Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|240
Gene name
LocationContig_1042:2114..5240
Strand-
Gene length (bp)3126
Transcript length (bp)3030
Coding sequence length (bp)3030
Protein length (aa) 1010

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09421 FRQ Frequency clock protein 0.0E+00 20 1005

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q00586|FRQ_TRISN Frequency clock protein OS=Trichoderma spinulosum GN=FRQ PE=3 SV=1 1 1004 0.0E+00
sp|Q01115|FRQ_LEPAU Frequency clock protein OS=Leptosphaeria australiensis GN=FRQ PE=3 SV=1 18 1008 0.0E+00
sp|P19970|FRQ_NEUCR Frequency clock protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=frq PE=1 SV=3 8 1001 0.0E+00
sp|Q09033|FRQ_SORFI Frequency clock protein OS=Sordaria fimicola GN=FRQ PE=3 SV=1 8 1001 0.0E+00

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0007623 circadian rhythm Yes
GO:0005737 cytoplasm Yes
GO:0060255 regulation of macromolecule metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0005575 cellular_component No
GO:0043226 organelle No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0009889 regulation of biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0010468 regulation of gene expression No
GO:0065007 biological regulation No
GO:0031323 regulation of cellular metabolic process No
GO:0043229 intracellular organelle No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0044464 cell part No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0044424 intracellular part No
GO:0048511 rhythmic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0043227 membrane-bounded organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|240
MPLTEHTSQGTQPPPQPPPTSCHPLPRRTSPANSVTLRHHRLARDASLRASPGSGPANTSNVTSSPRRNSSGESH
ETGQSDPKKWFEQSNQNPTATFDNNVMDVDPPFFQKESDSSNEDKSYPYQHQAVPPRLVAAQSSSADDYRSVIDD
LTVEIQKLKEELKRYKQKGPDMLRKDKLFEIKIHGLPKRKKRELETTLRDFAASLGDSPDASSSQRKKSSRHATR
DHMYSASGSVSKHASSSSGSNVRPVDSAYASMSTGAHSSGTSLGRPSMSMRARSSEQKVQNYLRDIPEGLYPRHM
AMTEREKKKIVVRRLEQLFTGKIGGRHFRRSHLAPPAVGTGVLGPVIPEGQPPSNQQMHQPPTLVTAAEPAREAR
ILPPEQQSGHPGKKSRSRDNGSASNSNGDQTESGGNGNSSGSGANTSPSNMPPPPEQRPTRLKDLDPDRVQVPSE
NMEYIRHLGLVPSELLAGSAQTAPDVVHPDAEGWVYLNLLCNLAQLHMINVTPSFVRSAVSEISTKFQLSPDGRK
IRWRGGSEGTKFSSDSSGGTPQRSPDTDDTASSNKEASRKRQKTGNSTGDDFQSGSSGKNPYKFGPQISGSSESF
HYKPLFVQQESPNGQTSPDDTLSSFGPVEDSNMGGGSRWGLSGSGTSNRRKRRHDGAIIYYSGAPFCTDLSGDPG
DVSPATYMLSSGQDRQEPTAQFVRPLPRRSASGSSLCFRPLSDGPGSSLGGAGSSGGDVVAATAPGAATAGAGDE
ASEDIEFDLTWSGDQQYFEVRPLEPCGLGGVLPDDHFMVVVTTRRPKREMLTRISSTGRAKADEATDCIINRLAS
MTTSSPVPLMSRSSSQQCGSAAAVEMEYVSGRIKRLAPVPLPPPAIFFPPFSTDSSNDGDTDVGFEGDDDEYESS
EEFMSRRANPHQSDGYPDGVDLSSGDEDGEDPDDEPDTRRMYDVDMRNREDRESDGNARRSIGSAEAAPGTLRGR
SKSASEMMARTGGSSAATAGGVGSGFSSSGEEST*
Coding >Hirsu2|240
ATGCCCTTGACCGAGCACACCTCCCAGGGCACGCAACCACCGCCGCAACCGCCGCCCACCTCGTGCCACCCGCTG
CCTCGCCGAACCTCGCCCGCCAACTCCGTCACGCTACGTCACCACCGCCTCGCCCGCGATGCCTCCCTCCGAGCG
AGCCCCGGCTCCGGCCCGGCCAACACCAGCAATGTGACGTCGTCGCCGCGCCGGAACTCGTCGGGCGAGAGCCAC
GAGACGGGCCAGAGCGACCCCAAGAAATGGTTCGAGCAGTCCAACCAGAACCCGACGGCCACCTTTGACAACAAC
GTCATGGACGTCGATCCGCCCTTCTTCCAGAAAGAGTCCGACTCGTCCAACGAGGACAAGTCGTACCCCTACCAG
CACCAGGCCGTCCCGCCCCGCCTCGTGGCCGCCCAGAGCAGCAGCGCCGACGACTACCGGAGCGTCATCGACGAC
CTGACCGTCGAGATCCAGAAGCTCAAGGAGGAGCTCAAGCGCTACAAGCAAAAGGGCCCCGACATGCTGCGCAAG
GACAAGCTGTTCGAGATCAAGATCCACGGCCTGCCCAAGCGCAAGAAGCGCGAGCTGGAGACGACGCTGCGCGAC
TTCGCCGCCAGCCTCGGCGACTCGCCCGATGCCTCGTCCTCGCAGCGCAAGAAGTCGTCCAGGCACGCCACCCGC
GACCACATGTACTCGGCCTCCGGCTCCGTCTCCAAGCACGCCTCCTCCTCGTCCGGCTCCAACGTCCGGCCCGTC
GACTCGGCCTACGCCTCCATGTCCACCGGCGCCCACTCGTCTGGCACCTCTCTCGGCCGGCCCTCGATGAGCATG
AGGGCGCGCTCGTCGGAGCAGAAGGTGCAGAACTACCTGCGTGACATCCCCGAGGGCCTGTACCCGCGCCACATG
GCCATGACGGAGCGGGAGAAGAAGAAGATTGTGGTGCGGCGCCTGGAGCAGCTCTTCACCGGCAAGATCGGCGGC
CGTCACTTCCGACGCAGTCACCTCGCACCCCCCGCCGTCGGCACCGGCGTGCTGGGCCCCGTCATCCCCGAGGGC
CAGCCGCCGTCGAACCAGCAGATGCACCAGCCGCCGACCCTCGTGACGGCCGCCGAGCCGGCGCGCGAGGCGAGG
ATTCTCCCCCCGGAGCAGCAGTCGGGCCACCCGGGCAAGAAGAGCCGGTCCAGGGACAACGGCTCGGCCTCCAAC
TCGAACGGAGACCAGACCGAGTCGGGCGGCAACGGGAACAGCAGCGGCTCCGGGGCCAACACGTCGCCGTCCAAC
ATGCCGCCGCCGCCCGAGCAGCGGCCGACGCGCCTCAAGGACCTCGACCCGGACCGCGTCCAGGTCCCGTCCGAG
AACATGGAGTATATCCGTCACCTCGGCCTGGTGCCGTCGGAGCTGTTGGCGGGCTCCGCCCAGACGGCGCCCGAC
GTCGTCCACCCCGACGCCGAGGGCTGGGTCTACCTCAACCTCCTCTGCAACCTGGCGCAGCTGCACATGATCAAC
GTGACGCCCAGCTTCGTCCGCTCCGCCGTGTCGGAGATCAGCACCAAGTTTCAGCTCTCGCCCGACGGCCGCAAG
ATCCGCTGGCGCGGCGGCAGCGAGGGCACCAAGTTCTCGAGCGACAGCTCCGGCGGCACGCCCCAGCGGAGCCCG
GACACGGACGACACGGCCAGCTCCAACAAGGAGGCGTCGCGCAAGCGGCAGAAGACGGGCAACTCGACGGGCGAC
GACTTCCAGTCCGGCAGCTCGGGCAAGAACCCCTACAAGTTCGGGCCCCAAATCTCGGGCTCGTCGGAGAGCTTC
CACTACAAGCCGCTCTTCGTCCAGCAGGAGTCGCCCAACGGACAGACGTCGCCCGACGACACGCTGTCGTCGTTC
GGCCCGGTCGAGGACAGCAACATGGGCGGCGGCTCCCGCTGGGGGCTCAGCGGGTCGGGCACGTCGAACCGGAGG
AAGCGGCGCCATGACGGCGCCATCATCTACTACAGCGGGGCCCCGTTCTGCACCGATCTGTCGGGGGATCCCGGC
GACGTGTCCCCGGCGACGTACATGCTCTCGAGCGGCCAGGACCGCCAGGAGCCGACGGCGCAGTTCGTGCGGCCG
CTGCCCCGGCGGTCCGCGTCCGGCTCGTCCCTGTGCTTCCGCCCGCTGAGTGACGGGCCCGGCAGCAGTCTGGGT
GGCGCGGGGTCCTCCGGGGGGGACGTCGTCGCCGCGACGGCCCCGGGCGCCGCGACGGCCGGGGCCGGGGACGAG
GCGTCCGAGGACATCGAGTTCGACCTGACGTGGTCCGGCGACCAGCAGTACTTCGAGGTGCGACCGCTGGAGCCG
TGCGGGCTCGGCGGCGTCCTGCCCGACGACCACTTCATGGTGGTGGTGACGACGAGGCGGCCGAAGCGGGAGATG
CTGACGCGCATCTCGTCGACGGGGCGGGCCAAGGCGGACGAGGCGACGGACTGCATCATCAACCGGCTGGCGTCG
ATGACGACGTCGTCGCCGGTGCCGCTCATGTCGCGGTCGTCGTCGCAGCAGTGCGGCTCGGCGGCGGCGGTGGAG
ATGGAGTACGTGTCCGGGCGGATCAAGCGGCTGGCGCCGGTGCCGCTGCCGCCGCCGGCCATCTTCTTCCCGCCC
TTCAGCACCGACTCGTCCAACGACGGCGACACGGACGTGGGCTTCGAGGGCGACGACGACGAGTACGAGTCATCG
GAAGAGTTTATGAGCCGGCGGGCCAACCCGCACCAGTCGGACGGGTACCCCGACGGCGTGGACCTCAGCAGCGGG
GACGAGGATGGTGAGGACCCGGACGACGAGCCCGACACGCGGCGCATGTACGACGTGGACATGCGCAACCGCGAG
GACCGCGAGTCGGACGGGAACGCGCGCCGGTCCATCGGCAGCGCCGAGGCGGCCCCGGGCACGCTGCGGGGCCGG
AGCAAGAGCGCCAGCGAGATGATGGCGCGGACGGGCGGCAGCTCCGCCGCCACGGCCGGCGGGGTGGGGAGCGGC
TTCAGCAGCAGCGGCGAGGAGAGCACCTAG
Transcript >Hirsu2|240
ATGCCCTTGACCGAGCACACCTCCCAGGGCACGCAACCACCGCCGCAACCGCCGCCCACCTCGTGCCACCCGCTG
CCTCGCCGAACCTCGCCCGCCAACTCCGTCACGCTACGTCACCACCGCCTCGCCCGCGATGCCTCCCTCCGAGCG
AGCCCCGGCTCCGGCCCGGCCAACACCAGCAATGTGACGTCGTCGCCGCGCCGGAACTCGTCGGGCGAGAGCCAC
GAGACGGGCCAGAGCGACCCCAAGAAATGGTTCGAGCAGTCCAACCAGAACCCGACGGCCACCTTTGACAACAAC
GTCATGGACGTCGATCCGCCCTTCTTCCAGAAAGAGTCCGACTCGTCCAACGAGGACAAGTCGTACCCCTACCAG
CACCAGGCCGTCCCGCCCCGCCTCGTGGCCGCCCAGAGCAGCAGCGCCGACGACTACCGGAGCGTCATCGACGAC
CTGACCGTCGAGATCCAGAAGCTCAAGGAGGAGCTCAAGCGCTACAAGCAAAAGGGCCCCGACATGCTGCGCAAG
GACAAGCTGTTCGAGATCAAGATCCACGGCCTGCCCAAGCGCAAGAAGCGCGAGCTGGAGACGACGCTGCGCGAC
TTCGCCGCCAGCCTCGGCGACTCGCCCGATGCCTCGTCCTCGCAGCGCAAGAAGTCGTCCAGGCACGCCACCCGC
GACCACATGTACTCGGCCTCCGGCTCCGTCTCCAAGCACGCCTCCTCCTCGTCCGGCTCCAACGTCCGGCCCGTC
GACTCGGCCTACGCCTCCATGTCCACCGGCGCCCACTCGTCTGGCACCTCTCTCGGCCGGCCCTCGATGAGCATG
AGGGCGCGCTCGTCGGAGCAGAAGGTGCAGAACTACCTGCGTGACATCCCCGAGGGCCTGTACCCGCGCCACATG
GCCATGACGGAGCGGGAGAAGAAGAAGATTGTGGTGCGGCGCCTGGAGCAGCTCTTCACCGGCAAGATCGGCGGC
CGTCACTTCCGACGCAGTCACCTCGCACCCCCCGCCGTCGGCACCGGCGTGCTGGGCCCCGTCATCCCCGAGGGC
CAGCCGCCGTCGAACCAGCAGATGCACCAGCCGCCGACCCTCGTGACGGCCGCCGAGCCGGCGCGCGAGGCGAGG
ATTCTCCCCCCGGAGCAGCAGTCGGGCCACCCGGGCAAGAAGAGCCGGTCCAGGGACAACGGCTCGGCCTCCAAC
TCGAACGGAGACCAGACCGAGTCGGGCGGCAACGGGAACAGCAGCGGCTCCGGGGCCAACACGTCGCCGTCCAAC
ATGCCGCCGCCGCCCGAGCAGCGGCCGACGCGCCTCAAGGACCTCGACCCGGACCGCGTCCAGGTCCCGTCCGAG
AACATGGAGTATATCCGTCACCTCGGCCTGGTGCCGTCGGAGCTGTTGGCGGGCTCCGCCCAGACGGCGCCCGAC
GTCGTCCACCCCGACGCCGAGGGCTGGGTCTACCTCAACCTCCTCTGCAACCTGGCGCAGCTGCACATGATCAAC
GTGACGCCCAGCTTCGTCCGCTCCGCCGTGTCGGAGATCAGCACCAAGTTTCAGCTCTCGCCCGACGGCCGCAAG
ATCCGCTGGCGCGGCGGCAGCGAGGGCACCAAGTTCTCGAGCGACAGCTCCGGCGGCACGCCCCAGCGGAGCCCG
GACACGGACGACACGGCCAGCTCCAACAAGGAGGCGTCGCGCAAGCGGCAGAAGACGGGCAACTCGACGGGCGAC
GACTTCCAGTCCGGCAGCTCGGGCAAGAACCCCTACAAGTTCGGGCCCCAAATCTCGGGCTCGTCGGAGAGCTTC
CACTACAAGCCGCTCTTCGTCCAGCAGGAGTCGCCCAACGGACAGACGTCGCCCGACGACACGCTGTCGTCGTTC
GGCCCGGTCGAGGACAGCAACATGGGCGGCGGCTCCCGCTGGGGGCTCAGCGGGTCGGGCACGTCGAACCGGAGG
AAGCGGCGCCATGACGGCGCCATCATCTACTACAGCGGGGCCCCGTTCTGCACCGATCTGTCGGGGGATCCCGGC
GACGTGTCCCCGGCGACGTACATGCTCTCGAGCGGCCAGGACCGCCAGGAGCCGACGGCGCAGTTCGTGCGGCCG
CTGCCCCGGCGGTCCGCGTCCGGCTCGTCCCTGTGCTTCCGCCCGCTGAGTGACGGGCCCGGCAGCAGTCTGGGT
GGCGCGGGGTCCTCCGGGGGGGACGTCGTCGCCGCGACGGCCCCGGGCGCCGCGACGGCCGGGGCCGGGGACGAG
GCGTCCGAGGACATCGAGTTCGACCTGACGTGGTCCGGCGACCAGCAGTACTTCGAGGTGCGACCGCTGGAGCCG
TGCGGGCTCGGCGGCGTCCTGCCCGACGACCACTTCATGGTGGTGGTGACGACGAGGCGGCCGAAGCGGGAGATG
CTGACGCGCATCTCGTCGACGGGGCGGGCCAAGGCGGACGAGGCGACGGACTGCATCATCAACCGGCTGGCGTCG
ATGACGACGTCGTCGCCGGTGCCGCTCATGTCGCGGTCGTCGTCGCAGCAGTGCGGCTCGGCGGCGGCGGTGGAG
ATGGAGTACGTGTCCGGGCGGATCAAGCGGCTGGCGCCGGTGCCGCTGCCGCCGCCGGCCATCTTCTTCCCGCCC
TTCAGCACCGACTCGTCCAACGACGGCGACACGGACGTGGGCTTCGAGGGCGACGACGACGAGTACGAGTCATCG
GAAGAGTTTATGAGCCGGCGGGCCAACCCGCACCAGTCGGACGGGTACCCCGACGGCGTGGACCTCAGCAGCGGG
GACGAGGATGGTGAGGACCCGGACGACGAGCCCGACACGCGGCGCATGTACGACGTGGACATGCGCAACCGCGAG
GACCGCGAGTCGGACGGGAACGCGCGCCGGTCCATCGGCAGCGCCGAGGCGGCCCCGGGCACGCTGCGGGGCCGG
AGCAAGAGCGCCAGCGAGATGATGGCGCGGACGGGCGGCAGCTCCGCCGCCACGGCCGGCGGGGTGGGGAGCGGC
TTCAGCAGCAGCGGCGAGGAGAGCACCTAG
Gene >Hirsu2|240
ATGCCCTTGACCGAGCACACCTCCCAGGGCACGCAACCACCGCCGCAACCGCCGCCCACCTCGTGCCACCCGCTG
CCTCGCCGAACCTCGCCCGCCAACTCCGTCACGCTACGTCACCACCGCCTCGCCCGCGATGCCTCCCTCCGAGCG
AGCCCCGGCTCCGGCCCGGCCAACACCAGCAATGTGACGTCGTCGCCGCGCCGGAACTCGTCGGGCGAGAGCCAC
GAGACGGGCCAGAGCGACCCCAAGAAATGGTTCGAGCAGTCCAACCAGAACCCGACGGCCACCTTTGACAACAAC
GTCATGGACGGTCAGTGCCCGCCATCGCCCTGCCCTCATCCCTCCCCCGGCTGTCCCTCTCCAGCCAGCCCGCGC
GATCGTCGTTGTTGACGCTCGAGAAATGCAGTCGATCCGCCCTTCTTCCAGAAAGAGTCCGACTCGTCCAACGAG
GACAAGTCGTACCCCTACCAGCACCAGGCCGTCCCGCCCCGCCTCGTGGCCGCCCAGAGCAGCAGCGCCGACGAC
TACCGGAGCGTCATCGACGACCTGACCGTCGAGATCCAGAAGCTCAAGGAGGAGCTCAAGCGCTACAAGCAAAAG
GGCCCCGACATGCTGCGCAAGGACAAGCTGTTCGAGATCAAGATCCACGGCCTGCCCAAGCGCAAGAAGCGCGAG
CTGGAGACGACGCTGCGCGACTTCGCCGCCAGCCTCGGCGACTCGCCCGATGCCTCGTCCTCGCAGCGCAAGAAG
TCGTCCAGGCACGCCACCCGCGACCACATGTACTCGGCCTCCGGCTCCGTCTCCAAGCACGCCTCCTCCTCGTCC
GGCTCCAACGTCCGGCCCGTCGACTCGGCCTACGCCTCCATGTCCACCGGCGCCCACTCGTCTGGCACCTCTCTC
GGCCGGCCCTCGATGAGCATGAGGGCGCGCTCGTCGGAGCAGAAGGTGCAGAACTACCTGCGTGACATCCCCGAG
GGCCTGTACCCGCGCCACATGGCCATGACGGAGCGGGAGAAGAAGAAGATTGTGGTGCGGCGCCTGGAGCAGCTC
TTCACCGGCAAGATCGGCGGCCGTCACTTCCGACGCAGTCACCTCGCACCCCCCGCCGTCGGCACCGGCGTGCTG
GGCCCCGTCATCCCCGAGGGCCAGCCGCCGTCGAACCAGCAGATGCACCAGCCGCCGACCCTCGTGACGGCCGCC
GAGCCGGCGCGCGAGGCGAGGATTCTCCCCCCGGAGCAGCAGTCGGGCCACCCGGGCAAGAAGAGCCGGTCCAGG
GACAACGGCTCGGCCTCCAACTCGAACGGAGACCAGACCGAGTCGGGCGGCAACGGGAACAGCAGCGGCTCCGGG
GCCAACACGTCGCCGTCCAACATGCCGCCGCCGCCCGAGCAGCGGCCGACGCGCCTCAAGGACCTCGACCCGGAC
CGCGTCCAGGTCCCGTCCGAGAACATGGAGTATATCCGTCACCTCGGCCTGGTGCCGTCGGAGCTGTTGGCGGGC
TCCGCCCAGACGGCGCCCGACGTCGTCCACCCCGACGCCGAGGGCTGGGTCTACCTCAACCTCCTCTGCAACCTG
GCGCAGCTGCACATGATCAACGTGACGCCCAGCTTCGTCCGCTCCGCCGTGTCGGAGATCAGCACCAAGTTTCAG
CTCTCGCCCGACGGCCGCAAGATCCGCTGGCGCGGCGGCAGCGAGGGCACCAAGTTCTCGAGCGACAGCTCCGGC
GGCACGCCCCAGCGGAGCCCGGACACGGACGACACGGCCAGCTCCAACAAGGAGGCGTCGCGCAAGCGGCAGAAG
ACGGGCAACTCGACGGGCGACGACTTCCAGTCCGGCAGCTCGGGCAAGAACCCCTACAAGTTCGGGCCCCAAATC
TCGGGCTCGTCGGAGAGCTTCCACTACAAGCCGCTCTTCGTCCAGCAGGAGTCGCCCAACGGACAGACGTCGCCC
GACGACACGCTGTCGTCGTTCGGCCCGGTCGAGGACAGCAACATGGGCGGCGGCTCCCGCTGGGGGCTCAGCGGG
TCGGGCACGTCGAACCGGAGGAAGCGGCGCCATGACGGCGCCATCATCTACTACAGCGGGGCCCCGTTCTGCACC
GATCTGTCGGGGGATCCCGGCGACGTGTCCCCGGCGACGTACATGCTCTCGAGCGGCCAGGACCGCCAGGAGCCG
ACGGCGCAGTTCGTGCGGCCGCTGCCCCGGCGGTCCGCGTCCGGCTCGTCCCTGTGCTTCCGCCCGCTGAGTGAC
GGGCCCGGCAGCAGTCTGGGTGGCGCGGGGTCCTCCGGGGGGGACGTCGTCGCCGCGACGGCCCCGGGCGCCGCG
ACGGCCGGGGCCGGGGACGAGGCGTCCGAGGACATCGAGTTCGACCTGACGTGGTCCGGCGACCAGCAGTACTTC
GAGGTGCGACCGCTGGAGCCGTGCGGGCTCGGCGGCGTCCTGCCCGACGACCACTTCATGGTGGTGGTGACGACG
AGGCGGCCGAAGCGGGAGATGCTGACGCGCATCTCGTCGACGGGGCGGGCCAAGGCGGACGAGGCGACGGACTGC
ATCATCAACCGGCTGGCGTCGATGACGACGTCGTCGCCGGTGCCGCTCATGTCGCGGTCGTCGTCGCAGCAGTGC
GGCTCGGCGGCGGCGGTGGAGATGGAGTACGTGTCCGGGCGGATCAAGCGGCTGGCGCCGGTGCCGCTGCCGCCG
CCGGCCATCTTCTTCCCGCCCTTCAGCACCGACTCGTCCAACGACGGCGACACGGACGTGGGCTTCGAGGGCGAC
GACGACGAGTACGAGTCATCGGAAGAGTTTATGAGCCGGCGGGCCAACCCGCACCAGTCGGACGGGTACCCCGAC
GGCGTGGACCTCAGCAGCGGGGACGAGGATGGTGAGGACCCGGACGACGAGCCCGACACGCGGCGCATGTACGAC
GTGGACATGCGCAACCGCGAGGACCGCGAGTCGGACGGGAACGCGCGCCGGTCCATCGGCAGCGCCGAGGCGGCC
CCGGGCACGCTGCGGGGCCGGAGCAAGAGCGCCAGCGAGATGATGGCGCGGACGGGCGGCAGCTCCGCCGCCACG
GCCGGCGGGGTGGGGAGCGGCTTCAGCAGCAGCGGCGAGGAGAGCACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail