Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2429
Gene name
LocationContig_158:22552..24402
Strand-
Gene length (bp)1850
Transcript length (bp)1569
Coding sequence length (bp)1569
Protein length (aa) 523

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 9.6E-14 68 397
PF07690 MFS_1 Major Facilitator Superfamily 4.8E-09 383 515
PF00083 Sugar_tr Sugar (and other) transporter 1.8E-18 102 516

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 11 522 2.0E-179
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 27 522 9.0E-29
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 11 519 2.0E-24
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 26 519 2.0E-24
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 11 519 3.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 11 522 2.0E-179
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 27 522 9.0E-29
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 11 519 2.0E-24
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 26 519 2.0E-24
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 11 519 3.0E-24
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 26 519 4.0E-24
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 26 519 2.0E-22
sp|Q940M4|OCT7_ARATH Organic cation/carnitine transporter 7 OS=Arabidopsis thaliana GN=OCT7 PE=2 SV=1 50 520 6.0E-22
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 26 519 1.0E-21
sp|Q9WTN6|S22AL_MOUSE Solute carrier family 22 member 21 OS=Mus musculus GN=Slc22a21 PE=2 SV=1 99 518 3.0E-14
sp|O77504|S22A1_RABIT Solute carrier family 22 member 1 OS=Oryctolagus cuniculus GN=SLC22A1 PE=1 SV=1 102 518 4.0E-14
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 110 519 6.0E-14
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 44 281 7.0E-14
sp|Q9Z0E8|S22A5_MOUSE Solute carrier family 22 member 5 OS=Mus musculus GN=Slc22a5 PE=1 SV=1 99 518 1.0E-13
sp|Q4U2R8|S22A6_HUMAN Solute carrier family 22 member 6 OS=Homo sapiens GN=SLC22A6 PE=1 SV=1 73 519 3.0E-13
sp|O70594|S22A5_RAT Solute carrier family 22 member 5 OS=Rattus norvegicus GN=Slc22a5 PE=1 SV=1 99 518 3.0E-13
sp|O35956|S22A6_RAT Solute carrier family 22 member 6 OS=Rattus norvegicus GN=Slc22a6 PE=1 SV=1 105 519 4.0E-13
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 44 281 6.0E-13
sp|Q5RCH6|S22A6_PONAB Solute carrier family 22 member 6 OS=Pongo abelii GN=SLC22A6 PE=2 SV=1 73 519 1.0E-12
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 44 281 1.0E-12
sp|Q8MJI6|S22A2_RABIT Solute carrier family 22 member 2 OS=Oryctolagus cuniculus GN=SLC22A2 PE=1 SV=1 102 519 1.0E-12
sp|Q4W8A3|S22A6_MACFA Solute carrier family 22 member 6 OS=Macaca fascicularis GN=SLC22A6 PE=1 SV=1 73 519 2.0E-12
sp|O76082|S22A5_HUMAN Solute carrier family 22 member 5 OS=Homo sapiens GN=SLC22A5 PE=1 SV=1 109 518 4.0E-12
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 63 483 1.0E-11
sp|O02713|S22A2_PIG Solute carrier family 22 member 2 OS=Sus scrofa GN=SLC22A2 PE=2 SV=1 102 519 1.0E-11
sp|Q8VC69|S22A6_MOUSE Solute carrier family 22 member 6 OS=Mus musculus GN=Slc22a6 PE=1 SV=1 105 519 1.0E-11
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 91 519 2.0E-11
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 44 281 2.0E-11
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 44 281 2.0E-11
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 44 281 2.0E-11
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 44 281 2.0E-11
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 44 281 2.0E-11
sp|Q66J54|S226A_XENLA Solute carrier family 22 member 6-A OS=Xenopus laevis GN=slc22a6-a PE=2 SV=1 105 513 3.0E-11
sp|Q864Z3|S22A6_BOVIN Solute carrier family 22 member 6 OS=Bos taurus GN=SLC22A6 PE=2 SV=2 73 519 3.0E-11
sp|Q63089|S22A1_RAT Solute carrier family 22 member 1 OS=Rattus norvegicus GN=Slc22a1 PE=1 SV=1 102 518 6.0E-11
sp|Q3YAW7|S22A7_RABIT Solute carrier family 22 member 7 OS=Oryctolagus cuniculus GN=SLC22A7 PE=2 SV=1 109 519 6.0E-11
sp|A7MBE0|S22A1_BOVIN Solute carrier family 22 member 1 OS=Bos taurus GN=SLC22A1 PE=2 SV=1 102 518 7.0E-11
sp|O15245|S22A1_HUMAN Solute carrier family 22 member 1 OS=Homo sapiens GN=SLC22A1 PE=1 SV=2 102 518 9.0E-11
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 44 281 1.0E-10
sp|Q7ZX53|S22FL_XENLA Solute carrier family 22 member 15-like OS=Xenopus laevis GN=slc22a15b PE=2 SV=1 110 519 1.0E-10
sp|Q9TSY7|S22A6_RABIT Solute carrier family 22 member 6 OS=Oryctolagus cuniculus GN=SLC22A6 PE=2 SV=1 73 519 1.0E-10
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 109 519 2.0E-10
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 104 503 3.0E-10
sp|Q6PDF3|SVOPL_MOUSE Putative transporter SVOPL OS=Mus musculus GN=Svopl PE=2 SV=1 44 519 4.0E-10
sp|Q80UJ1|S22AK_MOUSE Solute carrier family 22 member 20 OS=Mus musculus GN=Slc22a20 PE=1 SV=1 102 517 5.0E-10
sp|Q1LVS8|SVOPL_DANRE Putative transporter SVOPL OS=Danio rerio GN=svopl PE=2 SV=1 42 522 8.0E-10
sp|Q8MK48|S22A6_PIG Solute carrier family 22 member 6 OS=Sus scrofa GN=SLC22A6 PE=1 SV=2 98 519 9.0E-10
sp|Q8IZD6|S22AF_HUMAN Solute carrier family 22 member 15 OS=Homo sapiens GN=SLC22A15 PE=2 SV=1 230 500 1.0E-09
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 40 480 1.0E-09
sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 44 298 1.0E-09
sp|O08966|S22A1_MOUSE Solute carrier family 22 member 1 OS=Mus musculus GN=Slc22a1 PE=1 SV=2 102 518 2.0E-09
sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 44 298 2.0E-09
sp|Q8N434|SVOPL_HUMAN Putative transporter SVOPL OS=Homo sapiens GN=SVOPL PE=2 SV=2 37 519 3.0E-09
sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=1 SV=1 44 298 4.0E-09
sp|Q9WTW5|S22A3_MOUSE Solute carrier family 22 member 3 OS=Mus musculus GN=Slc22a3 PE=2 SV=1 108 518 4.0E-09
sp|A6QLW8|S22A7_BOVIN Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1 110 501 6.0E-09
sp|Q5R540|S22A7_PONAB Solute carrier family 22 member 7 OS=Pongo abelii GN=SLC22A7 PE=2 SV=1 110 501 6.0E-09
sp|Q1RPP5|S22A7_PIG Solute carrier family 22 member 7 OS=Sus scrofa GN=SLC22A7 PE=2 SV=1 110 501 7.0E-09
sp|O88446|S22A3_RAT Solute carrier family 22 member 3 OS=Rattus norvegicus GN=Slc22a3 PE=2 SV=1 108 518 8.0E-09
sp|Q9Y694|S22A7_HUMAN Solute carrier family 22 member 7 OS=Homo sapiens GN=SLC22A7 PE=1 SV=1 110 501 9.0E-09
sp|Q17QN9|S22AG_BOVIN Solute carrier family 22 member 16 OS=Bos taurus GN=SLC22A16 PE=2 SV=2 230 513 1.0E-08
sp|O70577|S22A2_MOUSE Solute carrier family 22 member 2 OS=Mus musculus GN=Slc22a2 PE=1 SV=1 102 299 2.0E-08
sp|Q66J52|S226B_XENLA Solute carrier family 22 member 6-B OS=Xenopus laevis GN=slc22a6-b PE=2 SV=1 105 513 2.0E-08
sp|Q8CFZ5|S22AC_MOUSE Solute carrier family 22 member 12 OS=Mus musculus GN=Slc22a12 PE=1 SV=1 105 513 3.0E-08
sp|Q9H015|S22A4_HUMAN Solute carrier family 22 member 4 OS=Homo sapiens GN=SLC22A4 PE=1 SV=3 254 518 4.0E-08
sp|Q9R141|S22A4_RAT Solute carrier family 22 member 4 OS=Rattus norvegicus GN=Slc22a4 PE=1 SV=1 99 518 4.0E-08
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 108 518 4.0E-08
sp|Q504N2|S22AF_MOUSE Solute carrier family 22 member 15 OS=Mus musculus GN=Slc22a15 PE=2 SV=3 230 500 5.0E-08
sp|Q66KG0|S22AG_XENLA Solute carrier family 22 member 16 OS=Xenopus laevis GN=slc22a16 PE=2 SV=2 256 513 6.0E-08
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 48 520 6.0E-08
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 48 520 1.0E-07
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 112 519 1.0E-07
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 109 500 1.0E-07
sp|Q9R0W2|S22A2_RAT Solute carrier family 22 member 2 OS=Rattus norvegicus GN=Slc22a2 PE=1 SV=1 102 483 2.0E-07
sp|Q5R5H7|S22A2_PONAB Solute carrier family 22 member 2 OS=Pongo abelii GN=SLC22A2 PE=2 SV=1 102 483 2.0E-07
sp|A6NK97|S22AK_HUMAN Solute carrier family 22 member 20 OS=Homo sapiens GN=SLC22A20 PE=2 SV=1 102 512 3.0E-07
sp|A9CB25|S22A4_PAPAN Solute carrier family 22 member 4 OS=Papio anubis GN=SLC22A4 PE=3 SV=1 254 518 4.0E-07
sp|Q5RLM2|S22A7_RAT Solute carrier family 22 member 7 OS=Rattus norvegicus GN=Slc22a7 PE=1 SV=1 109 519 6.0E-07
sp|P46499|YLX3_CAEEL Uncharacterized protein F23F12.3 OS=Caenorhabditis elegans GN=F23F12.3/F23F12.1 PE=3 SV=4 107 520 6.0E-07
sp|Q95R48|OCTL_DROME Organic cation transporter-like protein OS=Drosophila melanogaster GN=Orct2 PE=2 SV=2 109 522 7.0E-07
sp|Q6NUB3|S22AF_XENLA Solute carrier family 22 member 15 OS=Xenopus laevis GN=slc22a15 PE=2 SV=2 254 513 8.0E-07
sp|O75751|S22A3_HUMAN Solute carrier family 22 member 3 OS=Homo sapiens GN=SLC22A3 PE=1 SV=1 108 518 8.0E-07
sp|Q3ZAV1|S22AC_RAT Solute carrier family 22 member 12 OS=Rattus norvegicus GN=Slc22a12 PE=2 SV=1 102 302 9.0E-07
sp|Q70BM6|S22A8_PIG Solute carrier family 22 member 8 OS=Sus scrofa GN=SLC22A8 PE=2 SV=1 98 513 1.0E-06
sp|Q86VW1|S22AG_HUMAN Solute carrier family 22 member 16 OS=Homo sapiens GN=SLC22A16 PE=1 SV=1 101 520 1.0E-06
sp|O88909|S22A8_MOUSE Solute carrier family 22 member 8 OS=Mus musculus GN=Slc22a8 PE=1 SV=2 213 512 2.0E-06
sp|Q5R9C4|S22A8_PONAB Solute carrier family 22 member 8 OS=Pongo abelii GN=SLC22A8 PE=2 SV=1 102 513 2.0E-06
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 60 479 4.0E-06
sp|Q9Z306|S22A4_MOUSE Solute carrier family 22 member 4 OS=Mus musculus GN=Slc22a4 PE=1 SV=1 99 518 5.0E-06
sp|Q863T6|S22A1_PIG Solute carrier family 22 member 1 OS=Sus scrofa GN=SLC22A1 PE=2 SV=1 230 518 6.0E-06
sp|Q8TCC7|S22A8_HUMAN Solute carrier family 22 member 8 OS=Homo sapiens GN=SLC22A8 PE=1 SV=1 102 513 6.0E-06
sp|Q28ES4|S22FL_XENTR Solute carrier family 22 member 15-like OS=Xenopus tropicalis GN=slc22a15b PE=2 SV=1 110 519 7.0E-06
sp|O15244|S22A2_HUMAN Solute carrier family 22 member 2 OS=Homo sapiens GN=SLC22A2 PE=1 SV=2 102 483 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 103 122 19
3 129 148 19
4 158 180 22
5 187 209 22
6 229 251 22
7 331 353 22
8 373 395 22
9 407 426 19
10 430 452 22
11 465 487 22
12 492 514 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2429
MGVDATVTDLEATSQREPCYSSSIDINEDDAGIIPKGALDPVYEAKARVLNRAIREIGMGWYQWQLFIVVGFGWA
SDNLWPIVTSLIFTPITNEFGPSRPPLFTLAQNIGLLAGAVFWGFGCDIFGRKWGFNLTLGLTAIWGLVAASAPN
FAAAGVFAALWSFGVGGNLPVDSAVFLEFLPQSHQFLLTILSIDWAFAQVVANLVAWPLLGNYTCAEGQKPCTKG
ANMGWRYFVLVMGGITLLMFLSRFVLFTIYESPKYLIGKGRDEEAVRVVHEVARRNGTTTNLTLDDLRACEPDGY
VAQTDASAAVRRYLEKLDAKHVRALFSTKTLALSTGIIMAIWALIGLGYPLYNAFLPYIQATRGAEFRDGSTYIT
YRNSLIISVLGVPGALLGGFLVELPRIGRKGTLSVFTILTGVFLYCSTTAANSTALLGWNCAFNFCSNVMYAVLY
GYTPEIFPTPQRGTGNALSATCNRVFGIMAPIIAMFANLQTSAPVYTSGALFIMAGILVFILPFESRGKEAL*
Coding >Hirsu2|2429
ATGGGCGTCGACGCGACCGTCACCGACCTCGAGGCGACATCCCAACGCGAGCCCTGCTACAGCAGCAGCATCGAC
ATTAATGAAGATGACGCCGGCATCATCCCCAAGGGTGCCCTTGACCCCGTCTACGAAGCGAAGGCCCGCGTCCTC
AATCGTGCTATACGGGAGATTGGAATGGGCTGGTATCAGTGGCAGCTCTTCATCGTCGTCGGCTTCGGCTGGGCC
AGCGATAATCTGTGGCCCATCGTCACCTCGCTCATCTTCACGCCCATCACCAACGAGTTCGGGCCCTCGCGCCCG
CCCCTCTTCACTCTGGCCCAGAATATCGGCCTCCTCGCCGGCGCCGTCTTTTGGGGCTTTGGCTGCGACATCTTC
GGCCGCAAATGGGGCTTCAATCTGACCCTCGGCCTCACCGCCATCTGGGGCCTGGTGGCCGCCAGCGCCCCCAAC
TTCGCCGCCGCCGGCGTCTTTGCCGCCTTGTGGTCCTTTGGTGTGGGCGGGAACCTGCCCGTCGACTCGGCCGTC
TTTCTCGAATTCTTGCCCCAGTCGCACCAGTTCCTCCTCACGATCTTGTCCATCGACTGGGCTTTCGCGCAGGTC
GTTGCCAACCTCGTCGCCTGGCCGCTCCTCGGCAATTACACCTGCGCTGAGGGTCAGAAACCGTGTACCAAGGGA
GCCAACATGGGCTGGCGCTACTTTGTCCTCGTCATGGGTGGCATCACCTTGCTCATGTTCCTCTCCCGCTTCGTC
CTCTTCACCATCTACGAGTCGCCCAAGTATCTGATTGGAAAGGGCCGCGACGAGGAGGCGGTGCGCGTCGTGCAC
GAGGTCGCCCGCCGCAACGGGACGACGACCAATCTGACGCTCGACGACCTCAGGGCCTGCGAGCCCGACGGCTAC
GTTGCTCAGACGGATGCCTCCGCCGCCGTCAGGAGGTACCTGGAGAAGCTCGACGCCAAGCACGTCCGCGCCCTC
TTCTCGACCAAGACGCTGGCCCTGAGCACGGGTATCATCATGGCCATATGGGCGCTCATCGGGCTGGGATACCCC
CTCTACAACGCCTTCTTGCCCTACATACAGGCCACGAGGGGCGCCGAGTTCAGAGACGGCAGCACTTACATAACC
TACCGCAACAGCCTCATCATCTCCGTCCTCGGCGTTCCGGGAGCCCTTCTCGGTGGCTTCCTGGTCGAACTCCCC
CGCATTGGTCGCAAAGGGACCCTGTCCGTCTTCACCATTCTCACAGGCGTCTTCCTGTACTGCTCCACCACCGCG
GCCAACAGCACTGCCCTCCTGGGCTGGAATTGCGCATTCAACTTCTGCAGCAACGTCATGTACGCTGTTCTTTAC
GGCTACACGCCCGAGATCTTTCCCACTCCCCAGCGCGGGACGGGCAACGCACTCTCCGCTACCTGCAACCGCGTA
TTTGGCATCATGGCCCCCATCATTGCCATGTTCGCCAACCTTCAAACCTCGGCCCCGGTCTATACTAGCGGCGCA
CTGTTCATCATGGCCGGCATACTCGTCTTCATACTTCCTTTTGAGTCGAGAGGGAAAGAGGCGTTGTGA
Transcript >Hirsu2|2429
ATGGGCGTCGACGCGACCGTCACCGACCTCGAGGCGACATCCCAACGCGAGCCCTGCTACAGCAGCAGCATCGAC
ATTAATGAAGATGACGCCGGCATCATCCCCAAGGGTGCCCTTGACCCCGTCTACGAAGCGAAGGCCCGCGTCCTC
AATCGTGCTATACGGGAGATTGGAATGGGCTGGTATCAGTGGCAGCTCTTCATCGTCGTCGGCTTCGGCTGGGCC
AGCGATAATCTGTGGCCCATCGTCACCTCGCTCATCTTCACGCCCATCACCAACGAGTTCGGGCCCTCGCGCCCG
CCCCTCTTCACTCTGGCCCAGAATATCGGCCTCCTCGCCGGCGCCGTCTTTTGGGGCTTTGGCTGCGACATCTTC
GGCCGCAAATGGGGCTTCAATCTGACCCTCGGCCTCACCGCCATCTGGGGCCTGGTGGCCGCCAGCGCCCCCAAC
TTCGCCGCCGCCGGCGTCTTTGCCGCCTTGTGGTCCTTTGGTGTGGGCGGGAACCTGCCCGTCGACTCGGCCGTC
TTTCTCGAATTCTTGCCCCAGTCGCACCAGTTCCTCCTCACGATCTTGTCCATCGACTGGGCTTTCGCGCAGGTC
GTTGCCAACCTCGTCGCCTGGCCGCTCCTCGGCAATTACACCTGCGCTGAGGGTCAGAAACCGTGTACCAAGGGA
GCCAACATGGGCTGGCGCTACTTTGTCCTCGTCATGGGTGGCATCACCTTGCTCATGTTCCTCTCCCGCTTCGTC
CTCTTCACCATCTACGAGTCGCCCAAGTATCTGATTGGAAAGGGCCGCGACGAGGAGGCGGTGCGCGTCGTGCAC
GAGGTCGCCCGCCGCAACGGGACGACGACCAATCTGACGCTCGACGACCTCAGGGCCTGCGAGCCCGACGGCTAC
GTTGCTCAGACGGATGCCTCCGCCGCCGTCAGGAGGTACCTGGAGAAGCTCGACGCCAAGCACGTCCGCGCCCTC
TTCTCGACCAAGACGCTGGCCCTGAGCACGGGTATCATCATGGCCATATGGGCGCTCATCGGGCTGGGATACCCC
CTCTACAACGCCTTCTTGCCCTACATACAGGCCACGAGGGGCGCCGAGTTCAGAGACGGCAGCACTTACATAACC
TACCGCAACAGCCTCATCATCTCCGTCCTCGGCGTTCCGGGAGCCCTTCTCGGTGGCTTCCTGGTCGAACTCCCC
CGCATTGGTCGCAAAGGGACCCTGTCCGTCTTCACCATTCTCACAGGCGTCTTCCTGTACTGCTCCACCACCGCG
GCCAACAGCACTGCCCTCCTGGGCTGGAATTGCGCATTCAACTTCTGCAGCAACGTCATGTACGCTGTTCTTTAC
GGCTACACGCCCGAGATCTTTCCCACTCCCCAGCGCGGGACGGGCAACGCACTCTCCGCTACCTGCAACCGCGTA
TTTGGCATCATGGCCCCCATCATTGCCATGTTCGCCAACCTTCAAACCTCGGCCCCGGTCTATACTAGCGGCGCA
CTGTTCATCATGGCCGGCATACTCGTCTTCATACTTCCTTTTGAGTCGAGAGGGAAAGAGGCGTTGTGA
Gene >Hirsu2|2429
ATGGGCGTCGACGCGACCGTCACCGACCTCGAGGCGACATCCCAACGCGAGCCCTGCTACAGCAGCAGCATCGAC
ATTAATGAAGATGACGCCGGCATCATCCCCAAGGGTGCCCTTGACCCCGTCTACGAAGCGAAGGCCCGCGTCCTC
AATCGTGCTGTATGATACTTCTCGTCTGCCCTCGTCTCCCCCACTTCCGTCGATCATCGTCTCCGCACATGCGCA
TGTCAATGGGTGAGGGTGTACATGAAGACGTGCTTGCAGGCGACAAGAATGTAGCTTGCAGGTATGTATGCATGC
GCGCGCTCGTGCCGTACATACATACCCGCCCTCGGCCCCATTTGGCGCTGCAAACACACCGCTGATGCCCCTCTC
CGTCAGATACGGGAGATTGGAATGGGCTGGTATCAGTGGCAGCTCTTCATCGTCGTCGGCTTCGGCTGGGCCAGC
GATAATCTGTGGCCCATCGTCACCTCGCTCATCTTCACGCCCATCACCAACGAGTTCGGGCCCTCGCGCCCGCCC
CTCTTCACTCTGGCCCAGAATATCGGCCTCCTCGCCGGCGCCGTCTTTTGGGGCTTTGGCTGCGACATCTTCGGC
CGCAAATGGGGCTTCAATCTGACCCTCGGCCTCACCGCCATCTGGGGCCTGGTGGCCGCCAGCGCCCCCAACTTC
GCCGCCGCCGGCGTCTTTGCCGCCTTGTGGTCCTTTGGTGTGGGCGGGAACCTGCCCGTCGACTCGGCCGTCTTT
CTCGAATTCTTGCCCCAGTCGCACCAGTTCCTCCTCACGATCTTGTCCATCGACTGGGCTTTCGCGCAGGTCGTT
GCCAACCTCGTCGCCTGGCCGCTCCTCGGCAATTACACCTGCGCTGAGGGTCAGAAACCGTGTACCAAGGGAGCC
AACATGGGCTGGCGCTACTTTGTCCTCGTCATGGGTGGCATCACCTTGCTCATGTTCCTCTCCCGCTTCGTCCTC
TTCACCATCTACGAGTCGCCCAAGTATCTGATTGGAAAGGGCCGCGACGAGGAGGCGGTGCGCGTCGTGCACGAG
GTCGCCCGCCGCAACGGGACGACGACCAATCTGACGCTCGACGACCTCAGGGCCTGCGAGCCCGACGGCTACGTT
GCTCAGACGGATGCCTCCGCCGCCGTCAGGAGGTACCTGGAGAAGCTCGACGCCAAGCACGTCCGCGCCCTCTTC
TCGACCAAGACGCTGGCCCTGAGCACGGGTATCATCATGGCCATATGGGCGCTCATCGGGCTGGGATACCCCCTC
TACAACGCCTTCTTGCCCTACATACAGGCCACGAGGGGCGCCGAGTTCAGAGACGGCAGCACTTACATAACCTAC
CGCAACAGCCTCATCATCTCCGTCCTCGGCGTTCCGGGAGCCCTTCTCGGTGGCTTCCTGGTCGAACTCCCCCGC
ATTGGTCGCAAAGGGACCCTGTCCGTCTTCACCATTCTCACAGGCGTCTTCCTGTACTGCTCCACCACCGCGGCC
AACAGCACTGCCCTCCTGGGCTGGAATTGCGCATTCAACTTCTGCAGCAACGTCATGTACGCTGTTCTTTACGGC
TACACGCCCGAGATCTTTCCCACTCCCCAGCGCGGGACGGGCAACGCACTCTCCGCTACCTGCAACCGCGTATTT
GGCATCATGGCCGTGAGTCACTAGTCTTCTACTCGCCCACTTCCCGCCCTCACTGACGCCCCTCGCCACAGCCCA
TCATTGCCATGTTCGCCAACCTTCAAACCTCGGCCCCGGTCTATACTAGCGGCGCACTGTTCATCATGGCCGGCA
TACTCGTCTTCATACTTCCTTTTGAGTCGAGAGGGAAAGAGGCGTTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail