Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2427
Gene name
LocationContig_158:13168..14721
Strand-
Gene length (bp)1553
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 6.0E-24 28 236
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 2.1E-08 107 322

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 262 284 22
2 299 317 18
3 319 341 22
4 356 378 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2427
MLFEKDPPPAAEYLDANPRAAEQRKRETALLIPCHKSAGILPGTLRAALRIFPPENVFVVANGDSATPLDNTADV
CRAHGVHHVWSPVGSKLVAQFVGCFAAERFKYVLMIDDDCALPPDFPVVSDRIAGRVRCVGYTIKSVGAASSRGT
ACQQAQDLEYKLSGLQRALAGAVGSCMFPHGAISLWDREFLVGTFRHHPGFSISEDWFTGDSCRSLGGRIKMCSA
VFVETETPAALFLGGAGCRGGFGEMTVFKQRFLRWNFFFVNGLWYNLRYLLLSWRLGWWEIGTKFFVFQEVYETL
LYILTPITLPISFLVSWRFCSYLVLVTVALYMINIIIFNEVHLRLKKERVGLVVLLLYFPFYKLALLLVNIGSCY
WAVFKYAKYFAKRHPKIVEDEKSLEIVLKLQQDGLKSSECLHTRAAAAALCGNTNEKMNGNRSSAYSSSLGHPGC
CCLC*
Coding >Hirsu2|2427
ATGCTGTTCGAGAAGGACCCGCCGCCGGCCGCAGAATACCTGGACGCCAACCCGCGGGCGGCAGAGCAGAGGAAG
CGCGAGACGGCGCTGCTGATCCCGTGCCACAAGTCGGCCGGGATCCTCCCGGGCACGCTCCGGGCAGCGCTGCGC
ATCTTCCCGCCGGAGAACGTCTTCGTCGTCGCCAACGGCGACTCGGCGACGCCGCTCGACAACACGGCCGACGTG
TGCCGCGCGCACGGCGTCCACCACGTCTGGTCACCGGTCGGCTCCAAGCTGGTGGCCCAGTTCGTCGGCTGCTTC
GCGGCCGAGCGGTTCAAGTATGTGCTCATGATCGACGACGACTGCGCGCTGCCGCCCGACTTCCCCGTCGTCAGC
GACCGCATCGCCGGCCGCGTCCGCTGCGTCGGCTACACCATCAAGAGCGTCGGCGCCGCCTCGTCCCGCGGCACG
GCCTGCCAGCAGGCCCAGGACCTCGAGTACAAGCTGTCGGGCCTGCAGCGGGCCCTGGCCGGCGCCGTCGGCAGC
TGCATGTTCCCGCACGGCGCCATCTCCCTCTGGGATCGCGAGTTCCTCGTCGGTACCTTTCGCCACCACCCGGGC
TTCTCCATCTCCGAGGACTGGTTCACGGGAGACAGCTGCCGCAGCCTCGGCGGCCGCATCAAGATGTGCTCGGCC
GTCTTCGTCGAGACCGAGACGCCCGCCGCCCTCTTCCTCGGCGGGGCCGGCTGCCGCGGCGGCTTCGGCGAGATG
ACCGTCTTCAAGCAGCGATTCCTGCGCTGGAACTTCTTCTTCGTCAACGGCCTGTGGTACAATCTCCGCTATCTC
CTCCTCAGTTGGCGGCTCGGCTGGTGGGAGATTGGGACCAAGTTTTTTGTTTTTCAAGAGGTCTACGAGACTCTT
CTTTACATCCTGACACCTATCACGCTCCCTATATCCTTCCTGGTCAGCTGGCGCTTTTGCTCCTATCTTGTGCTC
GTCACGGTCGCGCTGTACATGATCAATATCATCATCTTCAACGAGGTTCACTTGCGTCTGAAGAAGGAGAGAGTC
GGCTTAGTGGTACTTCTGTTATACTTTCCGTTTTACAAGCTTGCGCTTTTACTCGTCAACATTGGCAGTTGTTAC
TGGGCTGTCTTCAAATACGCCAAATACTTCGCCAAACGCCATCCCAAGATCGTGGAAGACGAGAAGTCGCTGGAA
ATCGTGTTGAAGCTCCAGCAGGATGGCCTCAAGAGCAGTGAGTGCTTACACACGAGAGCAGCTGCCGCCGCACTG
TGCGGTAATACCAACGAGAAGATGAACGGGAATCGATCGTCGGCGTATTCAAGTTCACTGGGCCACCCTGGCTGC
TGCTGCCTTTGTTGA
Transcript >Hirsu2|2427
ATGCTGTTCGAGAAGGACCCGCCGCCGGCCGCAGAATACCTGGACGCCAACCCGCGGGCGGCAGAGCAGAGGAAG
CGCGAGACGGCGCTGCTGATCCCGTGCCACAAGTCGGCCGGGATCCTCCCGGGCACGCTCCGGGCAGCGCTGCGC
ATCTTCCCGCCGGAGAACGTCTTCGTCGTCGCCAACGGCGACTCGGCGACGCCGCTCGACAACACGGCCGACGTG
TGCCGCGCGCACGGCGTCCACCACGTCTGGTCACCGGTCGGCTCCAAGCTGGTGGCCCAGTTCGTCGGCTGCTTC
GCGGCCGAGCGGTTCAAGTATGTGCTCATGATCGACGACGACTGCGCGCTGCCGCCCGACTTCCCCGTCGTCAGC
GACCGCATCGCCGGCCGCGTCCGCTGCGTCGGCTACACCATCAAGAGCGTCGGCGCCGCCTCGTCCCGCGGCACG
GCCTGCCAGCAGGCCCAGGACCTCGAGTACAAGCTGTCGGGCCTGCAGCGGGCCCTGGCCGGCGCCGTCGGCAGC
TGCATGTTCCCGCACGGCGCCATCTCCCTCTGGGATCGCGAGTTCCTCGTCGGTACCTTTCGCCACCACCCGGGC
TTCTCCATCTCCGAGGACTGGTTCACGGGAGACAGCTGCCGCAGCCTCGGCGGCCGCATCAAGATGTGCTCGGCC
GTCTTCGTCGAGACCGAGACGCCCGCCGCCCTCTTCCTCGGCGGGGCCGGCTGCCGCGGCGGCTTCGGCGAGATG
ACCGTCTTCAAGCAGCGATTCCTGCGCTGGAACTTCTTCTTCGTCAACGGCCTGTGGTACAATCTCCGCTATCTC
CTCCTCAGTTGGCGGCTCGGCTGGTGGGAGATTGGGACCAAGTTTTTTGTTTTTCAAGAGGTCTACGAGACTCTT
CTTTACATCCTGACACCTATCACGCTCCCTATATCCTTCCTGGTCAGCTGGCGCTTTTGCTCCTATCTTGTGCTC
GTCACGGTCGCGCTGTACATGATCAATATCATCATCTTCAACGAGGTTCACTTGCGTCTGAAGAAGGAGAGAGTC
GGCTTAGTGGTACTTCTGTTATACTTTCCGTTTTACAAGCTTGCGCTTTTACTCGTCAACATTGGCAGTTGTTAC
TGGGCTGTCTTCAAATACGCCAAATACTTCGCCAAACGCCATCCCAAGATCGTGGAAGACGAGAAGTCGCTGGAA
ATCGTGTTGAAGCTCCAGCAGGATGGCCTCAAGAGCAGTGAGTGCTTACACACGAGAGCAGCTGCCGCCGCACTG
TGCGGTAATACCAACGAGAAGATGAACGGGAATCGATCGTCGGCGTATTCAAGTTCACTGGGCCACCCTGGCTGC
TGCTGCCTTTGTTGA
Gene >Hirsu2|2427
ATGCTGTTCGAGAAGGACCCGCCGCCGGCCGCAGAATACCTGGACGCCAACCCGCGGGCGGCAGAGCAGAGGAAG
CGCGAGACGGCGCTGCTGATCCCGTGCCACAAGTCGGCCGGGATCCTCCCGGGCACGCTCCGGGCAGCGCTGCGC
ATCTTCCCGCCGGAGAACGTCTTCGTCGTCGCCAACGGCGACTCGGCGACGCCGCTCGACAACACGGCCGACGTG
TGCCGCGCGCACGGCGTCCACCACGTCTGGTCACCGGTCGGCTCCAAGCTGGTGGCCCAGTTCGTCGGCTGCTTC
GCGGCCGAGCGGTTCAAGTATGTGCTCATGATCGACGACGACTGCGCGCTGCCGCCCGACTTCCCCGTCGTCAGC
GACCGCATCGCCGGCCGCGTCCGCTGCGTCGGCTACACCATCAAGAGCGTCGGCGCCGCCTCGTCCCGCGGCACG
GCCTGCCAGCAGGCCCAGGACCTCGAGTACAAGCTGTCGGGCCTGCAGCGGGCCCTGGCCGGCGCCGTCGGCAGC
TGCATGTTCCCGCACGGCGCCATCTCCCTCTGGGATCGCGAGTTCCTCGTCGGTACCTTTCGCCACCACCCGGGC
TTCTCCATCTCCGAGGACTGGTTCACGGGAGACAGCTGCCGCAGCCTCGGCGGCCGCATCAAGATGTGCTCGGCC
GTCTTCGTCGAGACCGAGACGCCCGCCGCCCTCTTCCTCGGCGGGGCCGGCTGCCGCGGCGGCTTCGGCGAGATG
ACCGTCTTCAAGCAGCGATTCCTGCGCTGGAACTTCTTCTTCGTCAACGGCCTGTGGTACAATCTCCGCTATCTC
CTCCTCAGTTGGCGGCTCGGCTGGTGGGAGATTGGGACCAAGTTTTTTGTTTTTCAAGAGGTGAGTTCATCTGTT
TGGGGGGGGGGGGGGGGGGTTCCCCTAATTCGAACGCCCCCGTAATCATTGATGTCACAGAGCGGCACTAATTCG
AGGCTTTGACTGACGCAAAAATACTGCTAGGTCTACGAGACTCTTCTTTACATCCTGACACCTATCACGCTCCCT
ATATCCTTCCTGGTCAGCTGGCGCTTTTGCTCCTATCTTGTGCTCGTCACGGTCGCGCTGTACATGATCAATATC
ATCATCTTCAACGAGGTTCACTTGCGTCTGAAGAAGGAGAGAGTCGGCTTAGTGGTACTTCTGTTATACTTTGTA
AGTGAGGCAGTCTGCCCTTCGTGATGTCCTGTAACTTGGATGCTGACCTATCTCTCATAACGAAGCCGTTTTACA
AGCTTGCGCTTTTACTCGTCAACATTGGCAGTTGTTACTGGGCTGTCTTCAAATACGCCAAATACTTCGCCAAAC
GCCATCCCAAGATCGTGGAAGACGAGAAGTCGCTGGAAATCGTGTTGAAGCTCCAGCAGGATGGCCTCAAGAGCA
GTGAGTGCTTACACACGAGAGCAGCTGCCGCCGCACTGTGCGGTAATACCAACGAGAAGATGAACGGGAATCGAT
CGTCGGCGTATTCAAGTTCACTGGGCCACCCTGGCTGCTGCTGCCTTTGTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail