Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2419
Gene name
LocationContig_1579:307..3349
Strand+
Gene length (bp)3042
Transcript length (bp)2751
Coding sequence length (bp)2751
Protein length (aa) 917

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04053 Coatomer_WDAD Coatomer WD associated region 4.3E-145 350 778
PF00400 WD40 WD domain, G-beta repeat 7.8E-05 51 85
PF00400 WD40 WD domain, G-beta repeat 1.5E-07 90 127
PF00400 WD40 WD domain, G-beta repeat 1.8E-04 133 169
PF00400 WD40 WD domain, G-beta repeat 3.6E-04 210 242
PF00400 WD40 WD domain, G-beta repeat 4.7E-05 252 287

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96WV5|COPA_SCHPO Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 7 894 0.0E+00
sp|P53622|COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 7 892 0.0E+00
sp|Q27954|COPA_BOVIN Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 7 903 0.0E+00
sp|P53621|COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 7 890 0.0E+00
sp|Q8CIE6|COPA_MOUSE Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 7 903 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96WV5|COPA_SCHPO Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 7 894 0.0E+00
sp|P53622|COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 7 892 0.0E+00
sp|Q27954|COPA_BOVIN Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 7 903 0.0E+00
sp|P53621|COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 7 890 0.0E+00
sp|Q8CIE6|COPA_MOUSE Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 7 903 0.0E+00
sp|Q9SJT9|COPA2_ARATH Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 7 834 0.0E+00
sp|Q9AUR7|COPA2_ORYSJ Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 7 897 0.0E+00
sp|Q0J3D9|COPA3_ORYSJ Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 7 893 0.0E+00
sp|Q9AUR8|COPA1_ORYSJ Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 7 893 0.0E+00
sp|Q94A40|COPA1_ARATH Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 7 863 0.0E+00
sp|Q55FR9|COPA_DICDI Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 7 828 0.0E+00
sp|P35605|COPB2_BOVIN Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 10 777 2.0E-77
sp|O55029|COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 10 777 2.0E-77
sp|O35142|COPB2_RAT Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 10 777 4.0E-77
sp|Q5R664|COPB2_PONAB Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 10 777 4.0E-77
sp|P35606|COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 10 777 6.0E-77
sp|Q4R4I8|COPB2_MACFA Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 10 777 2.0E-76
sp|Q8L828|COB23_ARATH Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 10 777 2.0E-75
sp|Q9C827|COB22_ARATH Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1 10 777 2.0E-75
sp|O62621|COPB2_DROME Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 10 777 1.0E-74
sp|Q5VQ78|COB21_ORYSJ Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 10 881 1.0E-74
sp|Q20168|COPB2_CAEEL Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3 10 778 3.0E-74
sp|Q9CAA0|COB21_ARATH Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2 10 777 3.0E-73
sp|O42937|COPB2_SCHPO Probable coatomer subunit beta' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec27 PE=3 SV=2 10 787 3.0E-72
sp|Q6H8D6|COB23_ORYSJ Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2 10 777 2.0E-70
sp|P41811|COPB2_YEAST Coatomer subunit beta' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC27 PE=1 SV=1 11 783 5.0E-70
sp|Q6H8D5|COB22_ORYSJ Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1 10 777 2.0E-69
sp|Q54YD8|COPB2_DICDI Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 10 745 1.0E-64
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 3 322 1.0E-35
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 3 322 3.0E-32
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 19 318 6.0E-31
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 3 300 1.0E-29
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 11 325 1.0E-29
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 3 297 2.0E-29
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 21 298 8.0E-29
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 3 375 2.0E-28
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 56 332 3.0E-28
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 22 322 5.0E-28
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 18 288 5.0E-28
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 56 291 5.0E-28
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 21 322 3.0E-27
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 21 319 8.0E-27
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 21 287 1.0E-26
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 21 288 1.0E-26
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 21 330 1.0E-26
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 37 328 1.0E-26
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 21 288 1.0E-26
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 5 292 2.0E-26
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 56 297 2.0E-26
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 21 288 2.0E-26
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 21 327 3.0E-26
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 21 287 6.0E-26
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 21 288 1.0E-25
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 21 287 1.0E-25
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 56 297 1.0E-25
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 21 288 1.0E-25
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 56 291 2.0E-25
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 49 328 2.0E-25
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 48 319 2.0E-25
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 21 288 3.0E-25
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 8 317 4.0E-25
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 56 297 4.0E-25
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 21 288 4.0E-25
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 71 321 4.0E-25
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 56 297 5.0E-25
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 21 288 5.0E-25
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 21 288 5.0E-25
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 21 288 5.0E-25
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 21 288 5.0E-25
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 56 297 5.0E-25
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 56 297 6.0E-25
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 56 297 6.0E-25
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 56 297 6.0E-25
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 56 297 6.0E-25
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 71 333 6.0E-25
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 71 333 6.0E-25
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 56 297 7.0E-25
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 56 297 7.0E-25
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 21 288 8.0E-25
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 21 297 8.0E-25
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 21 293 8.0E-25
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 21 288 9.0E-25
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 21 288 9.0E-25
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 56 297 9.0E-25
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 56 297 9.0E-25
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 21 287 9.0E-25
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 56 319 9.0E-25
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 56 319 9.0E-25
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 56 319 9.0E-25
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 21 318 9.0E-25
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 21 287 1.0E-24
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 21 287 1.0E-24
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 21 288 1.0E-24
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 21 288 1.0E-24
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 56 297 1.0E-24
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 56 319 1.0E-24
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 56 289 1.0E-24
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 21 287 1.0E-24
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 53 289 1.0E-24
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 56 297 2.0E-24
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 56 297 2.0E-24
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 56 297 2.0E-24
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 21 287 2.0E-24
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 21 287 2.0E-24
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 21 287 2.0E-24
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 21 287 2.0E-24
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 21 287 3.0E-24
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 21 287 3.0E-24
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 21 289 3.0E-24
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 21 287 4.0E-24
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 5 289 4.0E-24
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 21 287 5.0E-24
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 71 333 5.0E-24
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 21 288 7.0E-24
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 21 287 8.0E-24
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 21 287 8.0E-24
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 50 330 1.0E-23
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 71 339 1.0E-23
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 21 304 1.0E-23
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 21 288 1.0E-23
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 5 357 3.0E-23
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 71 290 4.0E-23
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 4 328 4.0E-23
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 21 287 4.0E-23
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 48 328 6.0E-23
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 4 319 9.0E-23
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 56 319 1.0E-22
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 38 288 1.0E-22
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 71 290 1.0E-22
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 58 298 2.0E-22
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 56 301 2.0E-22
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 5 354 2.0E-22
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 21 347 2.0E-22
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 51 328 2.0E-22
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 2 347 3.0E-22
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 21 319 3.0E-22
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 21 319 3.0E-22
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 5 328 4.0E-22
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 22 284 4.0E-22
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 56 289 4.0E-22
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 20 289 5.0E-22
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 10 289 6.0E-22
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 21 328 7.0E-22
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 21 328 7.0E-22
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 15 319 8.0E-22
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 20 286 8.0E-22
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 21 328 1.0E-21
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 10 289 1.0E-21
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 37 328 1.0E-21
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 37 328 2.0E-21
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 21 289 2.0E-21
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 11 286 2.0E-21
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 5 344 2.0E-21
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 21 242 2.0E-21
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 21 328 2.0E-21
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 10 289 3.0E-21
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 21 289 3.0E-21
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 23 328 3.0E-21
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 10 289 4.0E-21
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 4 244 4.0E-21
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 21 328 4.0E-21
sp|Q2GT28|LIS12_CHAGB Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 11 289 4.0E-21
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 3 170 5.0E-21
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 21 259 5.0E-21
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 25 282 5.0E-21
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 11 286 6.0E-21
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 37 328 7.0E-21
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 10 244 1.0E-20
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 56 297 2.0E-20
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 39 328 2.0E-20
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 39 328 2.0E-20
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 21 292 3.0E-20
sp|Q0D0X6|LIS1_ASPTN Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 53 290 4.0E-20
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 56 310 5.0E-20
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 56 297 5.0E-20
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 56 297 6.0E-20
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 56 297 6.0E-20
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 56 297 6.0E-20
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 56 297 7.0E-20
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 56 297 8.0E-20
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 56 297 8.0E-20
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 56 297 8.0E-20
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 56 297 8.0E-20
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 53 319 1.0E-19
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 30 289 1.0E-19
sp|Q54YD8|COPB2_DICDI Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 8 185 2.0E-19
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 56 304 2.0E-19
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 53 289 2.0E-19
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 11 246 2.0E-19
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 53 304 2.0E-19
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 42 297 3.0E-19
sp|Q6C709|PRP46_YARLI Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 56 327 3.0E-19
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 21 242 4.0E-19
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 21 267 4.0E-19
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 22 277 4.0E-19
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 21 328 5.0E-19
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 11 286 5.0E-19
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 53 327 5.0E-19
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 5 170 6.0E-19
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 5 170 6.0E-19
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 23 328 6.0E-19
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 5 170 7.0E-19
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 11 286 8.0E-19
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 21 290 9.0E-19
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 1 242 1.0E-18
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 11 286 1.0E-18
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 23 328 1.0E-18
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 11 246 1.0E-18
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 11 246 1.0E-18
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 25 246 1.0E-18
sp|A2QP30|LIS1_ASPNC Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 53 290 1.0E-18
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 21 286 1.0E-18
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 21 286 1.0E-18
sp|Q5BE22|PRP46_EMENI Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 19 286 1.0E-18
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 95 333 2.0E-18
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 56 297 2.0E-18
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 5 170 2.0E-18
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 39 296 2.0E-18
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 48 333 2.0E-18
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 53 291 2.0E-18
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 53 291 2.0E-18
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 53 288 2.0E-18
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 53 288 2.0E-18
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 25 259 2.0E-18
sp|B8M0Q1|LIS1_TALSN Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 11 270 2.0E-18
sp|C4JZS6|LIS11_UNCRE Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 56 290 2.0E-18
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 5 170 3.0E-18
sp|Q4X0A9|SCONB_ASPFU Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 35 297 3.0E-18
sp|B0XTS1|SCONB_ASPFC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 35 297 3.0E-18
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 25 259 3.0E-18
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 49 319 4.0E-18
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 11 290 4.0E-18
sp|B6GZD3|LIS12_PENRW Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 50 335 4.0E-18
sp|Q12417|PRP46_YEAST Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 72 327 4.0E-18
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 38 327 5.0E-18
sp|Q8W117|SMU1_ARATH Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 5 286 5.0E-18
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 28 286 6.0E-18
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 95 333 7.0E-18
sp|Q2GT28|LIS12_CHAGB Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 25 246 7.0E-18
sp|A1DHW6|SCONB_NEOFI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 35 297 7.0E-18
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 21 246 9.0E-18
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 21 246 9.0E-18
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 21 259 1.0E-17
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 21 259 1.0E-17
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 48 333 1.0E-17
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 39 272 1.0E-17
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 11 286 1.0E-17
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 53 290 1.0E-17
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 25 259 1.0E-17
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 21 319 1.0E-17
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 19 286 1.0E-17
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 38 327 1.0E-17
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 19 286 1.0E-17
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 38 286 2.0E-17
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 38 286 2.0E-17
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 38 286 2.0E-17
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 38 286 2.0E-17
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 38 286 2.0E-17
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 53 304 2.0E-17
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 53 304 2.0E-17
sp|P42527|MHCKA_DICDI Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 43 294 2.0E-17
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 21 246 2.0E-17
sp|Q39190|PRL2_ARATH Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 53 241 2.0E-17
sp|A2QCU8|SCONB_ASPNC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 35 297 2.0E-17
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 48 327 2.0E-17
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 8 286 2.0E-17
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 50 314 2.0E-17
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 20 289 2.0E-17
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 15 185 3.0E-17
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 11 286 3.0E-17
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 95 333 3.0E-17
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 20 242 3.0E-17
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 38 320 4.0E-17
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 25 266 4.0E-17
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 52 290 4.0E-17
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 52 290 4.0E-17
sp|D1ZEM6|LIS12_SORMK Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 53 290 4.0E-17
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 19 286 4.0E-17
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 19 289 5.0E-17
sp|P0CS48|PRP46_CRYNJ Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 19 286 5.0E-17
sp|B6QC56|LIS11_TALMQ Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 11 246 5.0E-17
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 72 327 5.0E-17
sp|D1ZEM6|LIS12_SORMK Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 25 266 6.0E-17
sp|Q7S7L4|LIS12_NEUCR Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 25 266 6.0E-17
sp|P0CS49|PRP46_CRYNB Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 19 286 6.0E-17
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 20 333 6.0E-17
sp|Q6CKE8|PRP46_KLULA Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 72 327 6.0E-17
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 49 319 7.0E-17
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 48 328 7.0E-17
sp|A7EKM8|LIS1_SCLS1 Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 25 259 7.0E-17
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 39 286 8.0E-17
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 53 290 8.0E-17
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 53 290 8.0E-17
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 53 304 8.0E-17
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 8 287 9.0E-17
sp|Q6CG48|LIS1_YARLI Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 56 290 9.0E-17
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 5 170 1.0E-16
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 53 304 1.0E-16
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 21 319 1.0E-16
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 21 304 1.0E-16
sp|Q7S7L4|LIS12_NEUCR Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 53 290 1.0E-16
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 19 286 1.0E-16
sp|Q00664|LIS1_EMENI Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 56 290 1.0E-16
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 21 286 1.0E-16
sp|C7Z6H2|LIS1_NECH7 Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 25 246 1.0E-16
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 37 307 1.0E-16
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 70 169 2.0E-16
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 95 333 2.0E-16
sp|Q4ICM0|LIS1_GIBZE Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 53 304 2.0E-16
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 25 259 2.0E-16
sp|D1ZEB4|LIS11_SORMK Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 25 259 2.0E-16
sp|Q54Y96|SMU1_DICDI WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 10 328 2.0E-16
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 45 287 3.0E-16
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 43 286 3.0E-16
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 49 327 3.0E-16
sp|Q4ICM0|LIS1_GIBZE Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 25 246 3.0E-16
sp|O48847|LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 71 328 3.0E-16
sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 53 332 3.0E-16
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 40 315 3.0E-16
sp|Q7RY30|LIS11_NEUCR Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 25 259 3.0E-16
sp|Q4I7X1|PFS2_GIBZE Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 19 264 3.0E-16
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 53 290 3.0E-16
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 53 290 3.0E-16
sp|C7Z6H2|LIS1_NECH7 Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 53 304 4.0E-16
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 28 297 4.0E-16
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 53 290 5.0E-16
sp|Q9FUY2|LEUNG_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana GN=LUG PE=1 SV=2 65 328 5.0E-16
sp|Q5BE22|PRP46_EMENI Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 6 327 6.0E-16
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 40 315 6.0E-16
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 39 286 7.0E-16
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 49 319 7.0E-16
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 43 298 7.0E-16
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 25 259 7.0E-16
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 25 259 7.0E-16
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 38 246 8.0E-16
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 38 246 8.0E-16
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 39 292 8.0E-16
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 71 328 8.0E-16
sp|P0CS48|PRP46_CRYNJ Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 56 327 9.0E-16
sp|P0CS49|PRP46_CRYNB Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 56 327 9.0E-16
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 60 287 9.0E-16
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 60 287 9.0E-16
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 49 319 1.0E-15
sp|Q6C709|PRP46_YARLI Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 19 170 1.0E-15
sp|C4JZS6|LIS11_UNCRE Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 21 246 1.0E-15
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 56 339 1.0E-15
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 10 246 1.0E-15
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 10 246 1.0E-15
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 56 325 1.0E-15
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 56 325 1.0E-15
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 53 290 1.0E-15
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 72 301 1.0E-15
sp|A1CUD6|LIS11_ASPCL Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 11 246 1.0E-15
sp|Q2HBX6|LIS11_CHAGB Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 25 246 1.0E-15
sp|Q20168|COPB2_CAEEL Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3 6 148 2.0E-15
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 43 298 2.0E-15
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 19 170 2.0E-15
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 56 325 2.0E-15
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 72 301 2.0E-15
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 38 330 2.0E-15
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 53 290 2.0E-15
sp|Q6CGP9|PFS2_YARLI Polyadenylation factor subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFS2 PE=3 SV=1 6 298 2.0E-15
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 46 331 2.0E-15
sp|Q2GT28|LIS12_CHAGB Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 94 348 3.0E-15
sp|Q6C709|PRP46_YARLI Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 17 253 3.0E-15
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 21 242 3.0E-15
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 25 259 3.0E-15
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 30 298 3.0E-15
sp|B4HND9|WDR48_DROSE WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 54 338 3.0E-15
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 72 298 3.0E-15
sp|B4QB64|WDR48_DROSI WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 54 338 3.0E-15
sp|P62884|GBLP_LEIIN Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 95 309 3.0E-15
sp|P62883|GBLP_LEICH Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 95 309 3.0E-15
sp|Q25306|GBLP_LEIMA Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 95 309 3.0E-15
sp|B4P7H8|WDR48_DROYA WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 54 338 4.0E-15
sp|B2AEZ5|LIS11_PODAN Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 25 246 4.0E-15
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 46 357 4.0E-15
sp|Q8C7V3|UTP15_MOUSE U3 small nucleolar RNA-associated protein 15 homolog OS=Mus musculus GN=Utp15 PE=1 SV=1 21 356 4.0E-15
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 21 171 5.0E-15
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 53 319 5.0E-15
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 65 322 5.0E-15
sp|Q12417|PRP46_YEAST Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 29 246 5.0E-15
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 20 289 5.0E-15
sp|B6QC06|LIS12_TALMQ Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 5 259 5.0E-15
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 7 286 5.0E-15
sp|B3NSK1|WDR48_DROER WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 54 338 5.0E-15
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 12 318 6.0E-15
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 25 259 6.0E-15
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 37 170 6.0E-15
sp|Q1LZ08|WDR48_DROME WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 54 338 6.0E-15
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 38 241 6.0E-15
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 30 335 6.0E-15
sp|Q6FJS0|PFS2_CANGA Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 29 253 6.0E-15
sp|P58405|STRN3_RAT Striatin-3 OS=Rattus norvegicus GN=Strn3 PE=1 SV=2 19 327 6.0E-15
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 23 291 7.0E-15
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 53 332 7.0E-15
sp|B3MET8|WDR48_DROAN WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 54 329 7.0E-15
sp|A5D7H2|STRN3_BOVIN Striatin-3 OS=Bos taurus GN=STRN3 PE=2 SV=1 19 327 7.0E-15
sp|C4JPW9|LIS12_UNCRE Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 25 246 8.0E-15
sp|Q28YY2|WDR48_DROPS WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 54 338 8.0E-15
sp|B4GIJ0|WDR48_DROPE WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 54 338 8.0E-15
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 21 242 9.0E-15
sp|Q7RY30|LIS11_NEUCR Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 53 290 9.0E-15
sp|Q9ERG2|STRN3_MOUSE Striatin-3 OS=Mus musculus GN=Strn3 PE=1 SV=1 19 327 9.0E-15
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 30 298 9.0E-15
sp|Q6BU94|PRP46_DEBHA Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 56 327 9.0E-15
sp|P38011|GBLP_YEAST Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 53 330 9.0E-15
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 21 302 1.0E-14
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 95 331 1.0E-14
sp|D1ZEB4|LIS11_SORMK Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 53 290 1.0E-14
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 20 289 1.0E-14
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 38 297 1.0E-14
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 38 170 1.0E-14
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 21 325 1.0E-14
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 8 286 1.0E-14
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 72 288 1.0E-14
sp|P87060|POP1_SCHPO WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 30 330 1.0E-14
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 72 288 1.0E-14
sp|A7MB12|UTP15_BOVIN U3 small nucleolar RNA-associated protein 15 homolog OS=Bos taurus GN=UTP15 PE=2 SV=1 21 356 1.0E-14
sp|Q13033|STRN3_HUMAN Striatin-3 OS=Homo sapiens GN=STRN3 PE=1 SV=3 19 327 1.0E-14
sp|P0CS48|PRP46_CRYNJ Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 16 160 2.0E-14
sp|P0CS49|PRP46_CRYNB Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 16 160 2.0E-14
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 72 301 2.0E-14
sp|Q5ZME8|SMU1_CHICK WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 10 286 2.0E-14
sp|B6Q4Z5|SCONB_TALMQ Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 35 297 2.0E-14
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 60 319 2.0E-14
sp|Q8TED0|UTP15_HUMAN U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens GN=UTP15 PE=1 SV=3 21 356 2.0E-14
sp|Q9C270|PWP2_NEUCR Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 11 244 2.0E-14
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 8 168 3.0E-14
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 94 333 3.0E-14
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 94 289 3.0E-14
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 30 344 3.0E-14
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 38 329 3.0E-14
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 37 185 3.0E-14
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 38 241 3.0E-14
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 37 243 4.0E-14
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 7 168 4.0E-14
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 7 168 4.0E-14
sp|Q3UKJ7|SMU1_MOUSE WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 10 286 4.0E-14
sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 10 286 4.0E-14
sp|Q76B40|SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 10 286 4.0E-14
sp|Q2TBS9|SMU1_BOVIN WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 10 286 4.0E-14
sp|Q99M63|SMU1_RAT WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 10 286 4.0E-14
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 101 334 4.0E-14
sp|B4KRQ4|WDR48_DROMO WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 54 329 4.0E-14
sp|Q5A7Q3|PRP46_CANAL Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1 56 327 4.0E-14
sp|B4MFM2|WDR48_DROVI WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 54 329 4.0E-14
sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 30 289 4.0E-14
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 30 286 5.0E-14
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 93 291 5.0E-14
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 7 168 5.0E-14
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 53 325 5.0E-14
sp|Q2HBX6|LIS11_CHAGB Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 21 290 5.0E-14
sp|O55106|STRN_MOUSE Striatin OS=Mus musculus GN=Strn PE=1 SV=2 19 327 5.0E-14
sp|Q6FJZ9|PRP46_CANGA Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 56 327 5.0E-14
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 38 241 5.0E-14
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 38 241 5.0E-14
sp|A2RRU3|UTP15_RAT U3 small nucleolar RNA-associated protein 15 homolog OS=Rattus norvegicus GN=Utp15 PE=2 SV=1 21 328 5.0E-14
sp|Q8BHB4|WDR3_MOUSE WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 23 303 5.0E-14
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 21 242 6.0E-14
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 21 169 6.0E-14
sp|P58404|STRN4_MOUSE Striatin-4 OS=Mus musculus GN=Strn4 PE=1 SV=2 19 327 6.0E-14
sp|Q8BH57|WDR48_MOUSE WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 71 367 6.0E-14
sp|B4J8H6|WDR48_DROGR WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 54 329 6.0E-14
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 55 319 7.0E-14
sp|A7EKM8|LIS1_SCLS1 Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 53 288 7.0E-14
sp|Q9NRL3|STRN4_HUMAN Striatin-4 OS=Homo sapiens GN=STRN4 PE=1 SV=2 19 327 7.0E-14
sp|P25635|PWP2_YEAST Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 11 292 7.0E-14
sp|C4YPI7|LIS1_CANAW Nuclear distribution protein PAC1 OS=Candida albicans (strain WO-1) GN=PAC1 PE=3 SV=1 60 288 7.0E-14
sp|Q5A7Q6|LIS1_CANAL Nuclear distribution protein PAC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAC1 PE=3 SV=1 60 288 7.0E-14
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 53 325 8.0E-14
sp|Q12417|PRP46_YEAST Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 18 251 8.0E-14
sp|Q39190|PRL2_ARATH Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 19 170 8.0E-14
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 95 329 8.0E-14
sp|Q6CG48|LIS1_YARLI Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 20 286 8.0E-14
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 37 329 8.0E-14
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 72 288 8.0E-14
sp|O43815|STRN_HUMAN Striatin OS=Homo sapiens GN=STRN PE=1 SV=4 19 327 8.0E-14
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 93 291 9.0E-14
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 93 291 9.0E-14
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 93 291 9.0E-14
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 37 329 9.0E-14
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 93 291 1.0E-13
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 93 291 1.0E-13
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 23 286 1.0E-13
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 56 312 1.0E-13
sp|Q6CKE8|PRP46_KLULA Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 29 170 1.0E-13
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 37 329 1.0E-13
sp|Q7ZVA0|SMU1_DANRE WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 10 286 1.0E-13
sp|Q6L4F8|GBLPB_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 52 304 1.0E-13
sp|Q09990|LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 72 330 1.0E-13
sp|O18640|GBLP_DROME Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 38 171 1.0E-13
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 72 288 1.0E-13
sp|Q6PFM9|WDR48_DANRE WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 71 329 1.0E-13
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 72 367 2.0E-13
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 130 325 2.0E-13
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 93 291 2.0E-13
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 21 178 2.0E-13
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 23 242 2.0E-13
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 53 333 2.0E-13
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 93 316 2.0E-13
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 95 325 2.0E-13
sp|C4JPW9|LIS12_UNCRE Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 53 334 2.0E-13
sp|Q6P4J8|SMU1_XENTR WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 10 286 2.0E-13
sp|P39014|MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 6 297 2.0E-13
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 72 288 2.0E-13
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 38 247 2.0E-13
sp|Q6NRT3|SMU1_XENLA WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 10 286 2.0E-13
sp|O22212|PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 7 245 2.0E-13
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 53 292 2.0E-13
sp|P70483|STRN_RAT Striatin OS=Rattus norvegicus GN=Strn PE=1 SV=1 19 327 2.0E-13
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 8 286 2.0E-13
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 93 291 3.0E-13
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 93 367 3.0E-13
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 95 395 3.0E-13
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 17 220 3.0E-13
sp|Q39190|PRL2_ARATH Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 95 331 3.0E-13
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 72 319 3.0E-13
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 56 288 3.0E-13
sp|Q6FJZ9|PRP46_CANGA Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 29 170 3.0E-13
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 56 288 3.0E-13
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 56 288 3.0E-13
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 30 296 3.0E-13
sp|Q09990|LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 8 288 3.0E-13
sp|A8ILK1|CFA52_CHLRE Cilia- and flagella-associated protein 52 OS=Chlamydomonas reinhardtii GN=CFAP52 PE=1 SV=1 17 290 3.0E-13
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 81 325 3.0E-13
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 21 169 3.0E-13
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 93 367 4.0E-13
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 93 367 4.0E-13
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 93 367 4.0E-13
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 93 367 4.0E-13
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 93 367 4.0E-13
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 93 313 4.0E-13
sp|Q6C709|PRP46_YARLI Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 95 358 4.0E-13
sp|B9WD30|LIS1_CANDC Nuclear distribution protein PAC1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=PAC1 PE=3 SV=1 60 288 4.0E-13
sp|Q8VDD9|PHIP_MOUSE PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2 44 331 4.0E-13
sp|Q75BY3|PRP46_ASHGO Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 29 170 4.0E-13
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 93 312 5.0E-13
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 93 367 5.0E-13
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 93 367 5.0E-13
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 7 168 5.0E-13
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 7 168 5.0E-13
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 7 168 5.0E-13
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 93 291 5.0E-13
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 93 291 5.0E-13
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 7 168 5.0E-13
sp|P42527|MHCKA_DICDI Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 29 185 5.0E-13
sp|Q9GZS3|WDR61_HUMAN WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 45 307 5.0E-13
sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 38 297 5.0E-13
sp|Q4R2Z6|WDR48_MACFA WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 71 329 5.0E-13
sp|Q32PG3|WDR48_BOVIN WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 71 367 5.0E-13
sp|Q8TAF3|WDR48_HUMAN WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 71 367 5.0E-13
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 93 367 6.0E-13
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 7 168 6.0E-13
sp|P83774|GBLP_CANAL Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 38 171 6.0E-13
sp|Q5F3K4|WDR48_CHICK WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 71 367 6.0E-13
sp|Q7T2F6|WSB1_DANRE WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 30 286 6.0E-13
sp|Q5RAW8|WDR48_PONAB WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 71 367 6.0E-13
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 93 392 7.0E-13
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 6 129 7.0E-13
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 93 367 7.0E-13
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 93 312 7.0E-13
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 53 333 7.0E-13
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 30 288 7.0E-13
sp|Q5REE0|UTP15_PONAB U3 small nucleolar RNA-associated protein 15 homolog OS=Pongo abelii GN=UTP15 PE=2 SV=1 21 356 7.0E-13
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 3 243 8.0E-13
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 93 316 8.0E-13
sp|Q05B17|WDR48_XENTR WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 71 364 8.0E-13
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 8 286 8.0E-13
sp|Q9Y6I7|WSB1_HUMAN WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 14 286 8.0E-13
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 3 261 9.0E-13
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 23 242 9.0E-13
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 30 303 9.0E-13
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 93 392 1.0E-12
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 93 322 1.0E-12
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 94 368 1.0E-12
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 93 291 1.0E-12
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 93 291 1.0E-12
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 6 243 1.0E-12
sp|B8M0Q1|LIS1_TALSN Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 93 322 1.0E-12
sp|Q39190|PRL2_ARATH Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 128 329 1.0E-12
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 95 392 1.0E-12
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 95 392 1.0E-12
sp|B2AEZ5|LIS11_PODAN Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 53 290 1.0E-12
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 56 288 1.0E-12
sp|Q6BU94|PRP46_DEBHA Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 29 286 1.0E-12
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 30 303 1.0E-12
sp|Q5A7Q3|PRP46_CANAL Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1 29 170 1.0E-12
sp|Q8WWQ0|PHIP_HUMAN PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2 44 331 1.0E-12
sp|Q59WJ4|PFS2_CANAL Polyadenylation factor subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFS2 PE=3 SV=1 29 251 1.0E-12
sp|P42841|PFS2_YEAST Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 29 253 1.0E-12
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 89 319 1.0E-12
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 11 172 1.0E-12
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 115 325 2.0E-12
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 95 392 2.0E-12
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 53 304 2.0E-12
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 53 304 2.0E-12
sp|P0CS49|PRP46_CRYNB Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 95 323 2.0E-12
sp|B6Q4Z5|SCONB_TALMQ Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 42 258 2.0E-12
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 30 288 2.0E-12
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 35 170 2.0E-12
sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 34 258 2.0E-12
sp|A1C7E4|SCONB_ASPCL Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 38 297 2.0E-12
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 38 247 2.0E-12
sp|P74598|Y1491_SYNY3 Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 94 289 2.0E-12
sp|B8NGT5|SCONB_ASPFN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 27 264 2.0E-12
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 20 319 2.0E-12
sp|Q2UFN8|SCONB_ASPOR Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 27 264 2.0E-12
sp|O54927|WSB1_MOUSE WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 14 286 2.0E-12
sp|C5MJE8|LIS1_CANTT Nuclear distribution protein PAC1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=PAC1 PE=3 SV=1 60 288 2.0E-12
sp|Q39336|GBLP_BRANA Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 39 178 2.0E-12
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 23 243 3.0E-12
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 93 323 3.0E-12
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 93 295 3.0E-12
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 93 295 3.0E-12
sp|P0CS48|PRP46_CRYNJ Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 95 323 3.0E-12
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 71 341 3.0E-12
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 35 170 3.0E-12
sp|A0AUS0|WSDU1_DANRE WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 37 301 3.0E-12
sp|Q6BVZ3|PFS2_DEBHA Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2 21 314 3.0E-12
sp|Q9UNX4|WDR3_HUMAN WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 23 287 3.0E-12
sp|B4GDM7|CIAO1_DROPE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 46 286 3.0E-12
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 11 172 3.0E-12
sp|Q676U5|A16L1_HUMAN Autophagy-related protein 16-1 OS=Homo sapiens GN=ATG16L1 PE=1 SV=2 53 209 3.0E-12
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 11 172 3.0E-12
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 19 296 3.0E-12
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 11 172 3.0E-12
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 93 312 4.0E-12
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 95 311 4.0E-12
sp|O22212|PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 12 172 4.0E-12
sp|Q292E8|CIAO1_DROPS Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 46 286 4.0E-12
sp|Q39836|GBLP_SOYBN Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 30 298 4.0E-12
sp|Q21215|GBLP_CAEEL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 94 309 4.0E-12
sp|O24076|GBLP_MEDSA Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 30 298 4.0E-12
sp|Q9UTN4|PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 6 259 4.0E-12
sp|Q9DC48|PRP17_MOUSE Pre-mRNA-processing factor 17 OS=Mus musculus GN=Cdc40 PE=2 SV=1 8 287 4.0E-12
sp|D4D8P3|SCONB_TRIVH Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 27 249 4.0E-12
sp|D4AM37|SCONB_ARTBC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 27 249 4.0E-12
sp|O24456|GBLPA_ARATH Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 39 178 4.0E-12
sp|O60508|PRP17_HUMAN Pre-mRNA-processing factor 17 OS=Homo sapiens GN=CDC40 PE=1 SV=1 8 287 4.0E-12
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 56 170 4.0E-12
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 94 289 5.0E-12
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 94 289 5.0E-12
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 19 168 5.0E-12
sp|Q6CKE8|PRP46_KLULA Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 95 395 5.0E-12
sp|P39014|MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 15 258 5.0E-12
sp|Q00659|SCONB_EMENI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 27 264 5.0E-12
sp|Q6CP71|PFS2_KLULA Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 29 245 5.0E-12
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 19 242 5.0E-12
sp|Q9W5Z5|WSB1_TAKRU WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1 14 293 5.0E-12
sp|P49027|GBLPA_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1 28 300 5.0E-12
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 28 126 6.0E-12
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 130 302 6.0E-12
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 130 302 6.0E-12
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 130 302 6.0E-12
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 6 292 6.0E-12
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 95 392 6.0E-12
sp|Q39336|GBLP_BRANA Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 43 298 6.0E-12
sp|Q55AR8|SNR40_DICDI U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 30 241 6.0E-12
sp|Q32LN7|WDR61_BOVIN WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 73 305 6.0E-12
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 130 302 7.0E-12
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 35 289 7.0E-12
sp|P38011|GBLP_YEAST Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 38 178 7.0E-12
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 21 170 7.0E-12
sp|B6GZA1|SCONB_PENRW Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 30 287 7.0E-12
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 53 309 7.0E-12
sp|Q8C0J2|A16L1_MOUSE Autophagy-related protein 16-1 OS=Mus musculus GN=Atg16l1 PE=1 SV=1 53 209 7.0E-12
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 130 302 9.0E-12
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 7 168 9.0E-12
sp|Q9ERF3|WDR61_MOUSE WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 73 305 9.0E-12
sp|Q5RAC9|A16L1_PONAB Autophagy-related protein 16-1 OS=Pongo abelii GN=ATG16L1 PE=2 SV=1 53 209 9.0E-12
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 3 143 1.0E-11
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 95 301 1.0E-11
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 38 286 1.0E-11
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 6 129 1.0E-11
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 6 129 1.0E-11
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 115 325 1.0E-11
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 188 297 1.0E-11
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 53 332 1.0E-11
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 21 327 1.0E-11
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 93 350 1.0E-11
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 95 392 1.0E-11
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 22 185 1.0E-11
sp|Q6FJZ9|PRP46_CANGA Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 18 249 1.0E-11
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 23 174 1.0E-11
sp|Q00659|SCONB_EMENI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 38 242 1.0E-11
sp|Q26544|WSL17_SCHMA WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 62 329 1.0E-11
sp|O42249|GBLP_ORENI Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 94 316 1.0E-11
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 35 170 1.0E-11
sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 81 305 1.0E-11
sp|Q5I0B9|ATG16_XENTR Autophagy-related protein 16 OS=Xenopus tropicalis GN=atg16 PE=2 SV=2 47 288 1.0E-11
sp|Q54LT8|STRAP_DICDI Serine-threonine kinase receptor-associated protein OS=Dictyostelium discoideum GN=strap PE=3 SV=1 47 286 1.0E-11
sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 2 244 1.0E-11
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 99 325 2.0E-11
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 130 302 2.0E-11
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 93 291 2.0E-11
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 6 129 2.0E-11
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 53 242 2.0E-11
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 56 301 2.0E-11
sp|Q4V7A0|WDR61_RAT WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 73 305 2.0E-11
sp|Q921C3|BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2 21 331 2.0E-11
sp|P49026|GBLP_TOBAC Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 39 178 2.0E-11
sp|Q4X1Y0|PFS2_ASPFU Polyadenylation factor subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfs2 PE=3 SV=1 19 260 2.0E-11
sp|Q9NSI6|BRWD1_HUMAN Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4 56 331 2.0E-11
sp|Q9Y2I8|WDR37_HUMAN WD repeat-containing protein 37 OS=Homo sapiens GN=WDR37 PE=1 SV=2 97 335 2.0E-11
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 6 245 3.0E-11
sp|D1ZEB4|LIS11_SORMK Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 94 357 3.0E-11
sp|Q7RY30|LIS11_NEUCR Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 94 357 3.0E-11
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 94 331 3.0E-11
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 23 288 3.0E-11
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 23 288 3.0E-11
sp|Q75BY3|PRP46_ASHGO Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 18 170 3.0E-11
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 60 319 3.0E-11
sp|O24456|GBLPA_ARATH Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 30 298 3.0E-11
sp|Q75AV4|PFS2_ASHGO Polyadenylation factor subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSF2 PE=3 SV=1 9 286 3.0E-11
sp|C5FP68|SCONB_ARTOC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 27 271 3.0E-11
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 9 319 3.0E-11
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 30 251 3.0E-11
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 30 251 3.0E-11
sp|P93340|GBLP_NICPL Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 39 178 3.0E-11
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 23 168 4.0E-11
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 90 411 4.0E-11
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 21 173 4.0E-11
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 23 288 4.0E-11
sp|A8Q2R5|WDR48_BRUMA WD repeat-containing protein 48 homolog OS=Brugia malayi GN=Bm1_41555 PE=3 SV=2 56 325 4.0E-11
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 9 319 4.0E-11
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 30 251 4.0E-11
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 6 243 5.0E-11
sp|B6GZD3|LIS12_PENRW Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 30 246 5.0E-11
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 95 329 5.0E-11
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 16 168 5.0E-11
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 38 242 5.0E-11
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 30 242 5.0E-11
sp|B8NGT5|SCONB_ASPFN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 38 297 5.0E-11
sp|Q2UFN8|SCONB_ASPOR Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 38 297 5.0E-11
sp|B6GZA1|SCONB_PENRW Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 27 266 5.0E-11
sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 30 251 5.0E-11
sp|P93340|GBLP_NICPL Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 71 309 5.0E-11
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 21 319 5.0E-11
sp|Q9T014|SPA2_ARATH Protein SPA1-RELATED 2 OS=Arabidopsis thaliana GN=SPA2 PE=1 SV=2 27 288 5.0E-11
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 9 319 5.0E-11
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 114 302 5.0E-11
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 30 251 5.0E-11
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 71 327 6.0E-11
sp|Q9SZQ5|VIP3_ARATH WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 71 311 6.0E-11
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 114 338 7.0E-11
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 95 389 7.0E-11
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 95 389 7.0E-11
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 57 286 7.0E-11
sp|P0CS47|PFS2_CRYNB Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 48 299 7.0E-11
sp|Q7PS24|CIAO1_ANOGA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 49 286 7.0E-11
sp|Q0CY32|SCONB_ASPTN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 27 258 7.0E-11
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 208 297 8.0E-11
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 71 329 8.0E-11
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 2 244 8.0E-11
sp|Q2TZG4|PFS2_ASPOR Polyadenylation factor subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfs2 PE=3 SV=1 30 349 8.0E-11
sp|P07834|CDC4_YEAST Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 10 200 8.0E-11
sp|P0CS46|PFS2_CRYNJ Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 48 299 8.0E-11
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 63 327 9.0E-11
sp|Q5ZJH5|WDR61_CHICK WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 45 307 9.0E-11
sp|Q6ZMY6|WDR88_HUMAN WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 30 290 9.0E-11
sp|Q15269|PWP2_HUMAN Periodic tryptophan protein 2 homolog OS=Homo sapiens GN=PWP2 PE=2 SV=2 22 302 9.0E-11
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 135 318 1.0E-10
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 13 247 1.0E-10
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 21 243 1.0E-10
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 95 329 1.0E-10
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 95 329 1.0E-10
sp|A1CUD6|LIS11_ASPCL Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 94 392 1.0E-10
sp|B6QC06|LIS12_TALMQ Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 94 290 1.0E-10
sp|A1C7E4|SCONB_ASPCL Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 27 264 1.0E-10
sp|Q6CP71|PFS2_KLULA Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 9 326 1.0E-10
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 21 168 1.0E-10
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 2 244 1.0E-10
sp|Q0CY32|SCONB_ASPTN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 38 297 1.0E-10
sp|Q2TZG4|PFS2_ASPOR Polyadenylation factor subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfs2 PE=3 SV=1 19 260 1.0E-10
sp|P40765|COPA_CANLF Coatomer subunit alpha (Fragment) OS=Canis lupus familiaris GN=COPA PE=1 SV=2 7 41 1.0E-10
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 37 171 1.0E-10
sp|Q12220|UTP12_YEAST U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 5 218 1.0E-10
sp|Q93134|GBLP_BIOGL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 48 316 1.0E-10
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 94 359 1.0E-10
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 81 328 1.0E-10
sp|B3NQR5|CIAO1_DROER Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 46 286 1.0E-10
sp|P69104|GBLP_TRYBR Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 38 171 1.0E-10
sp|P69103|GBLP_TRYBB Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 38 171 1.0E-10
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 136 302 2.0E-10
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 137 386 2.0E-10
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 23 168 2.0E-10
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 23 168 2.0E-10
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 21 244 2.0E-10
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 91 333 2.0E-10
sp|Q4X0A9|SCONB_ASPFU Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 27 264 2.0E-10
sp|B0XTS1|SCONB_ASPFC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 27 264 2.0E-10
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 62 327 2.0E-10
sp|B2AEZ5|LIS11_PODAN Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 94 289 2.0E-10
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 19 290 2.0E-10
sp|P83774|GBLP_CANAL Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 43 331 2.0E-10
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 57 286 2.0E-10
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 57 286 2.0E-10
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 57 286 2.0E-10
sp|Q21215|GBLP_CAEEL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 38 186 2.0E-10
sp|P49026|GBLP_TOBAC Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 71 298 2.0E-10
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 114 302 2.0E-10
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 114 302 2.0E-10
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 114 302 2.0E-10
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 21 288 2.0E-10
sp|B9WHJ2|CIAO1_CANDC Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CIA1 PE=3 SV=1 49 288 2.0E-10
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 21 325 2.0E-10
sp|P41318|LST8_YEAST Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 30 297 2.0E-10
sp|Q7RY68|PFS2_NEUCR Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 95 343 2.0E-10
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 59 290 2.0E-10
sp|B4P7Q3|CIAO1_DROYA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 46 286 2.0E-10
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 38 178 2.0E-10
sp|Q5AZX0|PFS2_EMENI Polyadenylation factor subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfs2 PE=3 SV=1 19 260 2.0E-10
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 92 286 2.0E-10
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 175 341 3.0E-10
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 206 341 3.0E-10
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 206 341 3.0E-10
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 206 341 3.0E-10
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 206 341 3.0E-10
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 137 329 3.0E-10
sp|A1DHW6|SCONB_NEOFI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 27 264 3.0E-10
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 95 329 3.0E-10
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 104 291 3.0E-10
sp|O48847|LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 21 286 3.0E-10
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 23 288 3.0E-10
sp|Q6BU94|PRP46_DEBHA Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 18 172 3.0E-10
sp|Q8BHB4|WDR3_MOUSE WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 21 200 3.0E-10
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 71 327 3.0E-10
sp|Q59WJ4|PFS2_CANAL Polyadenylation factor subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFS2 PE=3 SV=1 21 169 3.0E-10
sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 114 302 3.0E-10
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 2 244 3.0E-10
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 2 244 3.0E-10
sp|Q9SZQ5|VIP3_ARATH WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 21 171 3.0E-10
sp|Q7RY68|PFS2_NEUCR Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 30 234 3.0E-10
sp|Q6CBI8|CIAO1_YARLI Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1 95 286 3.0E-10
sp|Q8BU03|PWP2_MOUSE Periodic tryptophan protein 2 homolog OS=Mus musculus GN=Pwp2 PE=1 SV=1 22 302 3.0E-10
sp|Q8CBE3|WDR37_MOUSE WD repeat-containing protein 37 OS=Mus musculus GN=Wdr37 PE=1 SV=1 47 335 3.0E-10
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 46 286 3.0E-10
sp|Q7K1Y4|CIAO1_DROME Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 46 286 3.0E-10
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 71 286 3.0E-10
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 48 332 3.0E-10
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 48 332 3.0E-10
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 48 332 3.0E-10
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 48 332 3.0E-10
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 48 332 3.0E-10
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 48 332 3.0E-10
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 48 332 3.0E-10
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 49 328 3.0E-10
sp|Q6BIR9|CIAO1_DEBHA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CIA1 PE=3 SV=1 49 287 3.0E-10
sp|O94394|YQF1_SCHPO Uncharacterized WD repeat-containing protein C126.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC126.01c PE=3 SV=2 25 288 3.0E-10
sp|B4QFZ8|CIAO1_DROSI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 46 286 3.0E-10
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 39 286 4.0E-10
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 134 325 4.0E-10
sp|Q4I7X1|PFS2_GIBZE Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 30 234 4.0E-10
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 19 178 4.0E-10
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 19 178 4.0E-10
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 71 327 4.0E-10
sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 95 334 4.0E-10
sp|P74598|Y1491_SYNY3 Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 15 175 4.0E-10
sp|Q7RY68|PFS2_NEUCR Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 19 263 4.0E-10
sp|Q5RFQ3|PWP2_PONAB Periodic tryptophan protein 2 homolog OS=Pongo abelii GN=PWP2 PE=2 SV=1 22 320 4.0E-10
sp|A4IIX9|WDR37_XENTR WD repeat-containing protein 37 OS=Xenopus tropicalis GN=wdr37 PE=2 SV=1 47 341 4.0E-10
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 21 319 4.0E-10
sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 38 170 4.0E-10
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 94 333 5.0E-10
sp|B6QC56|LIS11_TALMQ Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 93 411 5.0E-10
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 114 368 5.0E-10
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 58 327 5.0E-10
sp|Q39836|GBLP_SOYBN Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 95 368 5.0E-10
sp|P69104|GBLP_TRYBR Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 52 301 5.0E-10
sp|P69103|GBLP_TRYBB Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 52 301 5.0E-10
sp|Q5AG86|CIAO1_CANAL Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CIA1 PE=3 SV=1 49 288 5.0E-10
sp|Q5XGI5|WDR83_XENTR WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 52 328 5.0E-10
sp|B4HRQ6|CIAO1_DROSE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 46 286 5.0E-10
sp|B4MY77|CIAO1_DROWI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 46 286 5.0E-10
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 19 242 6.0E-10
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 72 309 6.0E-10
sp|Q25189|GBLP_HYDVU Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1 48 316 6.0E-10
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 48 286 6.0E-10
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 94 333 7.0E-10
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 21 159 7.0E-10
sp|Q00659|SCONB_EMENI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 127 297 7.0E-10
sp|Q5R650|WDR37_PONAB WD repeat-containing protein 37 OS=Pongo abelii GN=WDR37 PE=2 SV=1 97 335 7.0E-10
sp|Q5ZL33|STRAP_CHICK Serine-threonine kinase receptor-associated protein OS=Gallus gallus GN=STRAP PE=2 SV=2 47 286 7.0E-10
sp|Q2KJJ5|TBL3_BOVIN Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 42 287 7.0E-10
sp|P97865|PEX7_MOUSE Peroxisomal targeting signal 2 receptor OS=Mus musculus GN=Pex7 PE=1 SV=1 38 287 7.0E-10
sp|Q652L2|HIRA_ORYSJ Protein HIRA OS=Oryza sativa subsp. japonica GN=Os09g0567700 PE=2 SV=1 56 267 7.0E-10
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 6 129 8.0E-10
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 56 289 8.0E-10
sp|P07834|CDC4_YEAST Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 73 288 9.0E-10
sp|Q8C4J7|TBL3_MOUSE Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 42 218 9.0E-10
sp|P90916|LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans GN=lin-53 PE=1 SV=2 8 253 9.0E-10
sp|O94620|CWF17_SCHPO Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf17 PE=1 SV=1 42 289 9.0E-10
sp|Q8R537|PEX7_CRIGR Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus GN=PEX7 PE=1 SV=1 38 175 9.0E-10
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 23 168 1.0E-09
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 6 129 1.0E-09
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 93 333 1.0E-09
sp|A2QCU8|SCONB_ASPNC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 27 264 1.0E-09
sp|A2QCU8|SCONB_ASPNC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 96 297 1.0E-09
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 8 171 1.0E-09
sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 38 171 1.0E-09
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 94 392 1.0E-09
sp|Q8BHB4|WDR3_MOUSE WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 56 332 1.0E-09
sp|Q9NRL3|STRN4_HUMAN Striatin-4 OS=Homo sapiens GN=STRN4 PE=1 SV=2 3 168 1.0E-09
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 21 135 1.0E-09
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 22 177 1.0E-09
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 95 357 1.0E-09
sp|Q6BVZ3|PFS2_DEBHA Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2 6 242 1.0E-09
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 2 218 1.0E-09
sp|Q8C4J7|TBL3_MOUSE Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 81 298 1.0E-09
sp|B0X2V9|WDR48_CULQU WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1 46 307 1.0E-09
sp|Q86TI4|WDR86_HUMAN WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 37 183 1.0E-09
sp|Q09406|A16L2_CAEEL Autophagic-related protein 16.2 OS=Caenorhabditis elegans GN=atg-16.2 PE=3 SV=2 52 209 1.0E-09
sp|Q6PBD6|WDR61_XENTR WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 71 305 1.0E-09
sp|Q05946|UTP13_YEAST U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 50 327 1.0E-09
sp|B4JW81|CIAO1_DROGR Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 46 286 1.0E-09
sp|Q6P1V3|WSB1_XENTR WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 14 290 1.0E-09
sp|Q9XW12|CIAO1_CAEEL Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Caenorhabditis elegans GN=Y18D10A.9 PE=1 SV=2 65 407 1.0E-09
sp|Q8IZU2|WDR17_HUMAN WD repeat-containing protein 17 OS=Homo sapiens GN=WDR17 PE=2 SV=2 71 208 1.0E-09
sp|Q54W52|WDR12_DICDI Ribosome biogenesis protein WDR12 homolog OS=Dictyostelium discoideum GN=wdr12 PE=2 SV=1 55 357 1.0E-09
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 6 129 2.0E-09
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 146 319 2.0E-09
sp|Q6L4F8|GBLPB_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 39 171 2.0E-09
sp|A1C7E4|SCONB_ASPCL Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 77 297 2.0E-09
sp|Q39336|GBLP_BRANA Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 154 327 2.0E-09
sp|O42249|GBLP_ORENI Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 21 300 2.0E-09
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 71 280 2.0E-09
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 56 245 2.0E-09
sp|Q2KJJ5|TBL3_BOVIN Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 41 305 2.0E-09
sp|Q6GM65|PLAP_XENLA Phospholipase A-2-activating protein OS=Xenopus laevis GN=plaa PE=2 SV=2 71 286 2.0E-09
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 65 286 2.0E-09
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 71 286 2.0E-09
sp|Q54MP8|Y5837_DICDI Bromodomain and WD repeat-containing DDB_G0285837 OS=Dictyostelium discoideum GN=DDB_G0285837 PE=3 SV=1 56 286 2.0E-09
sp|O00628|PEX7_HUMAN Peroxisomal targeting signal 2 receptor OS=Homo sapiens GN=PEX7 PE=1 SV=1 38 287 2.0E-09
sp|Q8MY12|MHCKC_DICDI Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 16 174 2.0E-09
sp|Q54WA3|PEX7_DICDI Peroxisomal targeting signal 2 receptor OS=Dictyostelium discoideum GN=pex7 PE=3 SV=1 38 170 2.0E-09
sp|B4LJT7|CIAO1_DROVI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 53 286 2.0E-09
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 95 316 2.0E-09
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 23 203 3.0E-09
sp|Q9UNX4|WDR3_HUMAN WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 56 332 3.0E-09
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 101 319 3.0E-09
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 42 218 3.0E-09
sp|Q9C1X1|PWP2_SCHPO Periodic tryptophan protein 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.04c PE=1 SV=1 13 294 3.0E-09
sp|Q5E959|STRAP_BOVIN Serine-threonine kinase receptor-associated protein OS=Bos taurus GN=STRAP PE=2 SV=1 47 286 3.0E-09
sp|A8XSW2|WDR48_CAEBR WD repeat-containing protein 48 homolog OS=Caenorhabditis briggsae GN=wdr-48 PE=3 SV=3 36 325 3.0E-09
sp|Q5XIG8|STRAP_RAT Serine-threonine kinase receptor-associated protein OS=Rattus norvegicus GN=Strap PE=1 SV=1 47 286 3.0E-09
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 95 293 4.0E-09
sp|B6Q4Z5|SCONB_TALMQ Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 77 321 4.0E-09
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 38 168 4.0E-09
sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 59 323 4.0E-09
sp|P42841|PFS2_YEAST Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 20 169 4.0E-09
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 38 171 4.0E-09
sp|Q5FVN8|WSDU1_RAT WD repeat, SAM and U-box domain-containing protein 1 OS=Rattus norvegicus GN=Wdsub1 PE=2 SV=1 14 168 4.0E-09
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 65 286 4.0E-09
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 207 341 5.0E-09
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 9 336 5.0E-09
sp|B3MC74|CIAO1_DROAN Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 53 286 5.0E-09
sp|Q9Y3F4|STRAP_HUMAN Serine-threonine kinase receptor-associated protein OS=Homo sapiens GN=STRAP PE=1 SV=1 47 286 5.0E-09
sp|Q9Z1Z2|STRAP_MOUSE Serine-threonine kinase receptor-associated protein OS=Mus musculus GN=Strap PE=1 SV=2 47 286 5.0E-09
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 134 333 6.0E-09
sp|Q19124|A16L1_CAEEL Autophagic-related protein 16.1 OS=Caenorhabditis elegans GN=atg-16.1 PE=3 SV=1 72 178 6.0E-09
sp|C4R6H3|LIS1_PICPG Nuclear distribution protein PAC1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAC1 PE=3 SV=1 39 287 6.0E-09
sp|Q7ZTY4|RBBP7_DANRE Histone-binding protein RBBP7 OS=Danio rerio GN=rbbp7 PE=2 SV=1 20 246 6.0E-09
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 93 330 7.0E-09
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 134 333 7.0E-09
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 134 333 7.0E-09
sp|P25635|PWP2_YEAST Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 21 190 7.0E-09
sp|O18640|GBLP_DROME Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 21 330 7.0E-09
sp|Q9UNX4|WDR3_HUMAN WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 21 200 7.0E-09
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 90 368 7.0E-09
sp|Q93134|GBLP_BIOGL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 38 171 7.0E-09
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 11 286 7.0E-09
sp|O14186|YDSB_SCHPO Uncharacterized WD repeat-containing protein C4F8.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F8.11 PE=3 SV=1 39 176 7.0E-09
sp|Q5F201|CFA52_MOUSE Cilia- and flagella-associated protein 52 OS=Mus musculus GN=Cfap52 PE=1 SV=1 62 286 7.0E-09
sp|Q61Y48|LIN53_CAEBR Probable histone-binding protein lin-53 OS=Caenorhabditis briggsae GN=lin-53 PE=3 SV=2 8 246 7.0E-09
sp|P54319|PLAP_RAT Phospholipase A-2-activating protein OS=Rattus norvegicus GN=Plaa PE=1 SV=3 71 300 7.0E-09
sp|Q54J37|STRN_DICDI Striatin homolog OS=Dictyostelium discoideum GN=strn PE=3 SV=1 36 325 7.0E-09
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 130 325 8.0E-09
sp|Q39190|PRL2_ARATH Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 17 162 8.0E-09
sp|Q6FJ73|CIAO1_CANGA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIA1 PE=3 SV=1 19 287 8.0E-09
sp|A2QPW4|CIAO1_ASPNC Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cia1 PE=3 SV=1 108 337 8.0E-09
sp|Q9D0I6|WSDU1_MOUSE WD repeat, SAM and U-box domain-containing protein 1 OS=Mus musculus GN=Wdsub1 PE=2 SV=1 14 168 8.0E-09
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 38 171 9.0E-09
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 38 171 9.0E-09
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 38 171 9.0E-09
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 38 171 9.0E-09
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 38 171 9.0E-09
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 38 171 9.0E-09
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 38 171 9.0E-09
sp|Q8IZU2|WDR17_HUMAN WD repeat-containing protein 17 OS=Homo sapiens GN=WDR17 PE=2 SV=2 3 127 9.0E-09
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 95 329 1.0E-08
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 7 251 1.0E-08
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 7 251 1.0E-08
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 95 309 1.0E-08
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 39 169 1.0E-08
sp|B6GZA1|SCONB_PENRW Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 85 297 1.0E-08
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 136 311 2.0E-08
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 136 311 2.0E-08
sp|Q9C270|PWP2_NEUCR Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 55 319 2.0E-08
sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 25 211 2.0E-08
sp|Q9UNX4|WDR3_HUMAN WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 32 242 2.0E-08
sp|O24456|GBLPA_ARATH Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 154 327 2.0E-08
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 90 286 2.0E-08
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 90 368 2.0E-08
sp|Q25189|GBLP_HYDVU Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1 38 171 2.0E-08
sp|P90916|LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans GN=lin-53 PE=1 SV=2 134 367 2.0E-08
sp|Q05946|UTP13_YEAST U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 20 168 2.0E-08
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 72 164 3.0E-08
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 72 151 3.0E-08
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 20 242 3.0E-08
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 21 126 3.0E-08
sp|O48847|LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 107 311 3.0E-08
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 154 327 3.0E-08
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 72 242 3.0E-08
sp|Q39836|GBLP_SOYBN Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 154 327 3.0E-08
sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 42 186 3.0E-08
sp|Q0CY32|SCONB_ASPTN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 77 297 3.0E-08
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 28 242 4.0E-08
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 7 251 4.0E-08
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 7 169 4.0E-08
sp|O22212|PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 124 313 4.0E-08
sp|Q26544|WSL17_SCHMA WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 39 168 4.0E-08
sp|P0CS47|PFS2_CRYNB Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 32 347 4.0E-08
sp|P0CS46|PFS2_CRYNJ Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 32 347 4.0E-08
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 20 209 4.0E-08
sp|P41318|LST8_YEAST Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 3 171 4.0E-08
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 21 174 5.0E-08
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 130 325 5.0E-08
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 64 304 5.0E-08
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 134 333 5.0E-08
sp|P58404|STRN4_MOUSE Striatin-4 OS=Mus musculus GN=Strn4 PE=1 SV=2 3 168 5.0E-08
sp|O18640|GBLP_DROME Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 136 330 5.0E-08
sp|Q75BY3|PRP46_ASHGO Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 137 406 5.0E-08
sp|P07834|CDC4_YEAST Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 29 343 5.0E-08
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 208 327 6.0E-08
sp|B8NGT5|SCONB_ASPFN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 77 297 6.0E-08
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 23 136 7.0E-08
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 21 170 7.0E-08
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 37 168 7.0E-08
sp|Q2UFN8|SCONB_ASPOR Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 77 297 7.0E-08
sp|Q5AZX0|PFS2_EMENI Polyadenylation factor subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfs2 PE=3 SV=1 77 360 7.0E-08
sp|Q5XGI5|WDR83_XENTR WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 38 243 7.0E-08
sp|Q6CKE8|PRP46_KLULA Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 18 170 8.0E-08
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 38 171 8.0E-08
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 23 136 9.0E-08
sp|O24076|GBLP_MEDSA Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 136 327 9.0E-08
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 208 327 1.0E-07
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 136 311 1.0E-07
sp|B8M0Q1|LIS1_TALSN Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 177 321 1.0E-07
sp|A1DHW6|SCONB_NEOFI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 127 297 1.0E-07
sp|Q4I7X1|PFS2_GIBZE Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 95 329 1.0E-07
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 21 182 1.0E-07
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 53 207 1.0E-07
sp|D4D8P3|SCONB_TRIVH Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 77 297 1.0E-07
sp|D4AM37|SCONB_ARTBC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 77 297 1.0E-07
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 38 162 1.0E-07
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 90 368 1.0E-07
sp|A8Q2R5|WDR48_BRUMA WD repeat-containing protein 48 homolog OS=Brugia malayi GN=Bm1_41555 PE=3 SV=2 73 298 1.0E-07
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 53 325 1.0E-07
sp|Q6PBD6|WDR61_XENTR WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 114 316 1.0E-07
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 114 322 1.0E-07
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 114 322 1.0E-07
sp|Q61Y48|LIN53_CAEBR Probable histone-binding protein lin-53 OS=Caenorhabditis briggsae GN=lin-53 PE=3 SV=2 134 367 1.0E-07
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 190 327 2.0E-07
sp|C4JZS6|LIS11_UNCRE Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 136 343 2.0E-07
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 8 185 2.0E-07
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 3 171 2.0E-07
sp|Q8BHB4|WDR3_MOUSE WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 53 242 2.0E-07
sp|Q4X1Y0|PFS2_ASPFU Polyadenylation factor subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfs2 PE=3 SV=1 76 349 2.0E-07
sp|C5FP68|SCONB_ARTOC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 77 297 2.0E-07
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 129 327 2.0E-07
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 21 300 2.0E-07
sp|Q9NRL3|STRN4_HUMAN Striatin-4 OS=Homo sapiens GN=STRN4 PE=1 SV=2 93 247 3.0E-07
sp|A0AUS0|WSDU1_DANRE WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 56 335 3.0E-07
sp|Q9UTN4|PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 54 286 3.0E-07
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 88 298 3.0E-07
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 72 243 3.0E-07
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 72 243 3.0E-07
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 72 243 3.0E-07
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 94 334 3.0E-07
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 21 127 3.0E-07
sp|Q6PBD6|WDR61_XENTR WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 18 204 3.0E-07
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 18 84 4.0E-07
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 18 84 4.0E-07
sp|Q4X0A9|SCONB_ASPFU Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 77 297 4.0E-07
sp|B0XTS1|SCONB_ASPFC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 77 297 4.0E-07
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 90 287 4.0E-07
sp|Q8C7V3|UTP15_MOUSE U3 small nucleolar RNA-associated protein 15 homolog OS=Mus musculus GN=Utp15 PE=1 SV=1 8 207 4.0E-07
sp|Q8TED0|UTP15_HUMAN U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens GN=UTP15 PE=1 SV=3 8 207 4.0E-07
sp|O60508|PRP17_HUMAN Pre-mRNA-processing factor 17 OS=Homo sapiens GN=CDC40 PE=1 SV=1 71 311 4.0E-07
sp|Q26544|WSL17_SCHMA WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 6 245 4.0E-07
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 72 243 4.0E-07
sp|Q6PBD6|WDR61_XENTR WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 21 169 4.0E-07
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 3 133 5.0E-07
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 139 306 5.0E-07
sp|A7MB12|UTP15_BOVIN U3 small nucleolar RNA-associated protein 15 homolog OS=Bos taurus GN=UTP15 PE=2 SV=1 8 207 5.0E-07
sp|P58404|STRN4_MOUSE Striatin-4 OS=Mus musculus GN=Strn4 PE=1 SV=2 93 247 5.0E-07
sp|O22212|PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 132 371 5.0E-07
sp|Q9DC48|PRP17_MOUSE Pre-mRNA-processing factor 17 OS=Mus musculus GN=Cdc40 PE=2 SV=1 58 311 5.0E-07
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 50 168 5.0E-07
sp|Q86TI4|WDR86_HUMAN WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 21 335 5.0E-07
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 208 328 6.0E-07
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 136 322 6.0E-07
sp|Q6ZMY6|WDR88_HUMAN WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 1 127 6.0E-07
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 190 327 7.0E-07
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 64 304 7.0E-07
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 204 318 7.0E-07
sp|A2RRU3|UTP15_RAT U3 small nucleolar RNA-associated protein 15 homolog OS=Rattus norvegicus GN=Utp15 PE=2 SV=1 8 207 7.0E-07
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 23 173 8.0E-07
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 192 346 8.0E-07
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 21 126 8.0E-07
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 29 286 9.0E-07
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 149 338 9.0E-07
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 208 311 1.0E-06
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 21 127 1.0E-06
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 8 135 1.0E-06
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 149 338 1.0E-06
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 56 287 1.0E-06
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 21 132 1.0E-06
sp|Q00664|LIS1_EMENI Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 71 151 1.0E-06
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 27 168 1.0E-06
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 186 330 1.0E-06
sp|Q9ERF3|WDR61_MOUSE WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 21 169 1.0E-06
sp|Q4V7A0|WDR61_RAT WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 21 169 1.0E-06
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 8 171 1.0E-06
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 208 306 2.0E-06
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 21 126 2.0E-06
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 208 327 2.0E-06
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 208 311 2.0E-06
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 208 311 2.0E-06
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 208 311 2.0E-06
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 208 311 2.0E-06
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 208 311 2.0E-06
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 208 311 2.0E-06
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 208 311 2.0E-06
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 208 311 2.0E-06
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 208 311 2.0E-06
sp|Q9GZS3|WDR61_HUMAN WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 21 169 2.0E-06
sp|Q32LN7|WDR61_BOVIN WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 21 169 2.0E-06
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 56 337 2.0E-06
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 72 243 2.0E-06
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 208 311 3.0E-06
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 64 304 3.0E-06
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 206 395 3.0E-06
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 127 321 3.0E-06
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 127 321 3.0E-06
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 8 168 3.0E-06
sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 21 168 3.0E-06
sp|Q5ZJH5|WDR61_CHICK WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 21 169 3.0E-06
sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 39 169 3.0E-06
sp|Q2KJJ5|TBL3_BOVIN Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 21 168 3.0E-06
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 208 311 4.0E-06
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 208 311 4.0E-06
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 7 126 4.0E-06
sp|Q6CG48|LIS1_YARLI Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 140 322 4.0E-06
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 50 168 4.0E-06
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 3 168 4.0E-06
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 7 242 4.0E-06
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 21 127 5.0E-06
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 21 127 5.0E-06
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 50 168 5.0E-06
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 50 168 5.0E-06
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 2 127 6.0E-06
sp|Q9C270|PWP2_NEUCR Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 21 184 6.0E-06
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 50 168 6.0E-06
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 8 126 6.0E-06
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 95 297 7.0E-06
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 8 126 7.0E-06
sp|Q8C4J7|TBL3_MOUSE Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 3 168 7.0E-06
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 72 325 8.0E-06
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 38 168 8.0E-06
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 19 84 9.0E-06
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 95 297 9.0E-06
sp|Q2TZG4|PFS2_ASPOR Polyadenylation factor subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfs2 PE=3 SV=1 29 182 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0030117 membrane coat Yes
GO:0006886 intracellular protein transport Yes
GO:0005198 structural molecule activity Yes
GO:0016192 vesicle-mediated transport Yes
GO:0098796 membrane protein complex No
GO:0051649 establishment of localization in cell No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0071702 organic substance transport No
GO:0071705 nitrogen compound transport No
GO:0005488 binding No
GO:0070727 cellular macromolecule localization No
GO:0051641 cellular localization No
GO:0045184 establishment of protein localization No
GO:0009987 cellular process No
GO:0032991 protein-containing complex No
GO:0008104 protein localization No
GO:0033036 macromolecule localization No
GO:0046907 intracellular transport No
GO:0006810 transport No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0015031 protein transport No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.6007 0.4668 0.0371 0.1217 0.0649 0.0054 0.2837 0.3524 0.3076 0.0078

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5007
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|545
Ophiocordyceps australis map64 (Brazil) OphauB2|4820
Ophiocordyceps camponoti-floridani Ophcf2|01771
Ophiocordyceps camponoti-rufipedis Ophun1|4912
Ophiocordyceps kimflemingae Ophio5|4971
Ophiocordyceps subramaniannii Hirsu2|2419 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2419
MQSSPGMLTKFESKSSRAKGIAFHPKRPWILVSLHSSTIQLWDYRMGTLIDRFEEHDGPVRGVDFHKTQPLFVSG
GDDYKIKVWSYQTRRCLFTLNGHLDYVRTVFFHHELPWILSSSDDQTIRIWNWQNRSLICTMTGHNHYAMCAQFH
PKDDLVVSASLDQSVRVWDISGLRKKHSAPTSMSFEDQMARANQNQADMFGNTDAVVKFVLEGHDRGVNWVAFHP
TMPLIVSAGDDRLIKLWRMSETKAWEVDTCRGHFHNASGCLFHPHQDLILSAGEDKTIRVWDLNKRTAVQSFKRE
NDRFWVIAAHPEINLFAAGHDNGVMVFKLERERPASATHQNVLFYINKEKHVKSYDFQRNAESPTLVSLKKLGSP
WVTPRTLSYNPAERSVLVTTPADGGSYELVNLPKDGSGAIEPTELKRGSGNAAIFVARNRFAVLDTSNQTVDIKD
LSNNTTRSFKTPAGTSDIYCGGTGNILIVTPTAVHLYDIQQKKSIAELSVNGVKYVVWSNDSIYAALLSKHNVTI
VTKTLEQISTLHETIRIKSATWDDAGVLLYSTLNHVKYTLLSGDNGIVRTLDQTVYLVRVRGRNVYCLDRAAKPR
ILQIDPTEYRFKLALVKRNYEEMLHIIRNSSLVGQSIISYLQKKGYPEIALQFVQDPTTRFDLAIECGNLDVAVE
MARDLDKPKFWTRLSNEALAHGNHQVVEMCYQKLKQFDKLSFLYLTTGDHSKLARMAKIAEHRGDFTSRFHNALF
LGEVEDRIQMFKEIDLYPLAYMMAKSHGLDDECQTILEAIGITEDQLTMPQLGAPSTPPKPIVPTFKGNWPSKAS
SQSFFEKALLGQVESLSLDEEPANALGTEGMTLDDGKEMNPAAKRNDSAVEDDDEDVAGWDMGEDDVPEADSDFI
NPTMWRVARSRQPCSY*
Coding >Hirsu2|2419
ATGCAGTCCTCCCCGGGAATGTTGACCAAGTTCGAGTCAAAGTCTTCTCGAGCAAAAGGCATTGCCTTTCATCCA
AAGAGACCATGGATCCTGGTGTCATTGCACTCGTCCACTATCCAGCTTTGGGACTATCGTATGGGCACTTTGATC
GACAGATTTGAAGAACACGATGGACCTGTCCGTGGTGTCGATTTTCACAAGACCCAGCCACTCTTTGTATCCGGC
GGCGATGACTACAAGATCAAGGTCTGGTCATATCAGACGCGGCGCTGTCTCTTCACCCTCAATGGTCACCTGGAC
TATGTTCGGACAGTCTTTTTCCATCATGAACTCCCGTGGATTCTCTCATCTTCCGATGATCAGACTATTCGAATA
TGGAACTGGCAGAATCGTTCGTTGATCTGCACCATGACCGGCCACAATCATTACGCTATGTGTGCCCAGTTCCAT
CCGAAGGATGATCTCGTCGTCTCCGCCTCACTCGACCAATCGGTCCGCGTCTGGGACATATCTGGCCTCCGCAAG
AAGCATTCCGCCCCGACCTCTATGAGCTTCGAAGACCAGATGGCCCGCGCCAACCAGAATCAGGCAGACATGTTC
GGTAACACGGATGCCGTTGTCAAATTTGTCCTCGAGGGCCACGACCGTGGCGTCAACTGGGTCGCGTTTCACCCA
ACAATGCCTCTCATAGTGTCCGCCGGCGACGACCGCCTTATCAAGCTCTGGCGCATGAGCGAAACGAAAGCCTGG
GAAGTGGACACTTGTAGGGGTCATTTCCATAACGCCTCCGGCTGTCTGTTTCATCCGCACCAAGATTTGATCCTG
TCGGCTGGTGAGGACAAGACGATCCGAGTGTGGGACTTGAATAAACGGACTGCGGTCCAATCTTTCAAACGAGAA
AACGACCGGTTTTGGGTCATAGCGGCACACCCTGAGATCAATTTGTTCGCGGCCGGTCATGACAACGGAGTTATG
GTATTCAAGTTGGAACGCGAGCGTCCTGCCTCGGCCACACATCAAAATGTGCTCTTCTACATCAATAAGGAAAAG
CATGTAAAGTCCTATGACTTTCAGAGGAATGCGGAGAGCCCGACGCTCGTGTCTCTTAAGAAGCTGGGCAGCCCC
TGGGTCACCCCACGCACCCTGTCGTACAATCCGGCCGAGAGGTCTGTTCTTGTGACGACGCCAGCCGACGGAGGG
TCGTACGAGCTGGTCAATCTTCCCAAAGATGGATCAGGAGCTATTGAACCAACGGAGTTGAAGCGTGGTTCTGGT
AACGCGGCCATATTCGTGGCGAGAAACCGCTTTGCTGTCCTGGATACCTCTAACCAGACGGTTGACATCAAGGAT
CTATCGAACAATACGACACGATCATTCAAAACACCGGCCGGCACGTCCGATATCTATTGTGGCGGGACCGGCAAT
ATCCTCATCGTTACCCCCACCGCAGTTCATCTTTACGACATCCAGCAGAAGAAGAGCATCGCTGAGTTGTCCGTG
AACGGCGTCAAGTACGTGGTGTGGTCCAACGATAGCATCTACGCTGCCCTGCTCAGCAAGCACAATGTAACGATT
GTGACAAAGACACTCGAGCAGATTAGCACTCTGCATGAGACGATTCGAATCAAAAGCGCTACCTGGGATGATGCC
GGAGTCCTACTGTATTCAACTCTCAATCATGTCAAGTACACTCTCCTCAGTGGCGACAATGGCATAGTCCGAACT
CTTGATCAGACTGTCTATCTGGTGCGGGTCAGGGGCCGTAACGTCTACTGCCTGGACCGAGCTGCAAAACCGCGC
ATTTTACAGATCGACCCTACCGAGTACAGATTCAAATTGGCGCTGGTCAAGCGCAACTACGAAGAGATGTTGCAC
ATCATCCGTAACTCGAGTCTCGTGGGCCAGTCGATTATCTCATATCTGCAGAAAAAGGGGTACCCCGAAATCGCG
CTGCAGTTTGTGCAGGATCCTACAACTCGCTTCGACTTGGCCATTGAATGCGGTAACCTCGACGTTGCTGTTGAA
ATGGCAAGAGACCTGGACAAGCCGAAGTTTTGGACACGCTTGAGCAACGAAGCGCTGGCCCATGGCAATCATCAG
GTTGTGGAAATGTGCTATCAGAAACTCAAGCAGTTTGACAAACTGTCGTTCCTTTACCTAACCACCGGGGATCAC
TCCAAGCTTGCCCGCATGGCGAAGATTGCGGAGCACCGAGGGGATTTTACCTCTCGCTTCCACAACGCTCTATTT
CTTGGCGAGGTCGAAGACCGCATCCAGATGTTCAAGGAGATTGATCTTTACCCTCTAGCTTATATGATGGCCAAG
TCTCACGGCCTAGATGATGAATGTCAAACCATTCTGGAAGCCATTGGTATCACAGAGGATCAGCTCACCATGCCT
CAATTAGGGGCACCTTCGACACCGCCCAAGCCGATTGTGCCGACATTCAAAGGCAACTGGCCCTCAAAGGCCAGC
TCACAGTCGTTCTTCGAAAAGGCTTTGCTCGGCCAGGTTGAGAGCCTGTCTCTCGATGAAGAGCCGGCGAACGCC
CTAGGTACCGAAGGCATGACGCTGGATGACGGCAAGGAGATGAACCCTGCAGCGAAACGAAATGATAGCGCTGTC
GAAGACGACGACGAAGATGTGGCAGGCTGGGACATGGGCGAAGACGATGTCCCTGAAGCCGACAGCGACTTTATC
AATCCGACCATGTGGCGGGTGGCTCGTTCGAGACAGCCATGCAGCTACTGA
Transcript >Hirsu2|2419
ATGCAGTCCTCCCCGGGAATGTTGACCAAGTTCGAGTCAAAGTCTTCTCGAGCAAAAGGCATTGCCTTTCATCCA
AAGAGACCATGGATCCTGGTGTCATTGCACTCGTCCACTATCCAGCTTTGGGACTATCGTATGGGCACTTTGATC
GACAGATTTGAAGAACACGATGGACCTGTCCGTGGTGTCGATTTTCACAAGACCCAGCCACTCTTTGTATCCGGC
GGCGATGACTACAAGATCAAGGTCTGGTCATATCAGACGCGGCGCTGTCTCTTCACCCTCAATGGTCACCTGGAC
TATGTTCGGACAGTCTTTTTCCATCATGAACTCCCGTGGATTCTCTCATCTTCCGATGATCAGACTATTCGAATA
TGGAACTGGCAGAATCGTTCGTTGATCTGCACCATGACCGGCCACAATCATTACGCTATGTGTGCCCAGTTCCAT
CCGAAGGATGATCTCGTCGTCTCCGCCTCACTCGACCAATCGGTCCGCGTCTGGGACATATCTGGCCTCCGCAAG
AAGCATTCCGCCCCGACCTCTATGAGCTTCGAAGACCAGATGGCCCGCGCCAACCAGAATCAGGCAGACATGTTC
GGTAACACGGATGCCGTTGTCAAATTTGTCCTCGAGGGCCACGACCGTGGCGTCAACTGGGTCGCGTTTCACCCA
ACAATGCCTCTCATAGTGTCCGCCGGCGACGACCGCCTTATCAAGCTCTGGCGCATGAGCGAAACGAAAGCCTGG
GAAGTGGACACTTGTAGGGGTCATTTCCATAACGCCTCCGGCTGTCTGTTTCATCCGCACCAAGATTTGATCCTG
TCGGCTGGTGAGGACAAGACGATCCGAGTGTGGGACTTGAATAAACGGACTGCGGTCCAATCTTTCAAACGAGAA
AACGACCGGTTTTGGGTCATAGCGGCACACCCTGAGATCAATTTGTTCGCGGCCGGTCATGACAACGGAGTTATG
GTATTCAAGTTGGAACGCGAGCGTCCTGCCTCGGCCACACATCAAAATGTGCTCTTCTACATCAATAAGGAAAAG
CATGTAAAGTCCTATGACTTTCAGAGGAATGCGGAGAGCCCGACGCTCGTGTCTCTTAAGAAGCTGGGCAGCCCC
TGGGTCACCCCACGCACCCTGTCGTACAATCCGGCCGAGAGGTCTGTTCTTGTGACGACGCCAGCCGACGGAGGG
TCGTACGAGCTGGTCAATCTTCCCAAAGATGGATCAGGAGCTATTGAACCAACGGAGTTGAAGCGTGGTTCTGGT
AACGCGGCCATATTCGTGGCGAGAAACCGCTTTGCTGTCCTGGATACCTCTAACCAGACGGTTGACATCAAGGAT
CTATCGAACAATACGACACGATCATTCAAAACACCGGCCGGCACGTCCGATATCTATTGTGGCGGGACCGGCAAT
ATCCTCATCGTTACCCCCACCGCAGTTCATCTTTACGACATCCAGCAGAAGAAGAGCATCGCTGAGTTGTCCGTG
AACGGCGTCAAGTACGTGGTGTGGTCCAACGATAGCATCTACGCTGCCCTGCTCAGCAAGCACAATGTAACGATT
GTGACAAAGACACTCGAGCAGATTAGCACTCTGCATGAGACGATTCGAATCAAAAGCGCTACCTGGGATGATGCC
GGAGTCCTACTGTATTCAACTCTCAATCATGTCAAGTACACTCTCCTCAGTGGCGACAATGGCATAGTCCGAACT
CTTGATCAGACTGTCTATCTGGTGCGGGTCAGGGGCCGTAACGTCTACTGCCTGGACCGAGCTGCAAAACCGCGC
ATTTTACAGATCGACCCTACCGAGTACAGATTCAAATTGGCGCTGGTCAAGCGCAACTACGAAGAGATGTTGCAC
ATCATCCGTAACTCGAGTCTCGTGGGCCAGTCGATTATCTCATATCTGCAGAAAAAGGGGTACCCCGAAATCGCG
CTGCAGTTTGTGCAGGATCCTACAACTCGCTTCGACTTGGCCATTGAATGCGGTAACCTCGACGTTGCTGTTGAA
ATGGCAAGAGACCTGGACAAGCCGAAGTTTTGGACACGCTTGAGCAACGAAGCGCTGGCCCATGGCAATCATCAG
GTTGTGGAAATGTGCTATCAGAAACTCAAGCAGTTTGACAAACTGTCGTTCCTTTACCTAACCACCGGGGATCAC
TCCAAGCTTGCCCGCATGGCGAAGATTGCGGAGCACCGAGGGGATTTTACCTCTCGCTTCCACAACGCTCTATTT
CTTGGCGAGGTCGAAGACCGCATCCAGATGTTCAAGGAGATTGATCTTTACCCTCTAGCTTATATGATGGCCAAG
TCTCACGGCCTAGATGATGAATGTCAAACCATTCTGGAAGCCATTGGTATCACAGAGGATCAGCTCACCATGCCT
CAATTAGGGGCACCTTCGACACCGCCCAAGCCGATTGTGCCGACATTCAAAGGCAACTGGCCCTCAAAGGCCAGC
TCACAGTCGTTCTTCGAAAAGGCTTTGCTCGGCCAGGTTGAGAGCCTGTCTCTCGATGAAGAGCCGGCGAACGCC
CTAGGTACCGAAGGCATGACGCTGGATGACGGCAAGGAGATGAACCCTGCAGCGAAACGAAATGATAGCGCTGTC
GAAGACGACGACGAAGATGTGGCAGGCTGGGACATGGGCGAAGACGATGTCCCTGAAGCCGACAGCGACTTTATC
AATCCGACCATGTGGCGGGTGGCTCGTTCGAGACAGCCATGCAGCTACTGA
Gene >Hirsu2|2419
ATGCAGTCCTCCCCGGGAATGTTGACCAAGGTGCGCTTGTGTACAGCAAGGCGCCTCGTTCGATCCCGCTGACCC
GTTCCAGTTCGAGTCAAAGTCTTCTCGAGCAAAAGGCATTGCCTTTCATCCAAAGAGGTAATTCATTCTTATCGC
TCCGTGCCATTGCAGAAGACCCAAAGGTTGACCCAGTTGGCAGACCATGGATCCTGGTGTCATTGCACTCGTCCA
CTATCCAGCTTTGGGACTATCGTATGGGCACTTTGATCGACAGATTTGAAGAACACGATGGACCTGTCCGTGGTG
TCGATTTTCACAAGACCCAGCCACTCTTTGTATCCGGCGGCGATGACTACAAGATCAAGGTCTGGTCATATCAGA
CGCGGCGCTGTCTCTTCACCCTCAATGGTCACCTGGACTATGTTCGGACAGTCTTTTTCCATCATGAACTCCCGT
GGATTCTCTCATCTTCCGATGATCAGACTATTCGAATATGGAACTGGCAGAATCGTTCGTTGAGTAAGTCGTACT
CTCGAACGCCTCACCCGGCCCACTAATGCTAACCGCTCGGTAGTCTGCACCATGACCGGCCACAATCATTACGCT
ATGTGTGCCCAGTTCCATCCGAAGGATGATCTCGTCGTCTCCGCCTCACTCGACCAATCGGTCCGCGTCTGGGAC
ATATCTGGCCTCCGCAAGAAGCATTCCGCCCCGACCTCTATGAGCTTCGAAGACCAGATGGCCCGCGCCAACCAG
AATCAGGCAGACATGTTCGGTAACACGGATGCCGTTGTCAAATTTGTCCTCGAGGGCCACGACCGTGGCGTCAAC
TGGGTCGCGTTTCACCCAACAATGCCTCTCATAGTGTCCGCCGGCGACGACCGCCTTATCAAGCTCTGGCGCATG
AGCGAAACGAAAGCCTGGGAAGTGGACACTTGTAGGGGTCATTTCCATAACGCCTCCGGCTGTCTGTTTCATCCG
CACCAAGATTTGATCCTGTCGGCTGGTGAGGACAAGACGATCCGAGTGTGGGACTTGAATAAACGGACTGCGGTC
CAATCTTTCAAACGAGAAAACGACCGGTTTTGGGTCATAGCGGCACACCCTGAGATCAATTTGTTCGCGGCCGGT
CATGACAACGGAGTTATGGTATTCAAGTTGGAACGCGAGCGTCCTGCCTCGGCCACACATCAAAATGTGCTCTTC
TACATCAATAAGGAAAAGCATGTAAAGTCCTATGACTTTCAGAGGAATGCGGAGAGCCCGACGCTCGTGTCTCTT
AAGAAGCTGGGCAGCCCCTGGGTCACCCCACGCACCCTGTCGTACAATCCGGCCGAGAGGTCTGTTCTTGTGACG
ACGCCAGCCGACGGAGGGTCGTACGAGCTGGTCAATCTTCCCAAAGATGGATCAGGAGCTATTGAACCAACGGAG
TTGAAGCGTGGTTCTGGTAACGCGGCCATATTCGTGGCGAGAAACCGCTTTGCTGTCCTGGATACCTCTAACCAG
ACGGTTGACATCAAGGATCTATCGAACAATACGACACGATCATTCAAAACACCGGCCGGCACGTCCGATATCTAT
TGTGGCGGGACCGGCAATATCCTCATCGTTACCCCCACCGCAGTTCATCTTTACGACATCCAGCAGAAGAAGAGC
ATCGCTGAGTTGTCCGTGAACGGCGTCAAGTACGTGGTGTGGTCCAACGATAGCATCTACGCTGCCCTGCTCAGC
AAGCACAATGTAACGATTGTGACAAAGACACTCGAGCAGATTAGCACTCTGCATGAGACGATTCGAATCAAAAGC
GCTACCTGGGATGATGCCGGAGTCCTACTGTATTCAACTCTCAATCATGTCAAGTACACTCTCCTCAGTGGCGAC
AATGGCATAGTCCGAACTCTTGATCAGACTGTCTATCTGGTGCGGGTCAGGGGCCGTAACGTCTACTGCCTGGAC
CGAGCTGCAAAACCGCGCATTTTACAGATCGACCCTACCGAGTACAGATTCAAATTGGCGCTGGTCAAGCGCAAC
TACGAAGAGATGTTGCACATCATCCGTAACTCGAGTCTCGTGGGCCAGTCGATTATCTCATATCTGCAGAAAAAG
GGGTACCCCGAAATCGCGCTGCAGTTTGTGCAGGATCCTACAACTCGCTTCGACTTGGCCATTGAATGCGGTAAC
CTCGACGTTGCTGTTGAAATGGCAAGAGACCTGGACAAGCCGAAGTTTTGGACACGCTTGAGCAACGAAGCGCTG
GCCCATGGCAATCATCAGGTTGTGGAAATGTGCTATCAGAAACTCAAGCAGTTTGACAAACTGTCGTTCCTTTAC
CTAACCACCGGGGATCACTCCAAGCTTGCCCGCATGGCGAAGATTGCGGAGCACCGAGGGGATTTTACCTCTCGC
TTCCACAACGCTCTATTTCTTGGCGAGGTCGAAGACCGCATCCAGATGTTCAAGGAGATTGATCTTTGTTAGTAC
TCAACCGTTGCTCTTATGTGACCTCAACTGACCCTCTGGCAGACCCTCTAGCTTATATGATGGCCAAGTCTCACG
GCCTAGATGATGAATGTCAAACCATTCTGGAAGCCATTGGTATCACAGAGGATCAGCTCACCATGCCTCAATTAG
GGGCACCTTCGACACCGCCCAAGCCGATTGTGCCGACATTCAAAGGCAACTGGCCCTCAAAGGCCAGCTCACAGT
CGTTCTTCGAAAAGGCTTTGCTCGGCCAGGTTGAGAGCCTGTCTCTCGATGAAGAGCCGGCGAACGCCCTAGGTA
CCGAAGGCATGACGCTGGATGACGGCAAGGAGATGAACCCTGCAGCGAAACGAAATGATAGCGCTGTCGAAGACG
ACGACGAAGATGTGGCAGGCTGGGACATGGGCGAAGACGATGTCCCTGAAGCCGACAGCGACTTTATCAATGTTG
ACAGCGCAGATGCCGGTGGGGCTGGTAGCAGTGAAGCTGATCTCTGGGCGCGAAACTCACCTCTGGCAGCCGACC
ATGTGGCGGGTGGCTCGTTCGAGACAGCCATGCAGCTACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail