsu2|243
ATGTCCAGCTGCACCGGTGCGGAGCGCTGCAACGCTTCGGACGGCCCAGCATCAGCATCTCCACCCGTGGCCCTG
GCATCCCATCTCTGCCACGAGCTTTGCTTCTCGAAGGCACGAGCTCTCGCTTGCCAGGACCGAGGTCGGCCGTGG
GCGGCCATCGTCGACATGACCACGCTCCTCGACCCCTGCTTTGGGCCGCCCTCACCACGTCCTTTTCCACGCGTT
CCCAACAACACATGGTTATTCATCACCGGATTCATCTCTTTCCCGCCGAACCACTCTTTGCCTGACCTCCGATGG
GAACGACGGGGCCCAGTTCCCGCTGAGGGGCGGACCTTGGCTGACGATCCTTCTTCCGACGACGGGCCGCAGAAC
GGAAACAAGGCTGTCCCTGGTCGTGGTCCGCCGGAACGAGCCGCCGACTAG
Gene >Hirsu2|243
ATGTCCAGCTGCACCGGTGCGGAGCGCTGCAACGCTTCGGACGGCCCAGCATCAGCATCTCCACCCGTGGCCCTG
GCATCCCATCTCTGCCACGAGCTTTGCTTCTCGAAGGCACGAGCTCTCGCTTGCCAGGACCGAGGTCGGCCGTGG
GCGGCCATCGTCGACATGACCACGCTCCTCGACCCCTGCTTTGGGCCGCCCTCACCACGTCCTTTTCCACGCGTT
CCCAACAACACATGGTTATTCATCACCGGATTCATCTCTTTCCCGCCGAACCACTCTTTGCCTGACCTCCGATGG
GAACGACGGGGCCCAGTTCCCGCTGAGGGGCGGACCTTGGCTGACGATCCTTCTTCCGACGACGGGCCGCAGAAC
GGAAACAAGGCTGTCCCTGGTCGTGGTCCGCCGGAACGAGCCGCCGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail