Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2420
Gene name
LocationContig_1579:3570..4267
Strand+
Gene length (bp)697
Transcript length (bp)630
Coding sequence length (bp)630
Protein length (aa) 210

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06957 COPI_C Coatomer (COPI) alpha subunit C-terminus 3.1E-55 4 207

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53621|COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 5 207 1.0E-38
sp|Q8CIE6|COPA_MOUSE Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 5 207 1.0E-38
sp|Q27954|COPA_BOVIN Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 5 207 3.0E-38
sp|Q55FR9|COPA_DICDI Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 5 209 6.0E-32
sp|Q96WV5|COPA_SCHPO Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 1 209 5.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53621|COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 5 207 1.0E-38
sp|Q8CIE6|COPA_MOUSE Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 5 207 1.0E-38
sp|Q27954|COPA_BOVIN Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 5 207 3.0E-38
sp|Q55FR9|COPA_DICDI Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 5 209 6.0E-32
sp|Q96WV5|COPA_SCHPO Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 1 209 5.0E-31
sp|Q94A40|COPA1_ARATH Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 5 205 4.0E-29
sp|Q9SJT9|COPA2_ARATH Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 3 205 1.0E-27
sp|Q0J3D9|COPA3_ORYSJ Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 5 205 4.0E-27
sp|Q9AUR7|COPA2_ORYSJ Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 5 205 7.0E-27
sp|Q9AUR8|COPA1_ORYSJ Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 5 205 8.0E-27
sp|P53622|COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 1 207 8.0E-26
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0030126 COPI vesicle coat Yes
GO:0016192 vesicle-mediated transport Yes
GO:0005198 structural molecule activity Yes
GO:0006886 intracellular protein transport Yes
GO:0051641 cellular localization No
GO:0051649 establishment of localization in cell No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0030117 membrane coat No
GO:0008150 biological_process No
GO:0071702 organic substance transport No
GO:0071705 nitrogen compound transport No
GO:0098796 membrane protein complex No
GO:0005488 binding No
GO:0070727 cellular macromolecule localization No
GO:0006810 transport No
GO:0030120 vesicle coat No
GO:0045184 establishment of protein localization No
GO:0009987 cellular process No
GO:0032991 protein-containing complex No
GO:0015031 protein transport No
GO:0005575 cellular_component No
GO:0008104 protein localization No
GO:0033036 macromolecule localization No
GO:0003674 molecular_function No
GO:0046907 intracellular transport No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5152 0.5039 0.0855 0.1453 0.1266 0.0248 0.1757 0.4439 0.1316 0.0077

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7519
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-rufipedis Ophun1|914
Ophiocordyceps subramaniannii Hirsu2|2420 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2420
MKANKLEDGIKLFKGILHSILVNAVSSEGEVAEAKKLIISASEYTVAMDIEIARRKLGAAEAVAQDPVKLRRSLE
LSAYFTIPKIEVPHRQLALLSAMQLAVRNKNYKSALSFASRIIANGGSSKITDNAKKTKAQCERSPNDAVDIEFD
QFAEFDVCAASHTPIYSGTPFEECAFDGSKYHSKYKGTVCKVCEVCEVGKHGSGLKLFA*
Coding >Hirsu2|2420
ATGAAGGCGAACAAGCTGGAGGACGGCATCAAGCTGTTCAAAGGCATTCTGCACAGCATTCTCGTCAACGCCGTA
TCTAGCGAAGGCGAGGTGGCTGAGGCCAAGAAACTTATCATCTCAGCGAGCGAGTATACTGTGGCCATGGACATC
GAGATTGCGCGAAGGAAACTTGGCGCCGCCGAAGCTGTGGCTCAAGACCCTGTGAAGTTAAGAAGAAGTCTGGAG
TTGTCGGCGTACTTTACGATTCCTAAGATCGAAGTACCCCACAGACAACTCGCTCTATTGAGCGCCATGCAGTTG
GCCGTGCGAAATAAGAATTACAAGTCGGCTCTGAGTTTTGCCAGTCGCATCATAGCAAATGGCGGATCTAGCAAG
ATCACGGATAATGCCAAGAAAACGAAGGCTCAGTGCGAGAGAAGTCCCAACGACGCCGTCGACATTGAATTCGAT
CAATTCGCCGAGTTCGATGTGTGCGCCGCAAGCCACACTCCCATCTACAGTGGCACCCCCTTTGAAGAATGTGCC
TTCGACGGATCCAAGTATCACTCCAAGTACAAAGGAACCGTCTGCAAGGTCTGTGAGGTTTGCGAGGTTGGGAAG
CACGGCAGTGGCTTGAAGTTGTTCGCCTAG
Transcript >Hirsu2|2420
ATGAAGGCGAACAAGCTGGAGGACGGCATCAAGCTGTTCAAAGGCATTCTGCACAGCATTCTCGTCAACGCCGTA
TCTAGCGAAGGCGAGGTGGCTGAGGCCAAGAAACTTATCATCTCAGCGAGCGAGTATACTGTGGCCATGGACATC
GAGATTGCGCGAAGGAAACTTGGCGCCGCCGAAGCTGTGGCTCAAGACCCTGTGAAGTTAAGAAGAAGTCTGGAG
TTGTCGGCGTACTTTACGATTCCTAAGATCGAAGTACCCCACAGACAACTCGCTCTATTGAGCGCCATGCAGTTG
GCCGTGCGAAATAAGAATTACAAGTCGGCTCTGAGTTTTGCCAGTCGCATCATAGCAAATGGCGGATCTAGCAAG
ATCACGGATAATGCCAAGAAAACGAAGGCTCAGTGCGAGAGAAGTCCCAACGACGCCGTCGACATTGAATTCGAT
CAATTCGCCGAGTTCGATGTGTGCGCCGCAAGCCACACTCCCATCTACAGTGGCACCCCCTTTGAAGAATGTGCC
TTCGACGGATCCAAGTATCACTCCAAGTACAAAGGAACCGTCTGCAAGGTCTGTGAGGTTTGCGAGGTTGGGAAG
CACGGCAGTGGCTTGAAGTTGTTCGCCTAG
Gene >Hirsu2|2420
ATGAAGGCGAACAAGCTGGAGGACGGCATCAAGCTGTTCAAAGGCATTCTGCACAGCATTCTCGTCAACGCCGTA
TCTAGCGAAGGCGAGGTGGCTGAGGCCAAGAAACTTATCATCTCAGCGAGCGAGTATACTGTGGCCATGGACATC
GAGATTGCGCGAAGGAAACTTGGCGCCGCCGAAGCTGTGGCTCAAGACCCTGTGAAGTTAAGAAGAAGTCTGGAG
TTGTCGGCGTACTTTACGATTCCTAAGATCGAAGTACCCCACAGACAACTCGCTCTATTGAGCGCCATGCAGTTG
GCCGTGCGAAATAAGAATTACAAGTCGGCTCTGAGTTTTGCCAGTCGCATCATAGCAAATGGCGGATCTAGCAAG
ATCACGGATAATGTACGTCTGGGTGAACCAATACACATATGAACACCATACATACTAATCAGCATGTCATATCTT
ACAGGCCAAGAAAACGAAGGCTCAGTGCGAGAGAAGTCCCAACGACGCCGTCGACATTGAATTCGATCAATTCGC
CGAGTTCGATGTGTGCGCCGCAAGCCACACTCCCATCTACAGTGGCACCCCCTTTGAAGAATGTGCCTTCGACGG
ATCCAAGTATCACTCCAAGTACAAAGGAACCGTCTGCAAGGTCTGTGAGGTTTGCGAGGTTGGGAAGCACGGCAG
TGGCTTGAAGTTGTTCGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail