Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2404
Gene name
LocationContig_1573:3052..4526
Strand-
Gene length (bp)1474
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00994 MoCF_biosynth Probable molybdopterin binding domain 6.5E-35 48 225

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03219|YM44_YEAST Uncharacterized protein YMR178W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR178W PE=1 SV=1 46 314 4.0E-67
sp|Q22017|FAD1_CAEEL Probable FAD synthase OS=Caenorhabditis elegans GN=flad-1 PE=3 SV=1 46 312 3.0E-30
sp|Q68EH8|FAD1_DANRE FAD synthase OS=Danio rerio GN=flad1 PE=2 SV=1 46 285 8.0E-30
sp|Q626I0|FLAD1_CAEBR Probable FAD synthase OS=Caenorhabditis briggsae GN=CBG00973 PE=3 SV=1 35 273 7.0E-29
sp|Q6ING7|FLAD1_XENLA FAD synthase OS=Xenopus laevis GN=flad1 PE=2 SV=1 46 293 8.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03219|YM44_YEAST Uncharacterized protein YMR178W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR178W PE=1 SV=1 46 314 4.0E-67
sp|Q22017|FAD1_CAEEL Probable FAD synthase OS=Caenorhabditis elegans GN=flad-1 PE=3 SV=1 46 312 3.0E-30
sp|Q68EH8|FAD1_DANRE FAD synthase OS=Danio rerio GN=flad1 PE=2 SV=1 46 285 8.0E-30
sp|Q626I0|FLAD1_CAEBR Probable FAD synthase OS=Caenorhabditis briggsae GN=CBG00973 PE=3 SV=1 35 273 7.0E-29
sp|Q6ING7|FLAD1_XENLA FAD synthase OS=Xenopus laevis GN=flad1 PE=2 SV=1 46 293 8.0E-29
sp|Q8R123|FAD1_MOUSE FAD synthase OS=Mus musculus GN=Flad1 PE=1 SV=1 30 297 2.0E-26
sp|Q8NFF5|FAD1_HUMAN FAD synthase OS=Homo sapiens GN=FLAD1 PE=1 SV=1 46 297 1.0E-25
sp|Q5RCH4|FAD1_PONAB FAD synthase OS=Pongo abelii GN=FLAD1 PE=2 SV=1 46 285 2.0E-24
sp|O58186|Y439_PYRHO Protein PH0439 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0439 PE=3 SV=1 47 308 1.0E-21
sp|C3NMS7|Y772_SULIN Protein YN1551_0772 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=YN1551_0772 PE=3 SV=1 47 261 5.0E-21
sp|C3MJ86|Y2186_SULIL Protein LS215_2186 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=LS215_2186 PE=3 SV=1 47 261 5.0E-21
sp|C3N8A9|Y2147_SULIY Protein YG5714_2147 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=YG5714_2147 PE=3 SV=1 47 261 5.0E-21
sp|C4KJ66|Y2028_SULIK Protein M164_2028 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=M164_2028 PE=3 SV=1 47 261 5.0E-21
sp|C3MYX8|Y2021_SULIM Protein M1425_2021 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=M1425_2021 PE=3 SV=1 47 261 5.0E-21
sp|C3N026|Y2099_SULIA Protein M1627_2099 OS=Sulfolobus islandicus (strain M.16.27) GN=M1627_2099 PE=3 SV=1 47 261 2.0E-20
sp|Q9YAF9|Y1980_AERPE Protein APE_1980.1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_1980.1 PE=3 SV=2 52 274 2.0E-20
sp|A0M3L5|CINAL_GRAFK CinA-like protein OS=Gramella forsetii (strain KT0803) GN=GFO_2245 PE=3 SV=1 47 296 2.0E-20
sp|B8J6V6|CINAL_ANAD2 CinA-like protein OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=A2cp1_3752 PE=3 SV=1 50 315 3.0E-20
sp|Q3A1W5|CINAL_PELCD CinA-like protein OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=Pcar_2403 PE=3 SV=1 48 257 4.0E-20
sp|Q2IFM3|CINAL_ANADE CinA-like protein OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=Adeh_3614 PE=3 SV=1 50 315 4.0E-20
sp|O28033|Y2251_ARCFU Protein AF_2251 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_2251 PE=3 SV=1 49 307 5.0E-20
sp|Q9HKV6|Y487_THEAC Protein Ta0487 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0487 PE=1 SV=1 44 298 5.0E-20
sp|A4YIK8|Y2121_METS5 Protein Msed_2121 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_2121 PE=3 SV=2 44 228 3.0E-19
sp|A5GDB4|CINAL_GEOUR CinA-like protein OS=Geobacter uraniireducens (strain Rf4) GN=Gura_0217 PE=3 SV=1 48 317 4.0E-19
sp|A3MS85|Y062_PYRCJ Protein Pcal_0062 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=Pcal_0062 PE=3 SV=1 46 274 4.0E-19
sp|Q5JJB4|Y1472_THEKO Protein TK1472 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1472 PE=3 SV=1 47 296 5.0E-19
sp|A0LV09|CINAL_ACIC1 CinA-like protein OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=Acel_1497 PE=3 SV=1 47 304 1.0E-18
sp|A7HGS8|CINAL_ANADF CinA-like protein OS=Anaeromyxobacter sp. (strain Fw109-5) GN=Anae109_3745 PE=3 SV=1 50 275 2.0E-18
sp|Q1DCC8|CINAL_MYXXD CinA-like protein OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_1438 PE=3 SV=1 50 229 2.0E-18
sp|Q4J8Q2|Y1508_SULAC Protein Saci_1508 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_1508 PE=3 SV=1 47 274 2.0E-18
sp|A4WH44|Y096_PYRAR Protein Pars_0096 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=Pars_0096 PE=3 SV=1 47 271 3.0E-18
sp|B4UD97|CINAL_ANASK CinA-like protein OS=Anaeromyxobacter sp. (strain K) GN=AnaeK_3683 PE=3 SV=1 50 315 5.0E-18
sp|Q18BS8|CINA_PEPD6 Putative competence-damage inducible protein OS=Peptoclostridium difficile (strain 630) GN=cinA PE=3 SV=1 47 225 9.0E-18
sp|Q8ZYA5|Y875_PYRAE Protein PAE0875 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE0875 PE=3 SV=1 46 274 3.0E-17
sp|Q8U3J0|Y476_PYRFU Protein PF0476 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0476 PE=3 SV=1 47 277 6.0E-17
sp|Q971E0|Y1413_SULTO Protein STK_14130 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_14130 PE=3 SV=1 44 261 6.0E-17
sp|Q2LPL3|CINAL_SYNAS CinA-like protein OS=Syntrophus aciditrophicus (strain SB) GN=SYNAS_03440 PE=3 SV=1 50 298 9.0E-17
sp|P95958|Y103_SULSO Protein SSO0103 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0103 PE=3 SV=1 47 261 2.0E-16
sp|Q64TK0|CINAL_BACFR CinA-like protein OS=Bacteroides fragilis (strain YCH46) GN=BF2430 PE=3 SV=1 47 146 2.0E-16
sp|B8J0U1|CINAL_DESDA CinA-like protein OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=Ddes_1466 PE=3 SV=1 47 231 2.0E-16
sp|Q5LCF4|CINAL_BACFN CinA-like protein OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=BF2511 PE=3 SV=1 47 146 2.0E-16
sp|B9M363|CINAL_GEODF CinA-like protein OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=Geob_1113 PE=3 SV=1 47 317 2.0E-16
sp|C3KYP8|CINA_CLOB6 Putative competence-damage inducible protein OS=Clostridium botulinum (strain 657 / Type Ba4) GN=cinA PE=3 SV=1 47 304 3.0E-16
sp|Q03EQ4|CINA_PEDPA Putative competence-damage inducible protein OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=cinA PE=3 SV=1 46 150 4.0E-16
sp|Q8XP33|CINA_CLOPE Putative competence-damage inducible protein OS=Clostridium perfringens (strain 13 / Type A) GN=cinA PE=3 SV=1 47 310 4.0E-16
sp|Q0SWN5|CINA_CLOPS Putative competence-damage inducible protein OS=Clostridium perfringens (strain SM101 / Type A) GN=cinA PE=3 SV=1 47 310 5.0E-16
sp|B1KSY5|CINA_CLOBM Putative competence-damage inducible protein OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=cinA PE=3 SV=1 47 304 6.0E-16
sp|B3QTC8|CINAL_CHLT3 CinA-like protein OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=Ctha_1770 PE=3 SV=1 47 309 1.0E-15
sp|A8ME30|Y1209_CALMQ Protein Cmaq_1209 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=Cmaq_1209 PE=3 SV=1 47 274 1.0E-15
sp|B9L1M7|CINAL_THERP CinA-like protein OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=trd_1288 PE=3 SV=1 47 317 1.0E-15
sp|C1FQU7|CINA_CLOBJ Putative competence-damage inducible protein OS=Clostridium botulinum (strain Kyoto / Type A2) GN=cinA PE=3 SV=1 47 145 2.0E-15
sp|A7FQM1|CINA_CLOB1 Putative competence-damage inducible protein OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=cinA PE=3 SV=1 47 145 2.0E-15
sp|B1IDA0|CINA_CLOBK Putative competence-damage inducible protein OS=Clostridium botulinum (strain Okra / Type B1) GN=cinA PE=3 SV=1 47 145 2.0E-15
sp|A7G9W4|CINA_CLOBL Putative competence-damage inducible protein OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=cinA PE=3 SV=1 47 145 2.0E-15
sp|A8MI49|CINA_ALKOO Putative competence-damage inducible protein OS=Alkaliphilus oremlandii (strain OhILAs) GN=cinA PE=3 SV=1 47 229 3.0E-15
sp|B3WCM0|CINA_LACCB Putative competence-damage inducible protein OS=Lactobacillus casei (strain BL23) GN=cinA PE=3 SV=1 47 261 3.0E-15
sp|Q03AQ1|CINA_LACC3 Putative competence-damage inducible protein OS=Lactobacillus casei (strain ATCC 334) GN=cinA PE=3 SV=1 47 261 3.0E-15
sp|A6GZI7|CINAL_FLAPJ CinA-like protein OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=FP1434 PE=3 SV=1 47 297 3.0E-15
sp|Q6AIZ4|CINAL_DESPS CinA-like protein OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=DP2957 PE=3 SV=1 49 229 4.0E-15
sp|B1I313|CINA_DESAP Putative competence-damage inducible protein OS=Desulforudis audaxviator (strain MP104C) GN=cinA PE=3 SV=1 47 305 4.0E-15
sp|Q0TUU6|CINA_CLOP1 Putative competence-damage inducible protein OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=cinA PE=3 SV=1 47 310 4.0E-15
sp|Q2J752|CINAL_FRASC CinA-like protein OS=Frankia sp. (strain CcI3) GN=Francci3_3538 PE=3 SV=1 47 318 6.0E-15
sp|B1YMB8|CINA_EXIS2 Putative competence-damage inducible protein OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=cinA PE=3 SV=1 47 228 8.0E-15
sp|Q97B73|Y584_THEVO Protein TV0584 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV0584 PE=3 SV=2 47 274 9.0E-15
sp|B5ED03|CINAL_GEOBB CinA-like protein OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=Gbem_3628 PE=3 SV=1 48 317 2.0E-14
sp|A0PXD7|CINA_CLONN Putative competence-damage inducible protein OS=Clostridium novyi (strain NT) GN=cinA PE=3 SV=1 47 225 2.0E-14
sp|A8A2B6|CINAL_ECOHS CinA-like protein OS=Escherichia coli O9:H4 (strain HS) GN=EcHS_A2392 PE=3 SV=1 50 145 2.0E-14
sp|Q11S34|CINAL_CYTH3 CinA-like protein OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=CHU_2526 PE=3 SV=1 47 238 2.0E-14
sp|B1LLK3|CINAL_ECOSM CinA-like protein OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=EcSMS35_2403 PE=3 SV=1 50 145 3.0E-14
sp|P77808|CINAL_ECOLI NMN amidohydrolase-like protein YfaY OS=Escherichia coli (strain K12) GN=yfaY PE=1 SV=1 50 145 3.0E-14
sp|B1IXT8|CINAL_ECOLC CinA-like protein OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=EcolC_1400 PE=3 SV=1 50 145 3.0E-14
sp|B1X8W2|CINAL_ECODH CinA-like protein OS=Escherichia coli (strain K12 / DH10B) GN=ECDH10B_2409 PE=3 SV=1 50 145 3.0E-14
sp|C4ZU91|CINAL_ECOBW CinA-like protein OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=BWG_2022 PE=3 SV=1 50 145 3.0E-14
sp|B7LAR4|CINAL_ECO55 CinA-like protein OS=Escherichia coli (strain 55989 / EAEC) GN=EC55989_2495 PE=3 SV=1 50 145 3.0E-14
sp|B7N5L4|CINAL_ECOLU CinA-like protein OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ECUMN_2590 PE=3 SV=1 50 145 3.0E-14
sp|B6I7H5|CINAL_ECOSE CinA-like protein OS=Escherichia coli (strain SE11) GN=ECSE_2508 PE=3 SV=1 50 145 3.0E-14
sp|A4VSE5|CINA_STRSY Putative competence-damage inducible protein OS=Streptococcus suis (strain 05ZYH33) GN=cinA PE=3 SV=2 47 258 3.0E-14
sp|A4VYN4|CINA_STRS2 Putative competence-damage inducible protein OS=Streptococcus suis (strain 98HAH33) GN=cinA PE=3 SV=2 47 258 3.0E-14
sp|A5F9Y3|CINAL_FLAJ1 CinA-like protein OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=Fjoh_4984 PE=3 SV=1 47 298 4.0E-14
sp|Q83KC1|CINAL_SHIFL CinA-like protein OS=Shigella flexneri GN=SF2328 PE=3 SV=1 50 145 4.0E-14
sp|A5D2R7|CINA_PELTS Putative competence-damage inducible protein OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=cinA PE=3 SV=1 47 304 6.0E-14
sp|C5CFW1|CINAL_KOSOT CinA-like protein OS=Kosmotoga olearia (strain TBF 19.5.1) GN=Kole_1770 PE=3 SV=1 47 144 6.0E-14
sp|Q1AT03|CINAL_RUBXD CinA-like protein OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=Rxyl_2558 PE=3 SV=1 44 154 6.0E-14
sp|Q2S304|CINAL_SALRD CinA-like protein OS=Salinibacter ruber (strain DSM 13855 / M31) GN=SRU_1303 PE=3 SV=1 47 259 8.0E-14
sp|Q74GV1|CINAL_GEOSL CinA-like protein OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU0143 PE=3 SV=1 48 258 8.0E-14
sp|Q39Z82|CINAL_GEOMG CinA-like protein OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=Gmet_0196 PE=3 SV=1 48 311 9.0E-14
sp|Q9UYB5|Y1593_PYRAB Protein PYRAB15930 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB15930 PE=3 SV=1 47 296 1.0E-13
sp|C1A7F4|CINAL_GEMAT CinA-like protein OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=GAU_1122 PE=3 SV=1 50 259 2.0E-13
sp|A8AZT4|CINA_STRGC Putative competence-damage inducible protein OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=cinA PE=3 SV=1 47 157 2.0E-13
sp|B2A3C4|CINA_NATTJ Putative competence-damage inducible protein OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=cinA PE=3 SV=1 49 258 3.0E-13
sp|C6E6X4|CINAL_GEOSM CinA-like protein OS=Geobacter sp. (strain M21) GN=GM21_3733 PE=3 SV=1 50 269 3.0E-13
sp|A6TNW2|CINA_ALKMQ Putative competence-damage inducible protein OS=Alkaliphilus metalliredigens (strain QYMF) GN=cinA PE=3 SV=1 47 146 3.0E-13
sp|Q65JF3|CINA_BACLD Putative competence-damage inducible protein OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cinA PE=3 SV=1 47 258 3.0E-13
sp|A3DEA5|CINA_CLOTH Putative competence-damage inducible protein OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=cinA PE=3 SV=1 47 149 5.0E-13
sp|Q898T5|CINA_CLOTE Putative competence-damage inducible protein OS=Clostridium tetani (strain Massachusetts / E88) GN=cinA PE=3 SV=1 46 258 5.0E-13
sp|A2C089|CINAL_PROM1 CinA-like protein OS=Prochlorococcus marinus (strain NATL1A) GN=NATL1_03351 PE=3 SV=1 47 153 5.0E-13
sp|A1ALN8|CINAL_PELPD CinA-like protein OS=Pelobacter propionicus (strain DSM 2379) GN=Ppro_0627 PE=3 SV=1 50 176 6.0E-13
sp|Q03R28|CINA_LACBA Putative competence-damage inducible protein OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=cinA PE=3 SV=1 47 145 9.0E-13
sp|B2HDA1|CINAL_MYCMM CinA-like protein OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=MMAR_2796 PE=3 SV=1 47 212 1.0E-12
sp|A6M320|CINA_CLOB8 Putative competence-damage inducible protein OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=cinA PE=3 SV=1 47 148 1.0E-12
sp|P46323|CINA_BACSU Putative competence-damage inducible protein OS=Bacillus subtilis (strain 168) GN=cinA PE=3 SV=3 47 149 2.0E-12
sp|A9FML0|CINAL_SORC5 CinA-like protein OS=Sorangium cellulosum (strain So ce56) GN=sce8168 PE=3 SV=2 48 229 2.0E-12
sp|Q5WFW9|CINA_BACSK Putative competence-damage inducible protein OS=Bacillus clausii (strain KSM-K16) GN=cinA PE=3 SV=1 46 150 2.0E-12
sp|Q7NHU4|CINAL_GLOVI CinA-like protein OS=Gloeobacter violaceus (strain PCC 7421) GN=glr2441 PE=3 SV=1 46 304 2.0E-12
sp|A8F4W4|CINAL_PSELT CinA-like protein OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=Tlet_0632 PE=3 SV=2 44 248 2.0E-12
sp|A0QGE9|CINAL_MYCA1 CinA-like protein OS=Mycobacterium avium (strain 104) GN=MAV_2800 PE=3 SV=1 47 212 3.0E-12
sp|Q46HB7|CINAL_PROMT CinA-like protein OS=Prochlorococcus marinus (strain NATL2A) GN=PMN2A_1623 PE=3 SV=1 47 162 3.0E-12
sp|O32508|CINAL_DEIRA CinA-like protein OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=cinA PE=3 SV=1 47 306 4.0E-12
sp|Q73ZH8|CINAL_MYCPA CinA-like protein OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cinA PE=3 SV=1 47 215 5.0E-12
sp|B0S3U9|CINA_FINM2 Putative competence-damage inducible protein OS=Finegoldia magna (strain ATCC 29328) GN=cinA PE=3 SV=1 50 211 5.0E-12
sp|A0QY28|CINAL_MYCS2 CinA-like protein OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=cinA PE=3 SV=2 47 212 6.0E-12
sp|B1HR35|CINA_LYSSC Putative competence-damage inducible protein OS=Lysinibacillus sphaericus (strain C3-41) GN=cinA PE=3 SV=1 46 149 6.0E-12
sp|Q8DH31|CINAL_THEEB CinA-like protein OS=Thermosynechococcus elongatus (strain BP-1) GN=tlr2129 PE=3 SV=2 46 304 7.0E-12
sp|C5D9G1|CINA_GEOSW Putative competence-damage inducible protein OS=Geobacillus sp. (strain WCH70) GN=cinA PE=3 SV=1 46 149 7.0E-12
sp|B9MQY2|CINA_CALBD Putative competence-damage inducible protein OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=cinA PE=3 SV=1 47 155 7.0E-12
sp|Q82Z98|CINA_ENTFA Putative competence-damage inducible protein OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=cinA PE=3 SV=1 47 261 1.0E-11
sp|Q5L0F7|CINA_GEOKA Putative competence-damage inducible protein OS=Geobacillus kaustophilus (strain HTA426) GN=cinA PE=3 SV=1 46 144 1.0E-11
sp|B0K1B9|CINA_THEPX Putative competence-damage inducible protein OS=Thermoanaerobacter sp. (strain X514) GN=cinA PE=3 SV=1 52 305 1.0E-11
sp|Q31CS5|CINAL_PROM9 CinA-like protein OS=Prochlorococcus marinus (strain MIT 9312) GN=PMT9312_0259 PE=3 SV=1 50 157 1.0E-11
sp|A6LL44|CINAL_THEM4 CinA-like protein OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=Tmel_0783 PE=3 SV=1 47 154 1.0E-11
sp|Q7VDS9|CINAL_PROMA CinA-like protein OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=cinA PE=3 SV=1 45 258 1.0E-11
sp|A5N2R5|CINA_CLOK5 Putative competence-damage inducible protein OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=cinA PE=3 SV=1 50 212 1.0E-11
sp|B9E6E0|CINA_CLOK1 Putative competence-damage inducible protein OS=Clostridium kluyveri (strain NBRC 12016) GN=cinA PE=3 SV=1 50 212 1.0E-11
sp|A2BP56|CINAL_PROMS CinA-like protein OS=Prochlorococcus marinus (strain AS9601) GN=A9601_02791 PE=3 SV=1 50 314 1.0E-11
sp|Q3JYN0|CINA_STRA1 Putative competence-damage inducible protein OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=cinA PE=3 SV=1 47 157 1.0E-11
sp|A2BUN8|CINAL_PROM5 CinA-like protein OS=Prochlorococcus marinus (strain MIT 9515) GN=P9515_02901 PE=3 SV=1 50 145 2.0E-11
sp|B2V6Y9|CINAL_SULSY CinA-like protein OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=SYO3AOP1_0125 PE=3 SV=1 47 150 2.0E-11
sp|A8FDG2|CINA_BACP2 Putative competence-damage inducible protein OS=Bacillus pumilus (strain SAFR-032) GN=cinA PE=3 SV=1 47 149 2.0E-11
sp|C0MAR7|CINA_STRE4 Putative competence-damage inducible protein OS=Streptococcus equi subsp. equi (strain 4047) GN=cinA PE=3 SV=1 47 143 2.0E-11
sp|B4U0I9|CINA_STREM Putative competence-damage inducible protein OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=cinA PE=3 SV=1 47 143 2.0E-11
sp|A3Q040|CINAL_MYCSJ CinA-like protein OS=Mycobacterium sp. (strain JLS) GN=Mjls_2737 PE=3 SV=1 47 215 2.0E-11
sp|A4XLD7|CINA_CALS8 Putative competence-damage inducible protein OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=cinA PE=3 SV=1 47 258 2.0E-11
sp|Q1IWF4|CINAL_DEIGD CinA-like protein OS=Deinococcus geothermalis (strain DSM 11300) GN=Dgeo_2136 PE=3 SV=1 47 274 2.0E-11
sp|B0CEJ2|CINAL_ACAM1 CinA-like protein OS=Acaryochloris marina (strain MBIC 11017) GN=AM1_1941 PE=3 SV=1 46 304 2.0E-11
sp|B0K9N3|CINA_THEP3 Putative competence-damage inducible protein OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=cinA PE=3 SV=1 52 157 2.0E-11
sp|C0MGB7|CINA_STRS7 Putative competence-damage inducible protein OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=cinA PE=3 SV=1 47 143 2.0E-11
sp|B8CXC3|CINA_HALOH Putative competence-damage inducible protein OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=cinA PE=3 SV=1 47 133 2.0E-11
sp|P9WPE3|CINAL_MYCTU CinA-like protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cinA PE=1 SV=1 47 212 3.0E-11
sp|P9WPE2|CINAL_MYCTO CinA-like protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cinA PE=3 SV=1 47 212 3.0E-11
sp|A5U3S0|CINAL_MYCTA CinA-like protein OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1912 PE=3 SV=1 47 212 3.0E-11
sp|C1API1|CINAL_MYCBT CinA-like protein OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_1924 PE=3 SV=1 47 212 3.0E-11
sp|A1KJW6|CINAL_MYCBP CinA-like protein OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1940 PE=3 SV=1 47 212 3.0E-11
sp|P63776|CINAL_MYCBO CinA-like protein OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cinA PE=3 SV=1 47 212 3.0E-11
sp|Q1B8H0|CINAL_MYCSS CinA-like protein OS=Mycobacterium sp. (strain MCS) GN=Mmcs_2707 PE=3 SV=1 47 215 3.0E-11
sp|A1UGI7|CINAL_MYCSK CinA-like protein OS=Mycobacterium sp. (strain KMS) GN=Mkms_2751 PE=3 SV=1 47 215 3.0E-11
sp|A7HNE6|CINAL_FERNB CinA-like protein OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=Fnod_1586 PE=3 SV=1 47 155 3.0E-11
sp|A5GIG6|CINAL_SYNPW CinA-like protein OS=Synechococcus sp. (strain WH7803) GN=SynWH7803_0305 PE=3 SV=1 50 306 3.0E-11
sp|Q5M6H3|CINA_STRT2 Putative competence-damage inducible protein OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=cinA PE=3 SV=1 47 154 3.0E-11
sp|Q5M1Y3|CINA_STRT1 Putative competence-damage inducible protein OS=Streptococcus thermophilus (strain CNRZ 1066) GN=cinA PE=3 SV=1 47 154 3.0E-11
sp|Q8E2R9|CINA_STRA3 Putative competence-damage inducible protein OS=Streptococcus agalactiae serotype III (strain NEM316) GN=cinA PE=3 SV=1 47 157 3.0E-11
sp|Q03MX6|CINA_STRTD Putative competence-damage inducible protein OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=cinA PE=3 SV=1 47 154 3.0E-11
sp|A8ZZX4|CINAL_DESOH CinA-like protein OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=Dole_1570 PE=3 SV=1 47 260 4.0E-11
sp|A1BJF2|CINAL_CHLPD CinA-like protein OS=Chlorobium phaeobacteroides (strain DSM 266) GN=Cpha266_2541 PE=3 SV=1 52 144 5.0E-11
sp|Q3AN01|CINAL_SYNSC CinA-like protein OS=Synechococcus sp. (strain CC9605) GN=Syncc9605_0255 PE=3 SV=1 50 316 7.0E-11
sp|B3QL60|CINAL_CHLP8 CinA-like protein OS=Chlorobaculum parvum (strain NCIB 8327) GN=Cpar_1906 PE=3 SV=1 47 150 7.0E-11
sp|Q8RA54|CINA_CALS4 Putative competence-damage inducible protein OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cinA PE=3 SV=1 52 154 7.0E-11
sp|Q1JJH5|CINA_STRPC Putative competence-damage inducible protein OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=cinA PE=3 SV=1 47 143 9.0E-11
sp|Q1J9C6|CINA_STRPB Putative competence-damage inducible protein OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=cinA PE=3 SV=1 47 143 9.0E-11
sp|Q8DRX2|CINA_STRMU Putative competence-damage inducible protein OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=cinA PE=3 SV=1 49 260 9.0E-11
sp|Q5X9H9|CINA_STRP6 Putative competence-damage inducible protein OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=cinA PE=3 SV=1 47 143 9.0E-11
sp|A2RGU9|CINA_STRPG Putative competence-damage inducible protein OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=cinA PE=3 SV=1 47 143 9.0E-11
sp|Q8NZ29|CINA_STRP8 Putative competence-damage inducible protein OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=cinA PE=3 SV=1 47 143 9.0E-11
sp|C1CXY3|CINAL_DEIDV CinA-like protein OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=Deide_19430 PE=3 SV=1 47 274 1.0E-10
sp|A3PAX8|CINAL_PROM0 CinA-like protein OS=Prochlorococcus marinus (strain MIT 9301) GN=P9301_02801 PE=3 SV=1 50 168 1.0E-10
sp|Q7U9J5|CINAL_SYNPX CinA-like protein OS=Synechococcus sp. (strain WH8102) GN=SYNW0261 PE=3 SV=1 50 317 1.0E-10
sp|Q48QW6|CINA_STRPM Putative competence-damage inducible protein OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=cinA PE=3 SV=1 47 143 1.0E-10
sp|Q1JEH6|CINA_STRPD Putative competence-damage inducible protein OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=cinA PE=3 SV=1 47 143 1.0E-10
sp|Q3AUA4|CINAL_CHLCH CinA-like protein OS=Chlorobium chlorochromatii (strain CaD3) GN=Cag_0143 PE=3 SV=1 47 258 1.0E-10
sp|C1CTH7|CINA_STRZT Putative competence-damage inducible protein OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=cinA PE=3 SV=1 47 258 1.0E-10
sp|B1I8Q2|CINA_STRPI Putative competence-damage inducible protein OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=cinA PE=3 SV=1 47 258 1.0E-10
sp|B5E2E1|CINA_STRP4 Putative competence-damage inducible protein OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=cinA PE=3 SV=1 47 258 1.0E-10
sp|B5XJ05|CINA_STRPZ Putative competence-damage inducible protein OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=cinA PE=3 SV=1 47 143 1.0E-10
sp|Q47XX0|CINAL_COLP3 CinA-like protein OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=CPS_3682 PE=3 SV=1 50 153 1.0E-10
sp|Q1J494|CINA_STRPF Putative competence-damage inducible protein OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=cinA PE=3 SV=1 47 143 1.0E-10
sp|P0DA27|CINA_STRPQ Putative competence-damage inducible protein OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=cinA PE=3 SV=1 47 143 1.0E-10
sp|P0DA26|CINA_STRP3 Putative competence-damage inducible protein OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=cinA PE=3 SV=1 47 143 1.0E-10
sp|Q7TUN0|CINAL_PROMM CinA-like protein OS=Prochlorococcus marinus (strain MIT 9313) GN=PMT_1845 PE=3 SV=1 38 134 1.0E-10
sp|B3EL42|CINAL_CHLPB CinA-like protein OS=Chlorobium phaeobacteroides (strain BS1) GN=Cphamn1_0300 PE=3 SV=1 47 303 1.0E-10
sp|Q732U5|CINA_BACC1 Putative competence-damage inducible protein OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cinA PE=3 SV=1 46 212 1.0E-10
sp|B5YB52|CINAL_DICT6 CinA-like protein OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=DICTH_1766 PE=3 SV=1 50 310 1.0E-10
sp|Q88UZ3|CINA_LACPL Putative competence-damage inducible protein OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=cinA PE=3 SV=1 47 143 2.0E-10
sp|Q7TUG2|CINAL_PROMP CinA-like protein OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=PMM0257 PE=3 SV=1 50 133 2.0E-10
sp|C1CMP6|CINA_STRZP Putative competence-damage inducible protein OS=Streptococcus pneumoniae (strain P1031) GN=cinA PE=3 SV=1 47 258 2.0E-10
sp|C1CGM5|CINA_STRZJ Putative competence-damage inducible protein OS=Streptococcus pneumoniae (strain JJA) GN=cinA PE=3 SV=1 47 258 2.0E-10
sp|B8ZNU8|CINA_STRPJ Putative competence-damage inducible protein OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=cinA PE=3 SV=1 47 258 2.0E-10
sp|C1C9K9|CINA_STRP7 Putative competence-damage inducible protein OS=Streptococcus pneumoniae (strain 70585) GN=cinA PE=3 SV=1 47 258 2.0E-10
sp|A5IJ83|CINAL_THEP1 CinA-like protein OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=Tpet_0227 PE=3 SV=1 47 154 2.0E-10
sp|Q9S5X1|CINAL_THEMA CinA-like protein OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0703 PE=3 SV=1 47 154 2.0E-10
sp|A7Z4W4|CINA_BACMF Putative competence-damage inducible protein OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=cinA PE=3 SV=1 47 145 2.0E-10
sp|B2IM29|CINA_STRPS Putative competence-damage inducible protein OS=Streptococcus pneumoniae (strain CGSP14) GN=cinA PE=3 SV=1 47 258 2.0E-10
sp|A1S257|CINAL_SHEAM CinA-like protein OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=Sama_0252 PE=3 SV=1 50 270 2.0E-10
sp|B7ITN2|CINA_BACC2 Putative competence-damage inducible protein OS=Bacillus cereus (strain G9842) GN=cinA PE=3 SV=1 46 212 2.0E-10
sp|B1L804|CINAL_THESQ CinA-like protein OS=Thermotoga sp. (strain RQ2) GN=TRQ2_0225 PE=3 SV=1 47 154 2.0E-10
sp|Q028J4|CINAL_SOLUE CinA-like protein OS=Solibacter usitatus (strain Ellin6076) GN=Acid_1567 PE=3 SV=1 47 153 2.0E-10
sp|A8G2R7|CINAL_PROM2 CinA-like protein OS=Prochlorococcus marinus (strain MIT 9215) GN=P9215_02811 PE=3 SV=1 50 133 3.0E-10
sp|B2UNF6|CINAL_AKKM8 CinA-like protein OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=Amuc_0430 PE=3 SV=1 53 149 3.0E-10
sp|B8I7D0|CINA_CLOCE Putative competence-damage inducible protein OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=cinA PE=3 SV=1 47 145 3.0E-10
sp|Q99XP1|CINA_STRP1 Putative competence-damage inducible protein OS=Streptococcus pyogenes serotype M1 GN=cinA PE=3 SV=1 47 143 3.0E-10
sp|Q12SN4|CINAL_SHEDO CinA-like protein OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=Sden_0246 PE=3 SV=1 50 270 3.0E-10
sp|B1WSM0|CINAL_CYAA5 CinA-like protein OS=Cyanothece sp. (strain ATCC 51142) GN=cce_4251 PE=3 SV=1 46 225 3.0E-10
sp|A5GWH4|CINAL_SYNR3 CinA-like protein OS=Synechococcus sp. (strain RCC307) GN=SynRCC307_2330 PE=3 SV=1 50 316 4.0E-10
sp|A9VS24|CINA_BACWK Putative competence-damage inducible protein OS=Bacillus weihenstephanensis (strain KBAB4) GN=cinA PE=3 SV=1 46 212 4.0E-10
sp|A3Q9C2|CINAL_SHELP CinA-like protein OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=Shew_0198 PE=3 SV=1 50 133 4.0E-10
sp|Q6HF34|CINA_BACHK Putative competence-damage inducible protein OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cinA PE=3 SV=1 46 212 4.0E-10
sp|B7HLB5|CINA_BACC7 Putative competence-damage inducible protein OS=Bacillus cereus (strain AH187) GN=cinA PE=3 SV=1 46 212 4.0E-10
sp|B7JJ59|CINA_BACC0 Putative competence-damage inducible protein OS=Bacillus cereus (strain AH820) GN=cinA PE=3 SV=1 46 212 4.0E-10
sp|Q81WQ3|CINA_BACAN Putative competence-damage inducible protein OS=Bacillus anthracis GN=cinA PE=3 SV=1 46 212 4.0E-10
sp|C3L7E6|CINA_BACAC Putative competence-damage inducible protein OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=cinA PE=3 SV=1 46 212 4.0E-10
sp|C3P5I7|CINA_BACAA Putative competence-damage inducible protein OS=Bacillus anthracis (strain A0248) GN=cinA PE=3 SV=1 46 212 4.0E-10
sp|C1F6H5|CINAL_ACIC5 CinA-like protein OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=ACP_3409 PE=3 SV=1 47 133 4.0E-10
sp|A4TAK5|CINAL_MYCGI CinA-like protein OS=Mycobacterium gilvum (strain PYR-GCK) GN=Mflv_3280 PE=3 SV=1 47 141 5.0E-10
sp|Q04IM5|CINA_STRP2 Putative competence-damage inducible protein OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=cinA PE=3 SV=1 47 258 5.0E-10
sp|A8G1B1|CINAL_SHESH CinA-like protein OS=Shewanella sediminis (strain HAW-EB3) GN=Ssed_4280 PE=3 SV=1 50 133 6.0E-10
sp|P54184|CINA_STRPN Putative competence-damage inducible protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cinA PE=2 SV=2 47 258 6.0E-10
sp|Q636P5|CINA_BACCZ Putative competence-damage inducible protein OS=Bacillus cereus (strain ZK / E33L) GN=cinA PE=3 SV=1 46 212 6.0E-10
sp|Q8RHR9|CINAL_FUSNN CinA-like protein OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=FN1929 PE=3 SV=1 47 127 7.0E-10
sp|B9IV71|CINA_BACCQ Putative competence-damage inducible protein OS=Bacillus cereus (strain Q1) GN=cinA PE=3 SV=1 46 212 7.0E-10
sp|B9DW66|CINA_STRU0 Putative competence-damage inducible protein OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=cinA PE=3 SV=1 47 258 9.0E-10
sp|A0LLA6|CINAL_SYNFM CinA-like protein OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=Sfum_2530 PE=3 SV=1 46 284 1.0E-09
sp|B7HDQ5|CINA_BACC4 Putative competence-damage inducible protein OS=Bacillus cereus (strain B4264) GN=cinA PE=3 SV=1 46 165 1.0E-09
sp|C1EP04|CINA_BACC3 Putative competence-damage inducible protein OS=Bacillus cereus (strain 03BB102) GN=cinA PE=3 SV=1 46 212 1.0E-09
sp|A0RHF2|CINA_BACAH Putative competence-damage inducible protein OS=Bacillus thuringiensis (strain Al Hakam) GN=cinA PE=3 SV=1 46 212 1.0E-09
sp|Q81A15|CINA_BACCR Putative competence-damage inducible protein OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cinA PE=3 SV=1 46 165 1.0E-09
sp|B1KNC9|CINAL_SHEWM CinA-like protein OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=Swoo_0325 PE=3 SV=1 50 133 1.0E-09
sp|B8DYM0|CINAL_DICTD CinA-like protein OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=Dtur_0064 PE=3 SV=1 50 310 1.0E-09
sp|Q67NW5|CINA_SYMTH Putative competence-damage inducible protein OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=cinA PE=3 SV=1 47 260 1.0E-09
sp|Q089L6|CINAL_SHEFN CinA-like protein OS=Shewanella frigidimarina (strain NCIMB 400) GN=Sfri_0186 PE=3 SV=1 50 270 1.0E-09
sp|Q97D94|CINA_CLOAB Putative competence-damage inducible protein OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=cinA PE=3 SV=1 50 156 2.0E-09
sp|Q8KAX2|CINAL_CHLTE CinA-like protein OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT2029 PE=3 SV=1 47 149 2.0E-09
sp|Q7ZAK3|CINA_STRR6 Putative competence-damage inducible protein OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cinA PE=3 SV=1 47 258 2.0E-09
sp|Q0IDD6|CINAL_SYNS3 CinA-like protein OS=Synechococcus sp. (strain CC9311) GN=sync_0302 PE=3 SV=1 33 310 2.0E-09
sp|A7GRB0|CINA_BACCN Putative competence-damage inducible protein OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=cinA PE=3 SV=1 46 168 2.0E-09
sp|B3EHJ0|CINAL_CHLL2 CinA-like protein OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=Clim_2329 PE=3 SV=1 47 241 2.0E-09
sp|B3ER86|CINAL_AMOA5 CinA-like protein OS=Amoebophilus asiaticus (strain 5a2) GN=Aasi_0301 PE=3 SV=1 52 273 2.0E-09
sp|Q8EQR8|CINA_OCEIH Putative competence-damage inducible protein OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=cinA PE=3 SV=1 45 235 2.0E-09
sp|Q1IPQ9|CINAL_KORVE CinA-like protein OS=Koribacter versatilis (strain Ellin345) GN=Acid345_2140 PE=3 SV=1 47 155 3.0E-09
sp|Q8YMW6|CINAL_NOSS1 CinA-like protein OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr4808 PE=3 SV=1 46 304 3.0E-09
sp|B7JYM6|CINAL_CYAP8 CinA-like protein OS=Cyanothece sp. (strain PCC 8801) GN=PCC8801_0814 PE=3 SV=1 46 304 3.0E-09
sp|B8CNH3|CINAL_SHEPW CinA-like protein OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=swp_2051 PE=3 SV=1 50 133 4.0E-09
sp|Q3B1F7|CINAL_CHLL7 CinA-like protein OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=Plut_1982 PE=3 SV=1 47 124 5.0E-09
sp|A4J5U0|CINA_DESRM Putative competence-damage inducible protein OS=Desulfotomaculum reducens (strain MI-1) GN=cinA PE=3 SV=1 47 264 5.0E-09
sp|A9BHX8|CINAL_PETMO CinA-like protein OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=Pmob_1389 PE=3 SV=1 48 209 6.0E-09
sp|Q2RKI6|CINA_MOOTA Putative competence-damage inducible protein OS=Moorella thermoacetica (strain ATCC 39073) GN=cinA PE=3 SV=1 47 123 6.0E-09
sp|A9KTZ3|CINAL_SHEB9 CinA-like protein OS=Shewanella baltica (strain OS195) GN=Sbal195_4216 PE=3 SV=1 50 270 8.0E-09
sp|B9KAS5|CINAL_THENN CinA-like protein OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=CTN_1882 PE=3 SV=1 47 230 9.0E-09
sp|A8GZ14|CINAL_SHEPA CinA-like protein OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=Spea_0223 PE=3 SV=1 50 270 1.0E-08
sp|A3DA29|CINAL_SHEB5 CinA-like protein OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=Sbal_4127 PE=3 SV=1 50 270 1.0E-08
sp|B1GZ34|CINAL_UNCTG CinA-like protein OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=TGRD_033 PE=3 SV=1 50 145 1.0E-08
sp|A6WTS6|CINAL_SHEB8 CinA-like protein OS=Shewanella baltica (strain OS185) GN=Shew185_4098 PE=3 SV=1 50 270 1.0E-08
sp|B7GJN4|CINA_ANOFW Putative competence-damage inducible protein OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=cinA PE=3 SV=1 47 143 1.0E-08
sp|B8HR57|CINAL_CYAP4 CinA-like protein OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=Cyan7425_1676 PE=3 SV=1 45 145 1.0E-08
sp|Q111G9|CINAL_TRIEI CinA-like protein OS=Trichodesmium erythraeum (strain IMS101) GN=Tery_2662 PE=3 SV=1 47 211 2.0E-08
sp|Q9X7D6|CINAL_MYCLE CinA-like protein OS=Mycobacterium leprae (strain TN) GN=cinA PE=3 SV=2 47 127 2.0E-08
sp|Q8EK32|PNCC_SHEON Nicotinamide-nucleotide amidohydrolase PncC OS=Shewanella oneidensis (strain MR-1) GN=pncC PE=1 SV=1 50 133 3.0E-08
sp|Q0I067|CINAL_SHESR CinA-like protein OS=Shewanella sp. (strain MR-7) GN=Shewmr7_0233 PE=3 SV=1 50 133 3.0E-08
sp|A0L257|CINAL_SHESA CinA-like protein OS=Shewanella sp. (strain ANA-3) GN=Shewana3_3908 PE=3 SV=1 50 133 3.0E-08
sp|A1RPS2|CINAL_SHESW CinA-like protein OS=Shewanella sp. (strain W3-18-1) GN=Sputw3181_3863 PE=3 SV=1 50 133 3.0E-08
sp|A4YBU5|CINAL_SHEPC CinA-like protein OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=Sputcn32_3720 PE=3 SV=1 50 133 3.0E-08
sp|Q3MBD6|CINAL_ANAVT CinA-like protein OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=Ava_2078 PE=3 SV=1 46 133 3.0E-08
sp|Q0HDU2|CINAL_SHESM CinA-like protein OS=Shewanella sp. (strain MR-4) GN=Shewmr4_3712 PE=3 SV=1 53 133 4.0E-08
sp|B0TL92|CINAL_SHEHH CinA-like protein OS=Shewanella halifaxensis (strain HAW-EB4) GN=Shal_4097 PE=3 SV=1 50 133 5.0E-08
sp|A1T9F4|CINAL_MYCVP CinA-like protein OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=Mvan_2999 PE=3 SV=1 47 148 5.0E-08
sp|B1N0C1|CINA_LEUCK Putative competence-damage inducible protein OS=Leuconostoc citreum (strain KM20) GN=cinA PE=3 SV=1 47 150 6.0E-08
sp|Q9KAA5|CINA_BACHD Putative competence-damage inducible protein OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cinA PE=3 SV=1 47 143 8.0E-08
sp|B1XKM7|CINAL_SYNP2 CinA-like protein OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=SYNPCC7002_A2525 PE=3 SV=1 47 264 8.0E-08
sp|Q72QL2|CINAL_LEPIC CinA-like protein OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=LIC_12101 PE=3 SV=1 50 211 8.0E-08
sp|Q55760|CINAL_SYNY3 CinA-like protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0427 PE=3 SV=1 47 304 9.0E-08
sp|Q052J0|CINAL_LEPBL CinA-like protein OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=LBL_1257 PE=3 SV=1 53 226 9.0E-08
sp|Q04TG1|CINAL_LEPBJ CinA-like protein OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=LBJ_1205 PE=3 SV=1 53 226 9.0E-08
sp|Q31RK7|CINAL_SYNE7 CinA-like protein OS=Synechococcus elongatus (strain PCC 7942) GN=Synpcc7942_0280 PE=3 SV=1 45 133 1.0E-07
sp|B8EBG6|CINAL_SHEB2 CinA-like protein OS=Shewanella baltica (strain OS223) GN=Sbal223_4017 PE=3 SV=1 50 133 1.0E-07
sp|B7KFE8|CINAL_CYAP7 CinA-like protein OS=Cyanothece sp. (strain PCC 7424) GN=PCC7424_3471 PE=3 SV=1 46 152 1.0E-07
sp|A0AIJ9|CINA_LISW6 Putative competence-damage inducible protein OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=cinA PE=3 SV=1 46 126 2.0E-07
sp|A4SGM6|CINAL_CHLPM CinA-like protein OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=Cvib_1625 PE=3 SV=1 47 144 2.0E-07
sp|B8DFT0|CINA_LISMH Putative competence-damage inducible protein OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=cinA PE=3 SV=1 46 126 2.0E-07
sp|Q71ZS3|CINA_LISMF Putative competence-damage inducible protein OS=Listeria monocytogenes serotype 4b (strain F2365) GN=cinA PE=3 SV=1 46 126 3.0E-07
sp|C1L2V3|CINA_LISMC Putative competence-damage inducible protein OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=cinA PE=3 SV=1 46 126 3.0E-07
sp|Q8F5J2|CINAL_LEPIN CinA-like protein OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=LA_1689 PE=3 SV=1 50 211 4.0E-07
sp|B0JVG7|CINAL_MICAN CinA-like protein OS=Microcystis aeruginosa (strain NIES-843) GN=MAE_16790 PE=3 SV=1 47 217 5.0E-07
sp|Q0AXI8|CINAL_SYNWW CinA-like protein OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=Swol_1257 PE=3 SV=2 48 149 6.0E-07
sp|Q8Y793|CINA_LISMO Putative competence-damage inducible protein OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cinA PE=3 SV=1 46 126 6.0E-07
sp|B2GB14|CINA_LACF3 Putative competence-damage inducible protein OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=cinA PE=3 SV=1 47 144 7.0E-07
sp|Q5N2P7|CINAL_SYNP6 CinA-like protein OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cinA PE=3 SV=1 45 129 8.0E-07
sp|B0SSV0|CINAL_LEPBP CinA-like protein OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=LEPBI_I2088 PE=3 SV=1 50 153 1.0E-06
sp|B0SB28|CINAL_LEPBA CinA-like protein OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=LBF_2034 PE=3 SV=1 50 153 1.0E-06
sp|B2G6E2|CINA_LACRJ Putative competence-damage inducible protein OS=Lactobacillus reuteri (strain JCM 1112) GN=cinA PE=3 SV=1 47 137 2.0E-06
sp|A5VIW6|CINA_LACRD Putative competence-damage inducible protein OS=Lactobacillus reuteri (strain DSM 20016) GN=cinA PE=3 SV=1 47 137 2.0E-06
sp|Q92BV8|CINA_LISIN Putative competence-damage inducible protein OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=cinA PE=3 SV=1 46 153 2.0E-06
sp|C0QI20|CINAL_DESAH CinA-like protein OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=HRM2_26620 PE=3 SV=1 50 261 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2404
MLSRLSPSSLRLVSGLSIRPAARPWLSSVRGRMAPPDERSARTIHTAACLVIGDEVLGGKTVDTNSAYMAKWCFS
LGISLKRVEVIEDDEGEIVEAVRRMSDRYDFVVTSGGIGPTHDDITYQSIARAFGLPLKLHEPALEKMKRLSKRH
ASQPDFSYDTDSPALRAKLRMVQLPTDESRDPGEQVVFPDAELWVPVAVVNGNVHILPGVPKLFVRLLDGLKPHL
LPRLVDPDGKGTTRVLISTPMAESEIAAYLTELAARVAPRGVKVGSYPRWGKSRNTVTLVGRDKAFLESLVADVA
DNVRGKRVGNESDDDDDG*
Coding >Hirsu2|2404
ATGCTCTCCCGGCTCTCGCCCTCCTCCCTCAGGCTTGTCTCGGGCCTCTCGATCCGCCCAGCCGCGCGCCCGTGG
CTGTCGAGCGTGCGCGGCAGGATGGCGCCGCCGGACGAGCGCAGTGCGCGCACCATCCACACGGCGGCCTGCCTC
GTCATCGGCGACGAGGTGCTGGGCGGCAAGACGGTTGATACCAACTCGGCCTACATGGCCAAGTGGTGCTTCTCC
CTCGGCATTAGCCTGAAGCGAGTCGAGGTGATTGAGGACGACGAGGGCGAGATCGTGGAGGCGGTCCGCCGCATG
AGCGACCGCTACGACTTTGTCGTCACCAGCGGCGGCATCGGTCCGACGCACGACGACATCACGTACCAGTCCATA
GCCCGGGCCTTCGGCCTGCCGCTGAAGCTACACGAGCCGGCGCTCGAAAAGATGAAGAGGCTGTCGAAGCGGCAC
GCGTCGCAGCCCGACTTCAGCTACGACACCGACTCGCCCGCGCTGCGGGCCAAGCTGCGCATGGTCCAGCTGCCG
ACGGACGAGTCGCGCGACCCGGGCGAGCAGGTCGTCTTCCCCGACGCCGAGCTGTGGGTGCCCGTCGCCGTCGTC
AACGGCAACGTCCACATCCTGCCGGGCGTACCGAAGCTGTTCGTGAGGCTGCTGGACGGCCTGAAGCCGCACCTG
CTGCCGCGGCTCGTCGACCCGGACGGCAAGGGCACGACGCGGGTGCTGATCTCGACGCCCATGGCCGAGAGCGAG
ATCGCCGCCTACCTGACCGAGCTGGCGGCCCGGGTCGCGCCCCGGGGCGTCAAGGTCGGCAGCTACCCGCGCTGG
GGCAAGTCGCGCAACACGGTGACGCTCGTCGGGAGAGACAAGGCCTTCCTCGAGAGCCTGGTGGCCGACGTGGCG
GACAACGTTCGCGGCAAGCGGGTCGGCAACGAGAGCGACGACGACGACGACGGCTGA
Transcript >Hirsu2|2404
ATGCTCTCCCGGCTCTCGCCCTCCTCCCTCAGGCTTGTCTCGGGCCTCTCGATCCGCCCAGCCGCGCGCCCGTGG
CTGTCGAGCGTGCGCGGCAGGATGGCGCCGCCGGACGAGCGCAGTGCGCGCACCATCCACACGGCGGCCTGCCTC
GTCATCGGCGACGAGGTGCTGGGCGGCAAGACGGTTGATACCAACTCGGCCTACATGGCCAAGTGGTGCTTCTCC
CTCGGCATTAGCCTGAAGCGAGTCGAGGTGATTGAGGACGACGAGGGCGAGATCGTGGAGGCGGTCCGCCGCATG
AGCGACCGCTACGACTTTGTCGTCACCAGCGGCGGCATCGGTCCGACGCACGACGACATCACGTACCAGTCCATA
GCCCGGGCCTTCGGCCTGCCGCTGAAGCTACACGAGCCGGCGCTCGAAAAGATGAAGAGGCTGTCGAAGCGGCAC
GCGTCGCAGCCCGACTTCAGCTACGACACCGACTCGCCCGCGCTGCGGGCCAAGCTGCGCATGGTCCAGCTGCCG
ACGGACGAGTCGCGCGACCCGGGCGAGCAGGTCGTCTTCCCCGACGCCGAGCTGTGGGTGCCCGTCGCCGTCGTC
AACGGCAACGTCCACATCCTGCCGGGCGTACCGAAGCTGTTCGTGAGGCTGCTGGACGGCCTGAAGCCGCACCTG
CTGCCGCGGCTCGTCGACCCGGACGGCAAGGGCACGACGCGGGTGCTGATCTCGACGCCCATGGCCGAGAGCGAG
ATCGCCGCCTACCTGACCGAGCTGGCGGCCCGGGTCGCGCCCCGGGGCGTCAAGGTCGGCAGCTACCCGCGCTGG
GGCAAGTCGCGCAACACGGTGACGCTCGTCGGGAGAGACAAGGCCTTCCTCGAGAGCCTGGTGGCCGACGTGGCG
GACAACGTTCGCGGCAAGCGGGTCGGCAACGAGAGCGACGACGACGACGACGGCTGA
Gene >Hirsu2|2404
ATGCTCTCCCGGCTCTCGCCCTCCTCCCTCAGGCTTGTCTCGGGCCTCTCGATCCGCCCAGCCGCGCGCCCGTGG
CTGTCGAGCGTGCGCGGCAGGATGGCGCCGCCGGACGAGCGCAGTGCGCGCACCATCCACACGGCGGCCTGCCTC
GTCATCGGCGACGAGGTGCTGGGCGGCAAGGTGAGAGAAGGGGCGCCGTGCCGCCGCGCGACGTCACGGCCCGCT
GACAGCGCTCCAGACGGTTGATGTAGGCCCTGCTCGTCCTTGGCGCTCGACCGGTCAGGGAAGAGCAGACTGACG
CGAGGCCAGACCAACTCGGCCTACATGGCCAAGTGGTGCTTCTCCCTCGGCATTGTAACGTCACCGCCCACCGCT
GCCGGCCGGCGTCGCCGAGGCGCGCTGACTCCTGCGGCAGAGCCTGAAGCGAGTCGAGGTGATTGAGGACGACGA
GGGCGAGATCGTGGAGGCGGTCCGCCGCATGAGCGACCGCTACGACTTTGTCGTCACCAGGTGTGCCGAGCCGGT
CCCGGACGGCTCCCCCGTGTGTGTGTGTGTGTGTGTGTGCTGACACGACGTACCCGATCCCAGCGGCGGCATCGG
TCCGACGTGAGCGAAAGCCCATAGTTCCCCTCCTCTCCCCCTTTTGGTGTGCGCAATCGCTGACGCCGGCGCAGG
CACGACGACATCACGTACCAGTCCATAGCCCGGGCCTTCGGCCTGCCGCTGAAGCTACACGAGCCGGCGCTCGAA
AAGATGAAGAGGCTGTCGAAGCGGCACGCGTCGCAGCCCGACTTCAGCTACGACACCGACTCGCCCGCGCTGCGG
GCCAAGCTGCGCATGGTCCAGCTGCCGACGGACGAGTCGCGCGACCCGGGCGAGCAGGTCGTCTTCCCCGACGCC
GAGCTGTGGGTGCCCGTCGCCGTCGTCAACGGCAACGTCCACATCCTGCCGGGCGTACCGAAGCTGTGTAGGCCT
GCCCCTTCTCCCCCGACCCTCGCCGGCCCGCCTTCTCGGCTGACGACGGGGGGAGCGCCGGCCGCAAAGTCGTGA
GGCTGCTGGACGGCCTGAAGCCGCACCTGCTGCCGCGGCTCGTCGACCCGGACGGCAAGGGCACGACGCGGGTGC
TGATCTCGACGCCCATGGCCGAGAGCGAGATCGCCGCCTACCTGACCGAGCTGGCGGCCCGGGTCGCGCCCCGGG
GCGTCAAGGTCGGCAGCTACCCGCGCTGGGGCAAGTCGCGCAACACGGTGACGCTCGTCGGGAGGTAAGGCCGCC
CTTGTCCAAGCCCCTCTCTCGTCCCTCTCGGCTCGTGTCCGCCCGCGGCTCCCTTGATACGGCCGTGCCGGAGAG
AGCTGACGCAGGCGCCGACCGGCTCAGAGACAAGGCCTTCCTCGAGAGCCTGGTGGCCGACGTGGCGGACAACGT
TCGCGGCAAGCGGGTCGGCAACGAGAGCGACGACGACGACGACGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail