Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|239
Gene name
LocationContig_1042:25..1061
Strand-
Gene length (bp)1036
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07156 Prenylcys_lyase Prenylcysteine lyase 2.2E-26 140 246
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 6.7E-11 33 95
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 4.7E-07 39 114
PF01266 DAO FAD dependent oxidoreductase 1.3E-06 31 73

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q95KC9|PCYOX_MACFA Prenylcysteine oxidase OS=Macaca fascicularis GN=PCYOX1 PE=2 SV=1 31 231 8.0E-14
sp|P57681|PCYOX_ARATH Farnesylcysteine lyase OS=Arabidopsis thaliana GN=FLCY PE=1 SV=1 8 248 2.0E-13
sp|Q99ML5|PCYOX_RAT Prenylcysteine oxidase OS=Rattus norvegicus GN=Pcyox1 PE=1 SV=1 29 228 2.0E-13
sp|Q9CQF9|PCYOX_MOUSE Prenylcysteine oxidase OS=Mus musculus GN=Pcyox1 PE=1 SV=1 31 228 4.0E-13
sp|Q0P5H1|PCYXL_BOVIN Prenylcysteine oxidase-like OS=Bos taurus GN=PCYOX1L PE=2 SV=1 30 233 6.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q95KC9|PCYOX_MACFA Prenylcysteine oxidase OS=Macaca fascicularis GN=PCYOX1 PE=2 SV=1 31 231 8.0E-14
sp|P57681|PCYOX_ARATH Farnesylcysteine lyase OS=Arabidopsis thaliana GN=FLCY PE=1 SV=1 8 248 2.0E-13
sp|Q99ML5|PCYOX_RAT Prenylcysteine oxidase OS=Rattus norvegicus GN=Pcyox1 PE=1 SV=1 29 228 2.0E-13
sp|Q9CQF9|PCYOX_MOUSE Prenylcysteine oxidase OS=Mus musculus GN=Pcyox1 PE=1 SV=1 31 228 4.0E-13
sp|Q0P5H1|PCYXL_BOVIN Prenylcysteine oxidase-like OS=Bos taurus GN=PCYOX1L PE=2 SV=1 30 233 6.0E-09
sp|Q8NBM8|PCYXL_HUMAN Prenylcysteine oxidase-like OS=Homo sapiens GN=PCYOX1L PE=1 SV=2 30 233 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor Yes
GO:0055114 oxidation-reduction process Yes
GO:0030328 prenylcysteine catabolic process Yes
GO:0043436 oxoacid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0046395 carboxylic acid catabolic process No
GO:0008152 metabolic process No
GO:0044248 cellular catabolic process No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0008150 biological_process No
GO:0006575 cellular modified amino acid metabolic process No
GO:0003674 molecular_function No
GO:1901575 organic substance catabolic process No
GO:0044237 cellular metabolic process No
GO:0009063 cellular amino acid catabolic process No
GO:0044273 sulfur compound catabolic process No
GO:0044282 small molecule catabolic process No
GO:0042219 cellular modified amino acid catabolic process No
GO:0006082 organic acid metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0030329 prenylcysteine metabolic process No
GO:0000096 sulfur amino acid metabolic process No
GO:0003824 catalytic activity No
GO:0009056 catabolic process No
GO:0016054 organic acid catabolic process No
GO:0000098 sulfur amino acid catabolic process No
GO:0044281 small molecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|239
MRSPLGLVLAAAAAALGLRAAADSEREVRNVAIIGAGAAGASTAYHLRQYAQAAGLAVNVTIFERGGRAGGRSLT
VGAYGDAAQPLELGASIFVSLNQILCNASRALGLTLAEAGAGAEPGDVTLVWDGADVVFRSVEGEAWWWLAGRLL
WRYGAAPYRAVRLVRAVVANFLRLYDPPFFPFRSLTRRVYELGLHKVTGLTGEQFLAENKIDAGFARDVMQPATR
VNYASNLAHIHGLEAMVSFATDGAQRRRPRPQHVRRRHRDRQGRHAARRPPPVPPLHPTRHH*
Coding >Hirsu2|239
ATGCGCTCACCGCTGGGCCTCGTCCTGGCGGCGGCCGCGGCGGCACTGGGGCTGAGGGCGGCGGCGGATTCCGAG
CGGGAGGTCAGGAACGTGGCCATCATCGGTGCCGGGGCGGCTGGCGCGTCGACGGCGTACCACCTGCGGCAGTAC
GCGCAGGCGGCCGGGCTGGCCGTCAACGTAACCATCTTCGAGCGCGGCGGGCGCGCGGGCGGGCGCAGCCTGACG
GTGGGCGCCTACGGCGACGCGGCGCAGCCGCTCGAGCTGGGCGCCTCCATCTTCGTCAGCCTCAACCAGATCCTG
TGCAACGCGAGCCGGGCGCTGGGCCTGACGCTGGCCGAGGCCGGCGCCGGCGCCGAGCCGGGCGACGTCACCCTC
GTCTGGGACGGCGCCGACGTCGTCTTCCGCTCCGTCGAGGGCGAGGCCTGGTGGTGGTTGGCGGGGCGGCTGCTG
TGGCGATACGGCGCCGCGCCCTACCGCGCCGTCCGCCTCGTCCGCGCCGTCGTCGCTAACTTCCTTCGTCTCTAC
GATCCGCCCTTCTTCCCGTTCCGCTCGCTGACCCGCCGCGTGTACGAGCTTGGCCTGCATAAGGTCACTGGATTG
ACGGGCGAGCAGTTCCTGGCGGAGAACAAGATCGATGCGGGATTCGCGCGCGACGTCATGCAGCCGGCGACGCGC
GTCAACTACGCCTCCAACCTGGCCCACATCCACGGCCTCGAGGCCATGGTCTCCTTCGCCACCGACGGCGCCCAG
CGGCGCCGCCCTCGTCCGCAACACGTCCGTCGCCGCCATCGAGATCGACAAGGGCGCCATGCGGCCCGGCGCCCG
CCGCCGGTACCGCCTCTCCACCCGACCCGCCACCACTGA
Transcript >Hirsu2|239
ATGCGCTCACCGCTGGGCCTCGTCCTGGCGGCGGCCGCGGCGGCACTGGGGCTGAGGGCGGCGGCGGATTCCGAG
CGGGAGGTCAGGAACGTGGCCATCATCGGTGCCGGGGCGGCTGGCGCGTCGACGGCGTACCACCTGCGGCAGTAC
GCGCAGGCGGCCGGGCTGGCCGTCAACGTAACCATCTTCGAGCGCGGCGGGCGCGCGGGCGGGCGCAGCCTGACG
GTGGGCGCCTACGGCGACGCGGCGCAGCCGCTCGAGCTGGGCGCCTCCATCTTCGTCAGCCTCAACCAGATCCTG
TGCAACGCGAGCCGGGCGCTGGGCCTGACGCTGGCCGAGGCCGGCGCCGGCGCCGAGCCGGGCGACGTCACCCTC
GTCTGGGACGGCGCCGACGTCGTCTTCCGCTCCGTCGAGGGCGAGGCCTGGTGGTGGTTGGCGGGGCGGCTGCTG
TGGCGATACGGCGCCGCGCCCTACCGCGCCGTCCGCCTCGTCCGCGCCGTCGTCGCTAACTTCCTTCGTCTCTAC
GATCCGCCCTTCTTCCCGTTCCGCTCGCTGACCCGCCGCGTGTACGAGCTTGGCCTGCATAAGGTCACTGGATTG
ACGGGCGAGCAGTTCCTGGCGGAGAACAAGATCGATGCGGGATTCGCGCGCGACGTCATGCAGCCGGCGACGCGC
GTCAACTACGCCTCCAACCTGGCCCACATCCACGGCCTCGAGGCCATGGTCTCCTTCGCCACCGACGGCGCCCAG
CGGCGCCGCCCTCGTCCGCAACACGTCCGTCGCCGCCATCGAGATCGACAAGGGCGCCATGCGGCCCGGCGCCCG
CCGCCGGTACCGCCTCTCCACCCGACCCGCCACCACTGA
Gene >Hirsu2|239
ATGCGCTCACCGCTGGGCCTCGTCCTGGCGGCGGCCGCGGCGGCACTGGGGCTGAGGGCGGCGGCGGATTCCGAG
CGGGAGGTCAGGAACGTGGCCATCATCGGTGAGTAGGGCCTTTTCATCCCCTTCTTTTCCCGTTCCGCTGACGTC
GCCACCCCAGGTGCCGGGGCGGCTGGCGCGTCGACGGCGTACCACCTGCGGCAGTACGCGCAGGCGGCCGGGCTG
GCCGTCAACGTAACCATCTTCGAGCGCGGCGGGCGCGCGGGCGGGCGCAGCCTGACGGTGGGCGCCTACGGCGAC
GCGGCGCAGCCGCTCGAGCTGGGCGCCTCCATCTTCGTCAGCCTCAACCAGATCCTGTGCAACGCGAGCCGGGCG
CTGGGCCTGACGCTGGCCGAGGCCGGCGCCGGCGCCGAGCCGGGCGACGTCACCCTCGTCTGGGACGGCGCCGAC
GTCGTCTTCCGCTCCGTCGAGGGCGAGGCCTGGTGGTGGTTGGCGGGGCGGCTGCTGTGGCGATACGGCGCCGCG
CCCTACCGCGCCGTCCGCCTCGTCCGCGCCGTCGTCGCTAACTTCCTTCGTCTCTACGATCCGCCCTTCTTCCCG
TTCCGCTCGCTGACCCGCCGCGTGTACGAGCTTGGCCTGCATAAGGTCACTGGATTGACGGGCGAGCAGTTCCTG
GCGGAGAACAAGGTGAGGGGAGTTTGGGAGGTGGCGACATGAAAAAAGAAGAAGAAAACGAGCTGACGATACGAC
AGATCGATGCGGGATTCGCGCGCGACGTCATGCAGCCGGCGACGCGCGTCAACTACGCCTCCAACCTGGCCCACA
TCCACGGCCTCGAGGCCATGGTCTCCTTCGCCACCGACGGCGCCGTCGCCGTCGCCGGCGGCAACTGGCAGATCT
TCGACCGCATGGTCCGCAGCAGCGGCGCCGCCCTCGTCCGCAACACGTCCGTCGCCGCCATCGAGATCGACAAGG
GCGCCATGCGGCCCGGCGCCCGCCGCCGGTACCGCCTCTCCACCCGACCCGCCACCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail