Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2384
Gene name
LocationContig_157:511..1401
Strand+
Gene length (bp)890
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 4.3E-07 6 84
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 6.3E-07 112 232

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12415|TFC7_YEAST Transcription factor tau 55 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFC7 PE=1 SV=1 1 208 5.0E-23
sp|P53929|YNK8_YEAST Uncharacterized protein YNL108C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL108C PE=1 SV=1 1 251 2.0E-19

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2384
MPLEKIYVVRHGFRSNWLVDPATGTYSAYIPSPTGIPADPALTSHGLGQARELAGHLLTLDPPIEAVYSSPFYRC
LQTLAPFIQLQQSRRLAAEHGDEADARPPRPVRHAATEIRPEHGIREWFGSAPFDHPQPAPVHTLKSLFPAVDDK
YESIVTPPSRGETLAQLQERVALALRGIIRQCDASGARAAVLCTHAAVVILLGRVLTGLVPDSADAEDFHAYTCG
LSVFRRQRLDQGKSADPATPGQQVGWPKACWPPPSMSASPLV*
Coding >Hirsu2|2384
ATGCCGCTGGAGAAGATCTACGTCGTCCGCCACGGGTTCCGCTCTAACTGGCTCGTCGACCCGGCCACCGGCACC
TACTCGGCCTACATCCCCTCACCAACGGGAATCCCTGCCGATCCCGCCCTCACCTCCCACGGCCTCGGCCAGGCC
AGAGAGCTGGCCGGCCACCTGCTTACCCTCGACCCGCCCATAGAGGCCGTCTACTCCAGTCCCTTCTACCGCTGC
CTCCAGACACTGGCCCCCTTCATCCAGCTCCAGCAGAGCCGGCGGCTGGCTGCCGAGCATGGCGACGAGGCCGAC
GCCCGTCCGCCTCGGCCCGTCCGCCATGCCGCGACCGAGATTCGTCCCGAACATGGCATTCGTGAGTGGTTTGGC
TCTGCCCCCTTCGACCATCCTCAGCCAGCCCCCGTCCACACCCTCAAGTCGCTCTTCCCCGCCGTCGACGACAAG
TACGAGTCCATTGTCACGCCGCCCAGTCGGGGAGAGACGTTGGCGCAGCTGCAAGAGCGAGTCGCCCTCGCCCTG
CGTGGCATCATCAGACAGTGCGACGCCAGCGGGGCCCGCGCCGCCGTCCTGTGCACCCATGCCGCCGTCGTCATC
CTGCTGGGCCGCGTCCTCACGGGGCTGGTGCCGGATAGCGCCGACGCTGAGGATTTCCACGCATACACGTGCGGC
CTGAGCGTCTTTCGGAGACAGCGACTGGACCAAGGCAAGTCGGCAGATCCTGCCACGCCGGGCCAACAGGTCGGC
TGGCCGAAAGCGTGTTGGCCGCCGCCGTCGATGTCCGCCTCCCCACTGGTCTGA
Transcript >Hirsu2|2384
ATGCCGCTGGAGAAGATCTACGTCGTCCGCCACGGGTTCCGCTCTAACTGGCTCGTCGACCCGGCCACCGGCACC
TACTCGGCCTACATCCCCTCACCAACGGGAATCCCTGCCGATCCCGCCCTCACCTCCCACGGCCTCGGCCAGGCC
AGAGAGCTGGCCGGCCACCTGCTTACCCTCGACCCGCCCATAGAGGCCGTCTACTCCAGTCCCTTCTACCGCTGC
CTCCAGACACTGGCCCCCTTCATCCAGCTCCAGCAGAGCCGGCGGCTGGCTGCCGAGCATGGCGACGAGGCCGAC
GCCCGTCCGCCTCGGCCCGTCCGCCATGCCGCGACCGAGATTCGTCCCGAACATGGCATTCGTGAGTGGTTTGGC
TCTGCCCCCTTCGACCATCCTCAGCCAGCCCCCGTCCACACCCTCAAGTCGCTCTTCCCCGCCGTCGACGACAAG
TACGAGTCCATTGTCACGCCGCCCAGTCGGGGAGAGACGTTGGCGCAGCTGCAAGAGCGAGTCGCCCTCGCCCTG
CGTGGCATCATCAGACAGTGCGACGCCAGCGGGGCCCGCGCCGCCGTCCTGTGCACCCATGCCGCCGTCGTCATC
CTGCTGGGCCGCGTCCTCACGGGGCTGGTGCCGGATAGCGCCGACGCTGAGGATTTCCACGCATACACGTGCGGC
CTGAGCGTCTTTCGGAGACAGCGACTGGACCAAGGCAAGTCGGCAGATCCTGCCACGCCGGGCCAACAGGTCGGC
TGGCCGAAAGCGTGTTGGCCGCCGCCGTCGATGTCCGCCTCCCCACTGGTCTGA
Gene >Hirsu2|2384
ATGCCGCTGGAGAAGATCTACGTCGTCCGCCACGGGGTAAGTCGACGGCACAACACGCACCTTTCATCCCCGACC
GCCCAGTCGCCCTGTATTGACAGTCCCCATTGTCGACGCGGGCCTAGTTCCGCTCTAACTGGCTCGTCGACCCGG
CCACCGGCACCTACTCGGCCTACATCCCCTCACCAACGGGAATCCCTGCCGATCCCGCCCTCACCTCCCACGGCC
TCGGCCAGGCCAGAGAGCTGGCCGGCCACCTGCTTACCCTCGACCCGCCCATAGAGGCCGTCTACTCCAGTCCCT
TCTACCGCTGCCTCCAGACACTGGCCCCCTTCATCCAGCTCCAGCAGAGCCGGCGGCTGGCTGCCGAGCATGGCG
ACGAGGCCGACGCCCGTCCGCCTCGGCCCGTCCGCCATGCCGCGACCGAGATTCGTCCCGAACATGGCATTCGTG
AGTGGTTTGGCTCTGCCCCCTTCGACCATCCTCAGCCAGCCCCCGTCCACACCCTCAAGTCGCTCTTCCCCGCCG
TCGACGACAAGTACGAGTCCATTGTCACGCCGCCCAGTCGGGGAGAGACGTTGGCGCAGCTGCAAGAGCGAGTCG
CCCTCGCCCTGCGTGGCATCATCAGACAGTGCGACGCCAGCGGGGCCCGCGCCGCCGTCCTGTGCACCCATGCCG
CCGTCGTCATCCTGCTGGGCCGCGTCCTCACGGGGCTGGTGCCGGATAGCGCCGACGCTGAGGATTTCCACGCAT
ACACGTGCGGCCTGAGCGTCTTTCGGAGACAGCGACTGGACCAAGGCAAGTCGGCAGATCCTGCCACGCCGGGCC
AACAGGTCGGCTGGCCGAAAGCGTGTTGGCCGCCGCCGTCGATGTCCGCCTCCCCACTGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail