Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2369
Gene name
LocationContig_1562:4304..5409
Strand+
Gene length (bp)1105
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-14 1 260

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 45 67 22
3 117 139 22
4 154 176 22
5 197 219 22
6 254 276 22
7 283 305 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2369
MYSAVADVTADEDRASAFLTLSFGGLVGEFIGPAISSGLMQATSPWLPYLLSFVFLFLAVGMLICLPETLPPTRK
EVEEVEPAEDKASHAVKWQLREYASQLKESLEMLKQPGLAKVLVTFLAPVPVLIAMSQVLVQYVSKRFGWSLASA
GFLLSVRGTINMLLLLLILPGLSRALLSRAAAKGQHAAAKDRALAQLSAVVLTLGCLVIASGSIAVVVAGLMVST
LGSGLAPICRSLAAHLVSSDNTAKLQTLIGIIEAVSSLVAGPALAGLLAAGMSRGGAWTGLPFLGLAAFLCLATL
PLFFLAVPGTGQAPAPAPAGPCVRGEGGCRSLGAQCPAHADRGGSTV*
Coding >Hirsu2|2369
ATGTATTCCGCCGTGGCCGACGTGACGGCCGACGAGGACAGGGCATCGGCCTTCCTCACTCTCTCGTTCGGTGGT
CTGGTGGGCGAATTCATCGGGCCTGCCATCTCTTCGGGCCTCATGCAAGCTACTTCGCCATGGCTCCCGTATCTG
CTGAGCTTCGTCTTCCTCTTCCTCGCCGTCGGCATGCTGATCTGCCTCCCTGAGACGCTGCCGCCGACGAGGAAG
GAGGTGGAAGAGGTCGAGCCGGCCGAGGACAAGGCGAGCCATGCCGTCAAGTGGCAGCTCCGGGAATACGCGTCC
CAGCTCAAGGAGTCGCTGGAGATGCTGAAGCAGCCCGGCCTGGCCAAGGTCCTCGTCACCTTCCTTGCCCCCGTG
CCGGTGCTCATAGCGATGAGCCAGGTGTTGGTGCAGTACGTCAGCAAGCGGTTCGGCTGGTCGCTCGCCTCGGCC
GGCTTCCTGCTGTCGGTCCGCGGGACGATCAACATGCTGCTGCTGCTCCTCATTCTGCCGGGCCTCTCGCGCGCG
CTGCTGTCGCGCGCCGCTGCCAAGGGCCAGCACGCGGCCGCCAAGGACCGCGCCCTCGCCCAGCTCTCGGCCGTC
GTCCTGACGCTGGGCTGCCTCGTCATAGCCAGCGGCAGCATCGCCGTCGTCGTCGCCGGCCTGATGGTCAGCACG
CTCGGCTCCGGGCTGGCGCCCATCTGCCGCTCCCTGGCCGCCCACCTCGTCAGCAGCGACAACACGGCCAAGCTG
CAGACGCTCATCGGCATCATCGAGGCCGTGAGCTCGCTCGTGGCCGGCCCCGCCCTCGCCGGCTTGCTCGCCGCC
GGCATGAGCCGCGGCGGCGCCTGGACGGGGCTGCCCTTCCTCGGCCTGGCCGCCTTTCTCTGCCTCGCCACCCTG
CCGCTGTTCTTCCTGGCCGTCCCCGGAACGGGCCAGGCGCCGGCGCCGGCCCCCGCCGGCCCCTGTGTGCGCGGC
GAAGGCGGCTGCCGCTCCCTCGGTGCGCAGTGCCCGGCGCACGCCGACCGAGGGGGCTCGACCGTTTGA
Transcript >Hirsu2|2369
ATGTATTCCGCCGTGGCCGACGTGACGGCCGACGAGGACAGGGCATCGGCCTTCCTCACTCTCTCGTTCGGTGGT
CTGGTGGGCGAATTCATCGGGCCTGCCATCTCTTCGGGCCTCATGCAAGCTACTTCGCCATGGCTCCCGTATCTG
CTGAGCTTCGTCTTCCTCTTCCTCGCCGTCGGCATGCTGATCTGCCTCCCTGAGACGCTGCCGCCGACGAGGAAG
GAGGTGGAAGAGGTCGAGCCGGCCGAGGACAAGGCGAGCCATGCCGTCAAGTGGCAGCTCCGGGAATACGCGTCC
CAGCTCAAGGAGTCGCTGGAGATGCTGAAGCAGCCCGGCCTGGCCAAGGTCCTCGTCACCTTCCTTGCCCCCGTG
CCGGTGCTCATAGCGATGAGCCAGGTGTTGGTGCAGTACGTCAGCAAGCGGTTCGGCTGGTCGCTCGCCTCGGCC
GGCTTCCTGCTGTCGGTCCGCGGGACGATCAACATGCTGCTGCTGCTCCTCATTCTGCCGGGCCTCTCGCGCGCG
CTGCTGTCGCGCGCCGCTGCCAAGGGCCAGCACGCGGCCGCCAAGGACCGCGCCCTCGCCCAGCTCTCGGCCGTC
GTCCTGACGCTGGGCTGCCTCGTCATAGCCAGCGGCAGCATCGCCGTCGTCGTCGCCGGCCTGATGGTCAGCACG
CTCGGCTCCGGGCTGGCGCCCATCTGCCGCTCCCTGGCCGCCCACCTCGTCAGCAGCGACAACACGGCCAAGCTG
CAGACGCTCATCGGCATCATCGAGGCCGTGAGCTCGCTCGTGGCCGGCCCCGCCCTCGCCGGCTTGCTCGCCGCC
GGCATGAGCCGCGGCGGCGCCTGGACGGGGCTGCCCTTCCTCGGCCTGGCCGCCTTTCTCTGCCTCGCCACCCTG
CCGCTGTTCTTCCTGGCCGTCCCCGGAACGGGCCAGGCGCCGGCGCCGGCCCCCGCCGGCCCCTGTGTGCGCGGC
GAAGGCGGCTGCCGCTCCCTCGGTGCGCAGTGCCCGGCGCACGCCGACCGAGGGGGCTCGACCGTTTGA
Gene >Hirsu2|2369
ATGTATTCCGCCGTGGCCGACGTGACGGCCGACGAGGACAGGTTCGTCAGCGATTGCTCCCCCCGTTGTCGAGCC
CGCAGACTAAGCCGACGACTCGTCCAGGGCATCGGCCTTCCTCACTCTCTCGTTCGGTGGTCTGGTGGGCGAATT
CATCGGGCCTGCCATCTCTTCGGGCCTCATGCAAGCTACTTCGCCATGGCTCCCGTATCTGCTGAGCTTCGTCTT
CCTCTTCCTCGCCGTCGGCATGCTGATCTGCCTCCCTGAGACGCTGCCGCCGACGAGGAAGGAGGTGGAAGAGGT
CGAGCCGGCCGAGGACAAGGCGAGCCATGCCGTCAAGTGGCAGCTCCGGGAATACGCGTCCCAGCTCAAGGAGTC
GCTGGAGATGCTGAAGCAGCCCGGCCTGGCCAAGGTCCTCGTCACCTTCCTTGCCCCCGTGCCGGTGCTCATAGC
GATGAGCCAGGTGTTGGTGCAGTACGTCAGCAAGCGGTTCGGCTGGTCGCTCGCCTCGGCCGGCTTCCTGCTGTC
GGTCCGCGGGACGATCAACATGCTGCTGCTGCTCCTCATTCTGCCGGGCCTCTCGCGCGCGCTGCTGTCGCGCGC
CGCTGCCAAGGGCCAGCACGCGGCCGCCAAGGACCGCGCCCTCGCCCAGCTCTCGGCCGTCGTCCTGACGCTGGG
CTGCCTCGTCATAGCCAGCGGCAGCATCGCCGTCGTCGTCGCCGGCCTGATGGTCAGCACGCTCGGCTCCGGGCT
GGCGCCCATCTGCCGCTCCCTGGCCGCCCACCTCGTCAGCAGCGACAACACGGCCAAGCTGCAGACGCTCATCGG
CATCATCGAGGCCGTGAGCTCGCTCGTGGCCGGCCCCGCCCTCGCCGGCTTGCTCGCCGCCGGCATGAGCCGCGG
CGGCGCCTGGACGGGGCTGCCCTTCCTCGGCCTGGCCGCCTTTCTCTGCCTCGCCACCCTGCCGCTGTTCTTCCT
GGCCGTCCCCGGAACGGGCCAGGCGCCGGCGCCGGCCCCCGCCGGCCCCTGTGTGCGCGGCGAAGGCGGCTGCCG
CTCCCTCGGTGCGCAGTGCCCGGCGCACGCCGACCGAGGGGGCTCGACCGTTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail