Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2422
Gene name
LocationContig_158:2457..4533
Strand+
Gene length (bp)2076
Transcript length (bp)1590
Coding sequence length (bp)1590
Protein length (aa) 530

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 2.2E-49 63 506

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 20 502 5.0E-49
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 20 502 3.0E-48
sp|O00061|CP67_UROFA Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 59 527 7.0E-32
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 56 483 4.0E-31
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 56 498 7.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 20 502 5.0E-49
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 20 502 3.0E-48
sp|O00061|CP67_UROFA Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 59 527 7.0E-32
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 56 483 4.0E-31
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 56 498 7.0E-31
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 56 495 1.0E-28
sp|Q12732|AVNA_ASPPA Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 56 527 1.0E-27
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 34 511 4.0E-25
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 34 511 4.0E-25
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 33 511 6.0E-24
sp|Q00707|STCL_EMENI Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 31 498 1.0E-22
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 56 498 3.0E-22
sp|Q9UW95|AFLL_ASPPA Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 60 512 5.0E-22
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 59 529 8.0E-21
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 59 529 1.0E-20
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 59 525 1.0E-20
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 59 529 2.0E-20
sp|Q12612|TRI4_FUSSP Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 22 503 2.0E-20
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 321 494 2.0E-20
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 87 500 3.0E-20
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 87 500 4.0E-20
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 59 529 7.0E-19
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 195 494 8.0E-19
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 195 494 1.0E-18
sp|Q9ZUX1|C94C1_ARATH Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 196 495 2.0E-18
sp|Q9FVS9|C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 308 499 2.0E-18
sp|Q54F47|C513C_DICDI Probable cytochrome P450 513C1 OS=Dictyostelium discoideum GN=cyp513C1 PE=3 SV=1 33 526 3.0E-18
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 149 507 4.0E-18
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 59 529 5.0E-18
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 34 513 6.0E-18
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 321 495 7.0E-18
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 59 499 1.0E-17
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 321 506 2.0E-17
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 25 511 2.0E-17
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 90 526 2.0E-17
sp|Q6YTF1|C76M8_ORYSJ Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 78 498 3.0E-17
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 178 495 4.0E-17
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 59 511 4.0E-17
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 194 514 7.0E-17
sp|Q9VG40|CP134_DROME Probable cytochrome P450 313a4 OS=Drosophila melanogaster GN=Cyp313a4 PE=2 SV=4 59 496 8.0E-17
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 52 514 1.0E-16
sp|Q92045|CP11A_DASAM Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 54 507 1.0E-16
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 195 498 2.0E-16
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 59 496 2.0E-16
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 59 513 3.0E-16
sp|P97720|C11B1_MESAU Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1 127 494 3.0E-16
sp|Q9STL0|C71AN_ARATH Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 321 505 4.0E-16
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 59 496 4.0E-16
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 78 513 4.0E-16
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 59 496 4.0E-16
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 298 495 5.0E-16
sp|Q9SMP5|C94B3_ARATH Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 288 512 5.0E-16
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 92 525 8.0E-16
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 273 498 9.0E-16
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 86 513 1.0E-15
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 259 498 1.0E-15
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 25 525 2.0E-15
sp|Q9V419|C28A5_DROME Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 33 498 2.0E-15
sp|Q9EPT4|CP11A_MESAU Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mesocricetus auratus GN=CYP11A1 PE=2 SV=1 49 494 2.0E-15
sp|O65012|C78A4_PINRA Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 10 507 2.0E-15
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 59 496 2.0E-15
sp|Q9VGZ0|C12E1_DROME Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 19 503 3.0E-15
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 59 496 3.0E-15
sp|Q29552|C11B1_PIG Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 56 494 3.0E-15
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 282 498 4.0E-15
sp|Q9V8M2|C12B2_DROME Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 169 513 4.0E-15
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 307 525 4.0E-15
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 238 504 4.0E-15
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 59 496 6.0E-15
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 303 525 6.0E-15
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 105 494 6.0E-15
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 59 514 8.0E-15
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 76 500 9.0E-15
sp|P48420|C78A1_MAIZE Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 304 498 9.0E-15
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 321 507 1.0E-14
sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 31 497 1.0E-14
sp|P79153|CP11A_CAPHI Cholesterol side-chain cleavage enzyme, mitochondrial OS=Capra hircus GN=CYP11A1 PE=2 SV=1 49 508 1.0E-14
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 273 498 2.0E-14
sp|P14137|CP11A_RAT Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus GN=Cyp11a1 PE=2 SV=1 48 501 2.0E-14
sp|Q7Y1V5|C78AB_ORYSJ Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 307 507 3.0E-14
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 301 526 3.0E-14
sp|P51663|C11B1_SHEEP Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 60 494 3.0E-14
sp|Q9QZ82|CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus GN=Cyp11a1 PE=1 SV=1 48 501 4.0E-14
sp|Q9FI39|THAD_ARATH Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 298 498 4.0E-14
sp|Q12581|CP52X_CANMA Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 304 517 4.0E-14
sp|P47195|C80A1_BERST Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 248 494 5.0E-14
sp|Q92104|CP11B_LITCT Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 59 502 5.0E-14
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 83 511 5.0E-14
sp|O46515|CP11A_HORSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Equus caballus GN=CYP11A1 PE=3 SV=1 49 502 8.0E-14
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 253 496 8.0E-14
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 276 513 8.0E-14
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 321 514 9.0E-14
sp|O44220|C12B1_DROAC Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 205 522 1.0E-13
sp|O23066|C86A2_ARATH Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 102 529 1.0E-13
sp|Q2KIG5|THAS_BOVIN Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 25 525 1.0E-13
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 321 498 1.0E-13
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 304 494 1.0E-13
sp|P00189|CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus GN=CYP11A1 PE=1 SV=1 49 508 2.0E-13
sp|P79202|CP11A_SHEEP Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 49 508 2.0E-13
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 321 496 2.0E-13
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 82 504 3.0E-13
sp|Q9FIB0|C78A7_ARATH Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 275 496 4.0E-13
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 304 517 4.0E-13
sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 300 505 5.0E-13
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 90 495 6.0E-13
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 297 525 6.0E-13
sp|Q96418|C75A5_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 321 507 6.0E-13
sp|Q6Z5I7|C76M6_ORYSJ Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 78 498 8.0E-13
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 251 498 8.0E-13
sp|P15150|C11B1_BOVIN Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 60 494 8.0E-13
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 280 495 8.0E-13
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 59 529 1.0E-12
sp|Q12586|CP52I_CANMA Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 297 523 1.0E-12
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 322 498 1.0E-12
sp|P10612|CP11A_PIG Cholesterol side-chain cleavage enzyme, mitochondrial OS=Sus scrofa GN=CYP11A1 PE=1 SV=1 49 508 1.0E-12
sp|P51589|CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 194 503 1.0E-12
sp|Q12589|CP52K_CANMA Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 205 523 1.0E-12
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 298 513 1.0E-12
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 59 496 1.0E-12
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 59 513 2.0E-12
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 291 498 2.0E-12
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 278 494 2.0E-12
sp|Q09660|CC44_CAEEL Probable cytochrome P450 CYP44 OS=Caenorhabditis elegans GN=cyp-44A1 PE=3 SV=2 323 495 2.0E-12
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 86 513 2.0E-12
sp|O65438|C71AR_ARATH Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=CYP71A27 PE=3 SV=3 322 504 2.0E-12
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 159 504 2.0E-12
sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 321 498 2.0E-12
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 304 503 3.0E-12
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 297 527 3.0E-12
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 51 499 3.0E-12
sp|Q9FMV7|C94B1_ARATH Cytochrome P450 94B1 OS=Arabidopsis thaliana GN=CYP94B1 PE=2 SV=1 296 528 3.0E-12
sp|Q1ZXG6|C5131_DICDI Probable cytochrome P450 513A1 OS=Dictyostelium discoideum GN=cyp513A1 PE=3 SV=1 51 506 4.0E-12
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 264 516 4.0E-12
sp|Q9VFJ0|CA131_DROME Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 246 497 5.0E-12
sp|Q43250|C71C1_MAIZE 3-hydroxyindolin-2-one monooxygenase OS=Zea mays GN=CYP71C1 PE=1 SV=1 253 498 5.0E-12
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 321 527 6.0E-12
sp|Q9LIP5|C71BW_ARATH Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 78 444 6.0E-12
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 86 513 6.0E-12
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 59 529 6.0E-12
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 278 494 7.0E-12
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 237 498 7.0E-12
sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 296 494 7.0E-12
sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 159 497 8.0E-12
sp|P93149|C93B1_GLYEC Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 76 499 1.0E-11
sp|B3RFJ6|86A22_PETHY Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1 291 526 1.0E-11
sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 288 495 1.0E-11
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 291 490 1.0E-11
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 59 529 1.0E-11
sp|Q00557|CP1A1_MESAU Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 322 498 1.0E-11
sp|Q93Z79|C14A1_ARATH Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 322 498 2.0E-11
sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 300 504 2.0E-11
sp|P21595|CP56_YEAST Cytochrome P450-DIT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIT2 PE=1 SV=2 206 498 2.0E-11
sp|P19099|C11B2_HUMAN Cytochrome P450 11B2, mitochondrial OS=Homo sapiens GN=CYP11B2 PE=1 SV=3 60 476 2.0E-11
sp|P15393|C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 160 499 2.0E-11
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 304 494 2.0E-11
sp|I3PFJ5|C76AD_BETVU Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 270 446 2.0E-11
sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 99 521 2.0E-11
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 321 498 2.0E-11
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 304 505 3.0E-11
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 297 495 3.0E-11
sp|P49264|C71B1_THLAR Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 33 500 3.0E-11
sp|Q9LMM1|C86A4_ARATH Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 102 526 3.0E-11
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 196 514 3.0E-11
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 321 507 4.0E-11
sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 307 496 4.0E-11
sp|Q9SWR5|C93C1_SOYBN 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 303 499 4.0E-11
sp|Q9SXS3|C93C2_GLYEC 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 26 499 4.0E-11
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 304 498 4.0E-11
sp|G4XV71|C93C2_GLYUR 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 322 499 4.0E-11
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 51 499 5.0E-11
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 59 514 5.0E-11
sp|Q9STK9|C71AO_ARATH Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 321 498 5.0E-11
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 297 495 5.0E-11
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 303 513 5.0E-11
sp|O80823|C86A8_ARATH Cytochrome P450 86A8 OS=Arabidopsis thaliana GN=CYP86A8 PE=2 SV=1 291 526 5.0E-11
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 197 514 5.0E-11
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 206 527 6.0E-11
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 275 500 6.0E-11
sp|P00185|CP1A1_RAT Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 304 498 6.0E-11
sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 321 525 6.0E-11
sp|P30611|CP52N_CANTR Cytochrome P450 52B1 OS=Candida tropicalis GN=CYP52B1 PE=2 SV=1 321 495 7.0E-11
sp|P43083|CP52V_CANAP Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 296 494 7.0E-11
sp|O49340|C71AC_ARATH Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 248 496 8.0E-11
sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 122 507 9.0E-11
sp|F4IK45|C70B2_ARATH Cytochrome P450 709B2 OS=Arabidopsis thaliana GN=CYP709B2 PE=2 SV=1 208 498 9.0E-11
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 321 500 9.0E-11
sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 123 524 1.0E-10
sp|Q64408|C11B1_CAVPO Cytochrome P450 11B1, mitochondrial OS=Cavia porcellus GN=CYP11B1 PE=2 SV=1 160 494 1.0E-10
sp|P98188|C94A2_VICSA Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 297 494 1.0E-10
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 202 524 1.0E-10
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 291 526 1.0E-10
sp|P17177|CP27A_RABIT Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 163 514 1.0E-10
sp|Q9SP06|C80B3_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 78 496 2.0E-10
sp|O04790|C75A7_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 321 494 2.0E-10
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 283 496 2.0E-10
sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 92 498 2.0E-10
sp|P56590|CP1A1_CANLF Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 322 522 2.0E-10
sp|Q8HYN1|CP17A_PANTR Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 304 525 2.0E-10
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 304 498 2.0E-10
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 273 504 2.0E-10
sp|P15540|CP21A_PIG Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 292 496 2.0E-10
sp|Q96581|C75A4_GENTR Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 307 498 2.0E-10
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 179 507 2.0E-10
sp|P00184|CP1A1_MOUSE Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 304 498 2.0E-10
sp|O18963|CP2E1_BOVIN Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 194 496 2.0E-10
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 196 514 2.0E-10
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 205 522 2.0E-10
sp|P00191|CP21A_BOVIN Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 321 496 3.0E-10
sp|P37117|C71A4_SOLME Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 303 507 3.0E-10
sp|P33272|CP2BC_RAT Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 322 494 3.0E-10
sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 321 507 3.0E-10
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 305 498 3.0E-10
sp|Q2XV99|CP11A_MACFA Cholesterol side-chain cleavage enzyme, mitochondrial OS=Macaca fascicularis GN=CYP11A1 PE=2 SV=1 49 501 3.0E-10
sp|P15539|C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 160 495 3.0E-10
sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 307 496 3.0E-10
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 307 528 3.0E-10
sp|P70687|CP17A_MESAU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 322 525 3.0E-10
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 303 507 4.0E-10
sp|Q9LUC8|C7A13_ARATH Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 306 498 4.0E-10
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 321 503 4.0E-10
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 292 479 4.0E-10
sp|E3W9C4|C71A1_ZINZE Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 312 498 4.0E-10
sp|P30099|C11B2_RAT Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1 154 482 4.0E-10
sp|Q9STL2|C71AL_ARATH Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 321 498 4.0E-10
sp|O13820|ERG5_SCHPO Cytochrome P450 61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg5 PE=1 SV=3 8 479 4.0E-10
sp|Q43033|TCMO_PETCR Trans-cinnamate 4-monooxygenase OS=Petroselinum crispum GN=CYP73A10 PE=2 SV=1 275 496 5.0E-10
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 306 496 5.0E-10
sp|P05093|CP17A_HUMAN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 304 525 5.0E-10
sp|Q5IZM4|CP51_MYCVP Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 276 500 5.0E-10
sp|Q29527|C11B1_PAPHU Cytochrome P450 11B1, mitochondrial OS=Papio hamadryas ursinus GN=CYP11B1 PE=3 SV=1 60 476 5.0E-10
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 296 495 5.0E-10
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 283 494 6.0E-10
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 307 513 6.0E-10
sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 321 526 7.0E-10
sp|P9WPM5|CP137_MYCTU Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp137 PE=1 SV=1 85 525 7.0E-10
sp|P9WPM4|CP137_MYCTO Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp137 PE=3 SV=1 85 525 7.0E-10
sp|Q9V4I1|CP9B2_DROME Cytochrome P450 9b2 OS=Drosophila melanogaster GN=Cyp9b2 PE=2 SV=1 25 494 7.0E-10
sp|Q54CS3|C508C_DICDI Probable cytochrome P450 508C1 OS=Dictyostelium discoideum GN=cyp508C1 PE=3 SV=1 283 503 8.0E-10
sp|Q2LA60|CP21A_FELCA Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 321 525 8.0E-10
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 297 494 8.0E-10
sp|Q92148|CP1A1_MICTO Cytochrome P450 1A1 OS=Microgadus tomcod GN=cyp1a1 PE=2 SV=1 208 499 1.0E-09
sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 298 496 1.0E-09
sp|Q6UEG2|AFLN_ASPPA P450 monooxygenase AflN OS=Aspergillus parasiticus GN=aflN PE=3 SV=1 322 497 1.0E-09
sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 33 504 1.0E-09
sp|Q3LFU0|CP1A1_BALAC Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 322 502 1.0E-09
sp|Q9Y758|CP52M_DEBHN Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 297 515 1.0E-09
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 311 496 1.0E-09
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 304 500 1.0E-09
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 292 523 1.0E-09
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 305 496 1.0E-09
sp|P30100|C11B3_RAT Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1 154 482 1.0E-09
sp|Q06367|CP1A1_CAVPO Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1 322 497 2.0E-09
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 291 490 2.0E-09
sp|P0DKI2|C76AN_BETVU Inactive cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=3 SV=1 270 439 2.0E-09
sp|Q9GMC8|CP17A_FELCA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 322 498 2.0E-09
sp|P24460|CP2BB_CANLF Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 208 494 2.0E-09
sp|P56591|CP1A1_SHEEP Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 322 522 2.0E-09
sp|Q64658|C11B2_MESAU Cytochrome P450 11B2, mitochondrial OS=Mesocricetus auratus GN=CYP11B2 PE=2 SV=1 127 494 2.0E-09
sp|P15538|C11B1_HUMAN Cytochrome P450 11B1, mitochondrial OS=Homo sapiens GN=CYP11B1 PE=1 SV=5 60 476 2.0E-09
sp|Q9CAD6|C86A7_ARATH Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 321 526 2.0E-09
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 307 507 2.0E-09
sp|P56592|CP1A2_CANLF Cytochrome P450 1A2 OS=Canis lupus familiaris GN=CYP1A2 PE=1 SV=2 25 502 2.0E-09
sp|Q2LA59|CP21A_LYNLY Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 321 496 2.0E-09
sp|Q00714|STCS_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcS PE=1 SV=2 149 495 2.0E-09
sp|P54781|ERG5_YEAST Cytochrome P450 61 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG5 PE=1 SV=1 144 526 2.0E-09
sp|Q29488|CP2DH_MACFA Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP2D17 PE=2 SV=1 193 498 2.0E-09
sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 321 505 3.0E-09
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 244 507 3.0E-09
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 321 505 3.0E-09
sp|Q04468|TCMO_HELTU Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1 275 479 3.0E-09
sp|H2DH22|C7A10_PANGI Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 275 498 3.0E-09
sp|O93323|CP26A_XENLA Cytochrome P450 26A1 OS=Xenopus laevis GN=cyp26a1 PE=2 SV=1 296 500 3.0E-09
sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 304 498 3.0E-09
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 304 499 3.0E-09
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 208 498 3.0E-09
sp|P05182|CP2E1_RAT Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 322 496 3.0E-09
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 274 480 3.0E-09
sp|Q9QYG6|CP2DR_MESAU Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CYP2D27 PE=1 SV=1 321 498 3.0E-09
sp|P51581|CP2E1_MESAU Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 322 495 4.0E-09
sp|P56593|CP2AC_MOUSE Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 166 496 4.0E-09
sp|P58046|C71AF_ARATH Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 321 496 4.0E-09
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 323 497 4.0E-09
sp|Q6VVW9|CP2R1_MOUSE Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 269 494 4.0E-09
sp|Q12573|CP52W_CANAP Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 296 494 4.0E-09
sp|P00187|CP1A2_RABIT Cytochrome P450 1A2 OS=Oryctolagus cuniculus GN=CYP1A2 PE=1 SV=3 322 498 4.0E-09
sp|Q86A22|C515A_DICDI Probable cytochrome P450 515A1 OS=Dictyostelium discoideum GN=cyp515A1 PE=3 SV=1 207 496 4.0E-09
sp|Q9QYG5|CP2DK_MESAU Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 321 498 5.0E-09
sp|Q9QUJ1|CP2DS_MESAU Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 82 498 5.0E-09
sp|Q9MZY0|CP2E1_CANLF Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 322 495 5.0E-09
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 291 525 6.0E-09
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 306 496 6.0E-09
sp|Q9VMS9|C4AC1_DROME Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 268 494 6.0E-09
sp|Q05421|CP2E1_MOUSE Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 322 495 6.0E-09
sp|P05176|CP1A1_RABIT Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 322 498 7.0E-09
sp|Q9PUB4|CP26A_CHICK Cytochrome P450 26A1 OS=Gallus gallus GN=CYP26A1 PE=2 SV=1 307 500 7.0E-09
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 293 480 8.0E-09
sp|P05181|CP2E1_HUMAN Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 322 495 8.0E-09
sp|Q9W130|CP9C1_DROME Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 305 525 8.0E-09
sp|Q92039|CP1A1_CHACA Cytochrome P450 1A1 OS=Chaetodon capistratus GN=cyp1a1 PE=2 SV=1 208 496 8.0E-09
sp|Q5KQT7|CP1A1_FELCA Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1 322 498 8.0E-09
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 305 495 8.0E-09
sp|Q6R7M4|C15A1_DIPPU Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 285 494 8.0E-09
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 302 494 9.0E-09
sp|O48928|C77A3_SOYBN Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 323 496 9.0E-09
sp|P48422|C86A1_ARATH Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 303 494 1.0E-08
sp|Q9T093|C70B3_ARATH Cytochrome P450 709B3 OS=Arabidopsis thaliana GN=CYP709B3 PE=2 SV=1 196 498 1.0E-08
sp|Q8HYM9|CP17A_MACMU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 304 525 1.0E-08
sp|Q2XVA1|CP17A_MACFA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 304 525 1.0E-08
sp|I3V6B1|C80BX_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase-like protein OS=Papaver somniferum GN=CYP80BX PE=2 SV=1 296 475 1.0E-08
sp|Q8HYN0|CP17A_PAPCY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 304 525 1.0E-08
sp|Q9LUC5|C7A15_ARATH Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 306 498 1.0E-08
sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 306 498 1.0E-08
sp|O55071|CP2BJ_MOUSE Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 195 494 1.0E-08
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 304 498 1.0E-08
sp|Q9FMY1|C86B1_ARATH Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 310 525 1.0E-08
sp|P04798|CP1A1_HUMAN Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 322 522 1.0E-08
sp|P0DKI7|STORR_PAPSO Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 323 495 1.0E-08
sp|P08686|CP21A_HUMAN Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 321 496 1.0E-08
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 307 507 1.0E-08
sp|Q9LZ31|C77A4_ARATH Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1 323 496 1.0E-08
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 273 494 1.0E-08
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 305 496 1.0E-08
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 197 498 1.0E-08
sp|Q5KQT6|CP1A2_FELCA Cytochrome P450 1A2 OS=Felis catus GN=CYP1A2 PE=2 SV=1 322 502 2.0E-08
sp|P56655|CP238_MOUSE Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 322 494 2.0E-08
sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 291 513 2.0E-08
sp|Q2XNC8|CP2D6_PANTR Cytochrome P450 2D6 OS=Pan troglodytes GN=CYP2D6 PE=3 SV=1 322 498 2.0E-08
sp|P30609|CP52G_CANTR Cytochrome P450 52A7 OS=Candida tropicalis GN=CYP52A7 PE=2 SV=1 318 495 2.0E-08
sp|P00181|CP2C2_RABIT Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 305 494 2.0E-08
sp|Q9AR74|TCMO_RUTGR Trans-cinnamate 4-monooxygenase OS=Ruta graveolens GN=CYP73A2 PE=2 SV=1 307 479 2.0E-08
sp|F2Z9C1|P6H_ESCCA Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 321 500 2.0E-08
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 307 496 2.0E-08
sp|Q92088|CP2M1_ONCMY Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 322 497 2.0E-08
sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 321 515 2.0E-08
sp|Q2LCM1|CP21A_CANLU Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 321 496 2.0E-08
sp|Q8WNW0|CP21A_CANLF Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 321 496 2.0E-08
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 322 495 2.0E-08
sp|P10634|CP2DQ_RAT Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 292 499 2.0E-08
sp|P00180|CP2C1_RABIT Cytochrome P450 2C1 OS=Oryctolagus cuniculus GN=CYP2C1 PE=1 SV=2 296 494 2.0E-08
sp|L7X0L7|P6H_PAPSO Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 292 500 2.0E-08
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 298 502 2.0E-08
sp|P12394|CP17A_CHICK Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 307 526 2.0E-08
sp|Q6GUR1|CP1A1_MACMU Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1 322 522 2.0E-08
sp|P33616|CP1A1_MACFA Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1A1 PE=2 SV=1 322 522 2.0E-08
sp|B9GBJ9|C14C1_ORYSJ Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 371 497 2.0E-08
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 14 525 2.0E-08
sp|Q27712|CP2L1_PANAR Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 191 497 2.0E-08
sp|Q5UQ90|YL532_MIMIV Cytochrome P450-like protein L532 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L532 PE=1 SV=1 298 499 2.0E-08
sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 185 496 3.0E-08
sp|Q9V6D6|CP301_DROME Probable cytochrome P450 301a1, mitochondrial OS=Drosophila melanogaster GN=Cyp301a1 PE=2 SV=1 321 496 3.0E-08
sp|Q2XNC9|CP2D6_PANPA Cytochrome P450 2D6 OS=Pan paniscus GN=CYP2D6 PE=3 SV=1 322 498 3.0E-08
sp|P9WPM9|C135B_MYCTU Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135B1 PE=1 SV=1 307 502 3.0E-08
sp|P9WPM8|C135B_MYCTO Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135B1 PE=3 SV=1 307 502 3.0E-08
sp|P63716|C135B_MYCBO Putative cytochrome P450 135B1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp135B1 PE=3 SV=1 307 502 3.0E-08
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 291 498 3.0E-08
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 306 505 3.0E-08
sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 119 497 3.0E-08
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 306 498 3.0E-08
sp|Q9FH66|C71AG_ARATH Cytochrome P450 71A16 OS=Arabidopsis thaliana GN=CYP71A16 PE=2 SV=1 263 504 3.0E-08
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 103 500 4.0E-08
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 305 496 5.0E-08
sp|P85191|CP450_HELAN Cytochrome P450 (Fragment) OS=Helianthus annuus PE=1 SV=1 369 500 6.0E-08
sp|P56594|CP2CL_CANLF Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 283 494 7.0E-08
sp|P05177|CP1A2_HUMAN Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 322 502 7.0E-08
sp|Q2QYH7|C14C2_ORYSJ Cytochrome P450 714C2 OS=Oryza sativa subsp. japonica GN=CYP714C2 PE=2 SV=1 322 498 7.0E-08
sp|P33265|CP2CS_MESAU Cytochrome P450 2C28 OS=Mesocricetus auratus GN=CYP2C28 PE=2 SV=1 277 495 7.0E-08
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 304 498 8.0E-08
sp|P11714|CP2D9_MOUSE Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 322 498 9.0E-08
sp|P13108|CP2D4_RAT Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 321 498 1.0E-07
sp|P11715|CP17A_RAT Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 322 525 1.0E-07
sp|Q9GLD2|CP17A_PAPHU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 304 525 1.0E-07
sp|P33266|CP2E1_MACFA Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 322 495 1.0E-07
sp|O42430|CP1A1_LIMLI Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 274 496 1.0E-07
sp|P24456|CP2DA_MOUSE Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 309 500 1.0E-07
sp|P10635|CP2D6_HUMAN Cytochrome P450 2D6 OS=Homo sapiens GN=CYP2D6 PE=1 SV=2 322 498 1.0E-07
sp|P79383|CP2E1_PIG Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 322 495 1.0E-07
sp|A3A871|C71Z6_ORYSJ Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 310 500 1.0E-07
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 311 513 1.0E-07
sp|P79761|CP1A5_CHICK Cytochrome P450 1A5 OS=Gallus gallus GN=CYP1A5 PE=2 SV=1 171 521 1.0E-07
sp|Q964R0|CP6K1_BLAGE Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 149 507 1.0E-07
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 304 500 2.0E-07
sp|P56656|CP239_MOUSE Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 322 494 2.0E-07
sp|P20853|CP2A7_HUMAN Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 208 494 2.0E-07
sp|O24312|TCMO_POPTM Trans-cinnamate 4-monooxygenase OS=Populus tremuloides GN=CYP73A13 PE=2 SV=1 275 479 2.0E-07
sp|P56654|CP237_MOUSE Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 322 496 2.0E-07
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 307 498 2.0E-07
sp|Q43067|TCMO_PEA Trans-cinnamate 4-monooxygenase OS=Pisum sativum GN=CYP73A9 PE=2 SV=2 275 479 2.0E-07
sp|P12790|CP2B9_MOUSE Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=1 SV=2 304 494 2.0E-07
sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 307 498 2.0E-07
sp|Q4H4C3|CP1A2_MACFU Cytochrome P450 1A2 OS=Macaca fuscata fuscata GN=CYP1A2 PE=2 SV=3 325 522 2.0E-07
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 140 496 2.0E-07
sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 179 498 2.0E-07
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 306 523 2.0E-07
sp|P37121|C76A1_SOLME Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 274 498 2.0E-07
sp|Q9YH64|CP1A1_PLAFE Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 322 496 2.0E-07
sp|P11711|CP2A1_RAT Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 322 496 2.0E-07
sp|Q9VGB5|CP135_DROME Probable cytochrome P450 313a5 OS=Drosophila melanogaster GN=Cyp313a5 PE=1 SV=2 279 525 3.0E-07
sp|Q92100|CP1A1_PLEPL Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 322 496 3.0E-07
sp|P37115|TCMO_VIGRR Trans-cinnamate 4-monooxygenase OS=Vigna radiata var. radiata GN=CYP73A2 PE=1 SV=1 275 479 3.0E-07
sp|Q9UVC3|CP51_CUNEL Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 297 498 3.0E-07
sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 321 498 3.0E-07
sp|Q64680|CP2DI_RAT Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 321 498 3.0E-07
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 304 498 3.0E-07
sp|Q96423|TCMO_GLYEC Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1 275 479 3.0E-07
sp|P9WPP9|CP51_MYCTU Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp51 PE=1 SV=1 276 514 3.0E-07
sp|P9WPP8|CP51_MYCTO Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp51 PE=3 SV=1 276 514 3.0E-07
sp|P0A513|CP51_MYCBO Lanosterol 14-alpha demethylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp51 PE=3 SV=1 276 514 3.0E-07
sp|P20813|CP2B6_HUMAN Cytochrome P450 2B6 OS=Homo sapiens GN=CYP2B6 PE=1 SV=1 322 494 3.0E-07
sp|Q54DT2|C516A_DICDI Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 321 483 3.0E-07
sp|H2DH24|C7D47_PANGI Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 322 494 4.0E-07
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 297 514 4.0E-07
sp|Q9LUC9|C7A11_ARATH Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 306 498 4.0E-07
sp|Q92109|CP1A3_ONCMY Cytochrome P450 1A3 OS=Oncorhynchus mykiss GN=cyp1a3 PE=2 SV=2 322 496 4.0E-07
sp|Q8CIM7|CP2DQ_MOUSE Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 321 498 5.0E-07
sp|Q6WNQ9|C81E9_MEDTR Isoflavone 3'-hydroxylase (Fragment) OS=Medicago truncatula GN=CYP81E9 PE=1 SV=1 321 480 5.0E-07
sp|Q5KQH7|C14D1_ORYSJ Cytochrome P450 714D1 OS=Oryza sativa subsp. japonica GN=CYP714D1 PE=1 SV=1 286 498 5.0E-07
sp|Q9FF18|C7351_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 156 498 5.0E-07
sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 296 498 6.0E-07
sp|Q43255|C71C2_MAIZE indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 304 498 6.0E-07
sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 321 498 7.0E-07
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 306 494 8.0E-07
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 307 492 8.0E-07
sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 304 498 8.0E-07
sp|O23976|C76B1_HELTU 7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1 321 498 9.0E-07
sp|Q6WKY9|C7D95_MENGR Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 303 504 9.0E-07
sp|Q6IV13|C7D95_MENSP Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 303 504 9.0E-07
sp|P82711|C6A19_DROME Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 121 498 9.0E-07
sp|P55540|CPXU_RHISN Cytochrome P450 BJ-4 homolog OS=Rhizobium sp. (strain NGR234) GN=cyp117A2 PE=3 SV=1 283 490 9.0E-07
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 297 482 1.0E-06
sp|Q9LMX7|C78A5_ARATH Cytochrome P450 78A5 OS=Arabidopsis thaliana GN=CYP78A5 PE=2 SV=1 293 502 1.0E-06
sp|E1BHJ4|CP26B_BOVIN Cytochrome P450 26B1 OS=Bos taurus GN=CYP26B1 PE=3 SV=1 335 529 1.0E-06
sp|Q9V769|C6A22_DROME Cytochrome P450 6a22 OS=Drosophila melanogaster GN=Cyp6a22 PE=2 SV=1 307 514 1.0E-06
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 307 494 1.0E-06
sp|P00179|CP2C5_RABIT Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 322 494 2.0E-06
sp|A1DA63|FTME_NEOFI Fumitremorgin C synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-2 PE=3 SV=1 323 527 2.0E-06
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 60 500 2.0E-06
sp|P33273|CP255_RAT Cytochrome P450 2C55 OS=Rattus norvegicus GN=Cyp2c55 PE=2 SV=2 307 495 2.0E-06
sp|O64899|C80B1_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1 291 500 2.0E-06
sp|Q6V0L0|CP26C_HUMAN Cytochrome P450 26C1 OS=Homo sapiens GN=CYP26C1 PE=2 SV=2 310 492 2.0E-06
sp|P15123|CP2CG_RABIT Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 307 494 2.0E-06
sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 321 525 3.0E-06
sp|O18992|CP2DJ_CALJA Cytochrome P450 2D19 OS=Callithrix jacchus GN=CYP2D19 PE=2 SV=1 322 498 3.0E-06
sp|P24457|CP2DB_MOUSE Cytochrome P450 2D11 OS=Mus musculus GN=Cyp2d11 PE=2 SV=2 321 498 3.0E-06
sp|H2DH18|C7A12_PANGI Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 297 507 3.0E-06
sp|Q9LW27|C71BF_ARATH Bifunctional dihydrocamalexate synthase/camalexin synthase OS=Arabidopsis thaliana GN=CYP71B15 PE=1 SV=1 312 509 3.0E-06
sp|Q08D50|CP26B_XENTR Cytochrome P450 26B1 OS=Xenopus tropicalis GN=cyp26b1 PE=2 SV=1 335 496 3.0E-06
sp|P11371|CP2C4_RABIT Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 296 494 4.0E-06
sp|Q9D816|CP255_MOUSE Cytochrome P450 2C55 OS=Mus musculus GN=Cyp2c55 PE=1 SV=1 305 495 4.0E-06
sp|Q6EIG3|CP26B_DANRE Cytochrome P450 26B1 OS=Danio rerio GN=cyp26b1 PE=1 SV=1 338 490 4.0E-06
sp|Q811W2|CP26B_MOUSE Cytochrome P450 26B1 OS=Mus musculus GN=Cyp26b1 PE=1 SV=1 335 516 4.0E-06
sp|Q9ZW95|C7352_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 376 498 4.0E-06
sp|P00182|CP2C3_RABIT Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 283 494 5.0E-06
sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 250 496 6.0E-06
sp|E9Q816|CP2W1_MOUSE Cytochrome P450 2W1 OS=Mus musculus GN=Cyp2w1 PE=2 SV=1 321 494 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 24 46 22
2 238 260 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2422
MIIFPWAEYHQTKMAIGSLLGWPWALSSLTVGLVVVACASAVVALVAASIRDQRRLSHIPGPRWMGWTNLAMARK
MYGGRAHYDMLELERRYGPIVRTGPNMVLVSDPHVLRMMSAARSEYTRGPYYKAVRINPHVDNIFSMTDDRQHKT
LKSKMGPGYSGREMGGFEPGIDKHVGAFVRLIERKYLSTAHEYRPMDLALKCNYFALDVISELGFGAAFGFLRED
RDLYRYNALTRRFFPFVMFLSSVPSLLALLGRWPLNAMGPAAGDSAGFGRLMQFAAGFVDGRLAPGAKRGRDMMQ
AFVDAGLTRDELMQEVFVETVAGSDTTATAVRSTMLCLLGNPAALARLRAEIDTGIASGLVSSPVRDAEARRMPY
LQAVIREGIRMFPPATGVLSKQVPAGGDVLLGHAVPAGVQVGHNICGLLRSRALFGPDADVFRPDRWLEAEAAEA
DPDRLREMVGAVELVFGYGKFQCLGRTIAQMELNKVYVELLRRFDFTIVNVDKPVRLLSAAMLIMDDFWVRVSRR
DEAV*
Coding >Hirsu2|2422
ATGATCATCTTCCCCTGGGCAGAGTACCATCAGACCAAGATGGCCATCGGCTCCCTGCTGGGCTGGCCTTGGGCC
CTGTCGTCGCTGACGGTCGGCCTCGTGGTCGTCGCCTGCGCCTCGGCCGTGGTGGCCCTGGTGGCGGCGAGCATC
CGGGACCAGCGCCGGCTGTCACACATACCGGGCCCGAGGTGGATGGGATGGACCAACCTGGCCATGGCGCGCAAG
ATGTACGGCGGGCGGGCGCACTACGACATGCTCGAGCTCGAGAGGAGATACGGCCCCATCGTCCGCACAGGCCCC
AACATGGTCCTCGTCAGCGATCCGCACGTGCTGCGGATGATGTCGGCCGCGCGCAGCGAATACACGCGCGGGCCG
TACTACAAGGCGGTGCGCATCAACCCGCACGTCGACAACATCTTCTCCATGACGGACGACCGGCAGCACAAGACG
CTCAAGAGCAAGATGGGGCCGGGGTACTCGGGCCGCGAGATGGGCGGCTTCGAGCCCGGCATCGACAAGCACGTC
GGCGCCTTCGTCCGGCTCATCGAGCGCAAGTACCTGTCGACGGCGCACGAGTACCGGCCGATGGACCTGGCGCTC
AAGTGCAACTACTTCGCGCTCGACGTCATCAGCGAGCTCGGCTTCGGCGCCGCCTTCGGCTTCCTGCGCGAGGAC
CGCGACCTGTACCGGTACAACGCGCTGACGCGCCGCTTCTTCCCCTTCGTCATGTTCCTGAGCAGCGTGCCGAGC
CTGCTGGCCCTGCTCGGCCGCTGGCCGCTCAACGCCATGGGGCCCGCCGCCGGCGACTCGGCCGGCTTCGGCCGC
CTGATGCAGTTCGCCGCCGGCTTCGTCGACGGCCGCCTGGCGCCCGGCGCCAAGCGCGGCCGCGACATGATGCAG
GCCTTTGTCGACGCCGGCCTGACGCGCGACGAGCTGATGCAGGAGGTCTTTGTCGAGACCGTGGCCGGCTCCGAC
ACGACGGCGACGGCGGTCCGGTCGACGATGCTGTGCCTCCTCGGCAACCCTGCGGCCCTGGCCCGGCTGCGGGCC
GAGATCGACACGGGCATCGCCAGCGGGCTCGTGTCGTCGCCGGTCCGCGACGCCGAGGCCCGGCGCATGCCCTAC
CTGCAGGCCGTCATCCGCGAGGGCATCCGCATGTTCCCGCCCGCGACCGGCGTGCTGTCCAAGCAGGTGCCGGCC
GGCGGCGACGTGCTGCTCGGCCACGCCGTCCCGGCCGGCGTCCAGGTCGGCCACAACATCTGCGGCCTGCTGCGG
TCGAGGGCGCTGTTCGGGCCCGACGCCGACGTCTTCCGCCCGGACCGCTGGCTCGAGGCCGAGGCGGCCGAGGCC
GACCCGGACCGGCTGCGCGAGATGGTCGGCGCCGTCGAGCTGGTCTTTGGCTACGGCAAGTTCCAGTGCCTGGGC
CGGACGATTGCCCAGATGGAGCTGAACAAGGTCTATGTCGAGCTGCTGCGCCGGTTCGACTTCACGATCGTCAAT
GTGGACAAGCCGGTGCGGCTCCTCAGCGCCGCCATGCTGATCATGGATGACTTCTGGGTCCGGGTCTCGCGGCGG
GACGAAGCCGTCTGA
Transcript >Hirsu2|2422
ATGATCATCTTCCCCTGGGCAGAGTACCATCAGACCAAGATGGCCATCGGCTCCCTGCTGGGCTGGCCTTGGGCC
CTGTCGTCGCTGACGGTCGGCCTCGTGGTCGTCGCCTGCGCCTCGGCCGTGGTGGCCCTGGTGGCGGCGAGCATC
CGGGACCAGCGCCGGCTGTCACACATACCGGGCCCGAGGTGGATGGGATGGACCAACCTGGCCATGGCGCGCAAG
ATGTACGGCGGGCGGGCGCACTACGACATGCTCGAGCTCGAGAGGAGATACGGCCCCATCGTCCGCACAGGCCCC
AACATGGTCCTCGTCAGCGATCCGCACGTGCTGCGGATGATGTCGGCCGCGCGCAGCGAATACACGCGCGGGCCG
TACTACAAGGCGGTGCGCATCAACCCGCACGTCGACAACATCTTCTCCATGACGGACGACCGGCAGCACAAGACG
CTCAAGAGCAAGATGGGGCCGGGGTACTCGGGCCGCGAGATGGGCGGCTTCGAGCCCGGCATCGACAAGCACGTC
GGCGCCTTCGTCCGGCTCATCGAGCGCAAGTACCTGTCGACGGCGCACGAGTACCGGCCGATGGACCTGGCGCTC
AAGTGCAACTACTTCGCGCTCGACGTCATCAGCGAGCTCGGCTTCGGCGCCGCCTTCGGCTTCCTGCGCGAGGAC
CGCGACCTGTACCGGTACAACGCGCTGACGCGCCGCTTCTTCCCCTTCGTCATGTTCCTGAGCAGCGTGCCGAGC
CTGCTGGCCCTGCTCGGCCGCTGGCCGCTCAACGCCATGGGGCCCGCCGCCGGCGACTCGGCCGGCTTCGGCCGC
CTGATGCAGTTCGCCGCCGGCTTCGTCGACGGCCGCCTGGCGCCCGGCGCCAAGCGCGGCCGCGACATGATGCAG
GCCTTTGTCGACGCCGGCCTGACGCGCGACGAGCTGATGCAGGAGGTCTTTGTCGAGACCGTGGCCGGCTCCGAC
ACGACGGCGACGGCGGTCCGGTCGACGATGCTGTGCCTCCTCGGCAACCCTGCGGCCCTGGCCCGGCTGCGGGCC
GAGATCGACACGGGCATCGCCAGCGGGCTCGTGTCGTCGCCGGTCCGCGACGCCGAGGCCCGGCGCATGCCCTAC
CTGCAGGCCGTCATCCGCGAGGGCATCCGCATGTTCCCGCCCGCGACCGGCGTGCTGTCCAAGCAGGTGCCGGCC
GGCGGCGACGTGCTGCTCGGCCACGCCGTCCCGGCCGGCGTCCAGGTCGGCCACAACATCTGCGGCCTGCTGCGG
TCGAGGGCGCTGTTCGGGCCCGACGCCGACGTCTTCCGCCCGGACCGCTGGCTCGAGGCCGAGGCGGCCGAGGCC
GACCCGGACCGGCTGCGCGAGATGGTCGGCGCCGTCGAGCTGGTCTTTGGCTACGGCAAGTTCCAGTGCCTGGGC
CGGACGATTGCCCAGATGGAGCTGAACAAGGTCTATGTCGAGCTGCTGCGCCGGTTCGACTTCACGATCGTCAAT
GTGGACAAGCCGGTGCGGCTCCTCAGCGCCGCCATGCTGATCATGGATGACTTCTGGGTCCGGGTCTCGCGGCGG
GACGAAGCCGTCTGA
Gene >Hirsu2|2422
ATGATCATCTTCCCCTGGGCAGAGTACCATCAGACCAAGATGGCCATCGGCTCCCTGCTGGGCTGGCCTTGGGCC
CTGTCGTCGCTGACGGTCGGCCTCGTGGTCGTCGCCTGCGCCTCGGCCGTGGTGGCCCTGGTGGCGGCGAGCATC
CGGGACCAGCGCCGGCTGTCACACATACCGGGCCCGAGGTGGATGGGATGGACCAACCTGGCCATGGCGCGCAAG
ATGTACGGCGGGCGGGCGCACTACGACATGCTCGAGCTCGAGAGGAGATACGGTATGCAGCTCGGCCGCCGATAT
CTCGTCCCCCCCCCTCCCGGCCGAGAGGCCCCGGACGAGAGGGCTTGCGGGAGAGGACACTCGTCAGTCGTGTCT
CTGTCGGACCAGCACTGACGTCGTCTCTTCCGCCAGGCCCCATCGTCCGCACAGGCCCCAACATGGTCCTCGTCA
GCGATCCGCACGTGCTGCGGATGATGTCGGCCGCGCGCAGCGAATACACGCGCGGGCCGTACTACAAGGCGGTGC
GCATCAACCCGCACGTCGACAACATCTTCTCCATGACGGACGACCGGCAGCACAAGACGCTCAAGAGCAAGATGG
GGCCGGGGGTAAGAGTCTTGTCTCCTCCCCTTCCTCCTTGTCCGGGCCCCGATGATAACGAAGGTCGGGTCCTGC
AGTACTCGGGCCGCGAGATGGGCGGCTTCGAGCCCGGCATCGACAAGCACGTCGGCGCCTTCGTCCGGCTCATCG
AGCGCAAGTACCTGTCGACGGCGCACGAGTACCGGCCGATGGACCTGGCGCTCAAGTGCAACTACTTCGCGCTCG
ACGTCATCAGCGAGCTCGGCTTCGGCGCCGCCTTCGGCTTCCTGCGCGAGGACCGCGACCTGTACCGGTACAACG
CGCTGACGCGCCGCTTCTTCCCCTTCGTCATGTTCCTGAGCAGCGTGCCGAGCCTGCTGGCCCTGCTCGGCCGCT
GGCCGCTCAACGCCATGGGGCCCGCCGCCGGCGACTCGGCCGGCTTCGGCCGCCTGATGCAGTTCGCCGCCGGCT
TCGTCGACGGCCGCCTGGCGCCCGGCGCCAAGCGCGGCCGCGACATGATGCAGGCCTTTGTCGACGCCGGCCTGA
CGCGCGACGAGCTGATGCAGGAGGTCTTTGTCGAGACGTGAGTGGCAGAAGCTTCTTTTTCTTCTTTTTCTTCTT
CTTGTTCTTTTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTGGCTGACGAGGAC
GAAAACAGCGTGGCCGGCTCCGACACGACGGCGACGGCGGTCCGGTCGACGATGCTGTGCCTCCTCGGCAACCCT
GCGGCCCTGGCCCGGCTGCGGGCCGAGATCGACACGGGCATCGCCAGCGGGCTCGTGTCGTCGCCGGTCCGCGAC
GCCGAGGCCCGGCGCATGCCCTACCTGCAGGCCGTCATCCGCGAGGGCATCCGCATGTTCCCGCCCGCGACCGGC
GTGCTGTCCAAGCAGGTGCCGGCCGGCGGCGACGTGCTGCTCGGCCACGCCGTCCCGGCCGGCGTCCAGGTCGGC
CACAACATCTGCGGCCTGCTGCGGTCGAGGGCGCTGTTCGGGCCCGACGCCGACGTCTTCCGCCCGGACCGCTGG
CTCGAGGCCGAGGCGGCCGAGGCCGACCCGGACCGGCTGCGCGAGATGGTCGGCGCCGTCGAGCTGGTCTTTGGC
TACGGCAAGTTCCAGTGCCTGGGCCGGACGATTGCCCAGATGGAGCTGAACAAGGTCTATGTCGAGGTAAGCCGC
TTTCACTTTATTTTTTTTTTTTATTTCCCTTGGACGACTCTTCTTCAAAATAGATGCCGTGTAGTTTTACATGCG
CCTCGGCCCGCTGTCTCAGACAACGGCCCGAGTTGTGCAACAACTGCCGAGAGACCATCGCTGACGTTCCTCGAC
CAGCTGCTGCGCCGGTTCGACTTCACGATCGTCAATGTGGACAAGCCGGTGCGGCTCCTCAGCGCCGCCATGCTG
ATCATGGATGACTTCTGGGTCCGGGTCTCGCGGCGGGACGAAGCCGTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail