Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2381
Gene name
LocationContig_1568:3272..3911
Strand-
Gene length (bp)639
Transcript length (bp)639
Coding sequence length (bp)639
Protein length (aa) 213

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03364 Polyketide_cyc Polyketide cyclase / dehydrase and lipid transport 1.1E-23 61 198

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USM9|COQ10_SCHPO Coenzyme Q-binding protein coq10, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coq10 PE=3 SV=1 51 202 6.0E-22
sp|Q6PBN4|CQ10X_DANRE Coenzyme Q-binding protein COQ10 homolog, mitochondrial OS=Danio rerio GN=zgc:73324 PE=2 SV=2 50 212 4.0E-18
sp|Q75CC1|COQ10_ASHGO Coenzyme Q-binding protein COQ10, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=COQ10 PE=3 SV=1 20 201 3.0E-15
sp|Q6GNP0|CQ10B_XENLA Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Xenopus laevis GN=coq10b PE=2 SV=1 18 206 4.0E-15
sp|O68560|RATA_PSEAE Ribosome association toxin RatA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ratA PE=3 SV=1 48 206 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USM9|COQ10_SCHPO Coenzyme Q-binding protein coq10, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coq10 PE=3 SV=1 51 202 6.0E-22
sp|Q6PBN4|CQ10X_DANRE Coenzyme Q-binding protein COQ10 homolog, mitochondrial OS=Danio rerio GN=zgc:73324 PE=2 SV=2 50 212 4.0E-18
sp|Q75CC1|COQ10_ASHGO Coenzyme Q-binding protein COQ10, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=COQ10 PE=3 SV=1 20 201 3.0E-15
sp|Q6GNP0|CQ10B_XENLA Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Xenopus laevis GN=coq10b PE=2 SV=1 18 206 4.0E-15
sp|O68560|RATA_PSEAE Ribosome association toxin RatA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ratA PE=3 SV=1 48 206 3.0E-13
sp|Q08058|COQ10_YEAST Coenzyme Q-binding protein COQ10, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ10 PE=1 SV=1 26 210 5.0E-13
sp|Q556V1|COQ10_DICDI Coenzyme Q-binding protein COQ10, mitochondrial OS=Dictyostelium discoideum GN=coq10-1 PE=3 SV=1 27 210 5.0E-13
sp|Q8FEY4|PAST_ECOL6 Persistence and stress-resistance toxin PasT OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pasT PE=1 SV=1 48 204 7.0E-13
sp|Q6DFA6|CQ10A_XENLA Coenzyme Q-binding protein COQ10 homolog A, mitochondrial OS=Xenopus laevis GN=coq10b-a PE=2 SV=1 53 209 2.0E-12
sp|Q8MLL3|COQ10_DROME Coenzyme Q-binding protein COQ10, mitochondrial OS=Drosophila melanogaster GN=Coq10 PE=2 SV=1 57 212 2.0E-12
sp|Q567E6|CQ10B_DANRE Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Danio rerio GN=coq10b PE=2 SV=1 15 210 3.0E-12
sp|P0AGL6|RATA_SHIFL Ribosome association toxin RatA OS=Shigella flexneri GN=ratA PE=3 SV=1 48 204 4.0E-12
sp|P0AGL5|RATA_ECOLI Ribosome association toxin RatA OS=Escherichia coli (strain K12) GN=ratA PE=1 SV=1 48 204 4.0E-12
sp|Q5RD79|CQ10B_PONAB Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Pongo abelii GN=COQ10B PE=2 SV=1 21 210 5.0E-11
sp|Q9H8M1|CQ10B_HUMAN Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Homo sapiens GN=COQ10B PE=2 SV=1 21 210 6.0E-11
sp|Q96MF6|CQ10A_HUMAN Coenzyme Q-binding protein COQ10 homolog A, mitochondrial OS=Homo sapiens GN=COQ10A PE=2 SV=2 53 210 7.0E-11
sp|Q9ZDZ7|RATA_RICPR Ribosome association toxin RatA OS=Rickettsia prowazekii (strain Madrid E) GN=ratA PE=3 SV=1 47 205 9.0E-11
sp|Q3THF9|CQ10B_MOUSE Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Mus musculus GN=Coq10b PE=1 SV=1 21 210 1.0E-10
sp|Q5I0I9|CQ10B_RAT Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Rattus norvegicus GN=Coq10b PE=2 SV=2 6 210 2.0E-10
sp|P0C6Q0|RATA_VIBCH Ribosome association toxin RatA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ratA PE=3 SV=1 47 206 1.0E-07
sp|A5F376|RATA_VIBC3 Ribosome association toxin RatA OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ratA PE=3 SV=2 47 206 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2381
MAFRLTASPWRHCCTRARPAPHAIARRAFFNLPGSTGGGGGSGGEAQHLAATRTLPYAHGALYELIADVESYERF
VPYCSRSRVTEWSPPDARGRRWPALADLHVGWGGFSDVFTSRLRCVPGVSVEAVSGGESAAPSAVFKTLITRWSV
RPGASDQPSSPSTEVRLTIDYRFANPVYAAVSAAVSDKVAGLMVEAFEKRARDILGPSSSRS*
Coding >Hirsu2|2381
ATGGCTTTTCGACTCACCGCTTCTCCGTGGCGGCACTGCTGTACGCGAGCCCGCCCGGCTCCCCACGCGATCGCC
CGCCGTGCCTTCTTCAACCTCCCCGGCAGCACCGGCGGCGGTGGCGGCAGCGGCGGCGAAGCCCAGCACCTCGCC
GCGACGCGCACGCTGCCCTACGCGCACGGGGCTCTCTACGAGCTCATCGCCGACGTCGAGTCGTATGAGCGCTTC
GTCCCCTACTGCTCCCGCTCCCGTGTCACCGAGTGGTCGCCTCCGGACGCCCGAGGCCGGCGCTGGCCGGCGCTG
GCCGACCTGCATGTCGGCTGGGGCGGCTTCAGCGACGTCTTTACCAGCCGCCTACGGTGCGTGCCGGGGGTGTCC
GTCGAGGCCGTCAGTGGCGGCGAGTCGGCCGCTCCATCTGCCGTCTTCAAGACGCTCATCACGCGCTGGTCGGTG
AGGCCCGGCGCCTCCGACCAGCCATCGTCGCCCTCGACCGAGGTCCGTCTCACCATCGATTACCGGTTCGCCAAC
CCCGTCTACGCCGCTGTTAGCGCCGCCGTCTCCGATAAGGTTGCTGGCCTCATGGTCGAAGCCTTCGAAAAACGA
GCTCGAGACATACTGGGACCATCAAGCAGCAGGTCGTGA
Transcript >Hirsu2|2381
ATGGCTTTTCGACTCACCGCTTCTCCGTGGCGGCACTGCTGTACGCGAGCCCGCCCGGCTCCCCACGCGATCGCC
CGCCGTGCCTTCTTCAACCTCCCCGGCAGCACCGGCGGCGGTGGCGGCAGCGGCGGCGAAGCCCAGCACCTCGCC
GCGACGCGCACGCTGCCCTACGCGCACGGGGCTCTCTACGAGCTCATCGCCGACGTCGAGTCGTATGAGCGCTTC
GTCCCCTACTGCTCCCGCTCCCGTGTCACCGAGTGGTCGCCTCCGGACGCCCGAGGCCGGCGCTGGCCGGCGCTG
GCCGACCTGCATGTCGGCTGGGGCGGCTTCAGCGACGTCTTTACCAGCCGCCTACGGTGCGTGCCGGGGGTGTCC
GTCGAGGCCGTCAGTGGCGGCGAGTCGGCCGCTCCATCTGCCGTCTTCAAGACGCTCATCACGCGCTGGTCGGTG
AGGCCCGGCGCCTCCGACCAGCCATCGTCGCCCTCGACCGAGGTCCGTCTCACCATCGATTACCGGTTCGCCAAC
CCCGTCTACGCCGCTGTTAGCGCCGCCGTCTCCGATAAGGTTGCTGGCCTCATGGTCGAAGCCTTCGAAAAACGA
GCTCGAGACATACTGGGACCATCAAGCAGCAGGTCGTGA
Gene >Hirsu2|2381
ATGGCTTTTCGACTCACCGCTTCTCCGTGGCGGCACTGCTGTACGCGAGCCCGCCCGGCTCCCCACGCGATCGCC
CGCCGTGCCTTCTTCAACCTCCCCGGCAGCACCGGCGGCGGTGGCGGCAGCGGCGGCGAAGCCCAGCACCTCGCC
GCGACGCGCACGCTGCCCTACGCGCACGGGGCTCTCTACGAGCTCATCGCCGACGTCGAGTCGTATGAGCGCTTC
GTCCCCTACTGCTCCCGCTCCCGTGTCACCGAGTGGTCGCCTCCGGACGCCCGAGGCCGGCGCTGGCCGGCGCTG
GCCGACCTGCATGTCGGCTGGGGCGGCTTCAGCGACGTCTTTACCAGCCGCCTACGGTGCGTGCCGGGGGTGTCC
GTCGAGGCCGTCAGTGGCGGCGAGTCGGCCGCTCCATCTGCCGTCTTCAAGACGCTCATCACGCGCTGGTCGGTG
AGGCCCGGCGCCTCCGACCAGCCATCGTCGCCCTCGACCGAGGTCCGTCTCACCATCGATTACCGGTTCGCCAAC
CCCGTCTACGCCGCTGTTAGCGCCGCCGTCTCCGATAAGGTTGCTGGCCTCATGGTCGAAGCCTTCGAAAAACGA
GCTCGAGACATACTGGGACCATCAAGCAGCAGGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail