Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2361
Gene name
LocationContig_156:29259..32454
Strand+
Gene length (bp)3195
Transcript length (bp)2940
Coding sequence length (bp)2940
Protein length (aa) 980

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07647 SAM_2 SAM domain (Sterile alpha motif) 5.5E-14 233 300
PF14604 SH3_9 Variant SH3 domain 9.4E-13 22 74
PF00018 SH3_1 SH3 domain 5.3E-12 21 70
PF00169 PH PH domain 7.5E-07 724 874

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39969|BOI2_YEAST Protein BOI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOI2 PE=1 SV=1 700 918 6.0E-38
sp|P38041|BOB1_YEAST Protein BOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOI1 PE=1 SV=1 700 934 1.0E-35
sp|O74653|POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pob1 PE=1 SV=1 662 917 3.0E-28
sp|P39969|BOI2_YEAST Protein BOI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOI2 PE=1 SV=1 21 319 3.0E-18
sp|P38041|BOB1_YEAST Protein BOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOI1 PE=1 SV=1 21 305 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39969|BOI2_YEAST Protein BOI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOI2 PE=1 SV=1 700 918 6.0E-38
sp|P38041|BOB1_YEAST Protein BOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOI1 PE=1 SV=1 700 934 1.0E-35
sp|O74653|POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pob1 PE=1 SV=1 662 917 3.0E-28
sp|P39969|BOI2_YEAST Protein BOI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOI2 PE=1 SV=1 21 319 3.0E-18
sp|P38041|BOB1_YEAST Protein BOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOI1 PE=1 SV=1 21 305 5.0E-12
sp|O74653|POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pob1 PE=1 SV=1 20 70 5.0E-06
sp|P53281|LSB1_YEAST LAS seventeen-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSB1 PE=1 SV=1 23 124 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2361
MASRPANNEPQPRPEVGDALIVIHDFQARSSDELSLAKGDRVELIERDDEFGDGWFLGRHLVNNNTGLFPEVYTR
PAPKSANAFTPSKTLPPVAEVSHDLDLDASSLASPNPTQPADAPASPPAAQAGETSTTTLPLGSARSDPTVSPSV
ASTSGSPSVALDDQSQDSQVLNETLHVINEHITDLRSPPSSGALGAPTDSGSEYSAPLDQRMSYIQGEETDEEED
MAHTRTEVETWNPEDVAEYLFTAGVEKHHCEVFREQEISGEVLLGMDQSSLFIKAFDLGSVGRRLKTWQKIKALQ
DEVSSHGLAIKGPGRTHDGEAASDDVKRTRSRTNTLTSPLLNRPMSAQTQRLSSTQTPKASPTTLGTTPTSPPAP
RDSPPRPGNAKRPSAASVRELNHSRRHSSTDFRLSGTIPNSLVPGLSASRSSAGADGTHKKQPSFDRNWTLGTAF
SQSSSRPLSSAGLHEIAGGSDADMLQDSAVDLDRGYFSGTDVDGRKRNVLRKRDSVGHSRKSSYTEEQRVRSATA
LSKHSRFGSVDSFRDVVPSPAIQKYYGLQPSPHRRTASTNTAESARPLPPAKDAPSPTVTNLDSASGPGRPHASP
VATKHPGFHSDWFSSVVSRPIGKGRPGMRAISDKLTSSRTREAEAPEVPSKEPSLNSPARTGSSTPSAGPSLLDL
ESPGTAKSSSTTATPASRAAKKKTKKETSAYTRGLLNTPPLEAKKDADYYGWMRKKSSNLMTTWKPRLFVLKGRR
LAYYYSEDDDQERGLIDISFHRVLPADNEKLTGFHATITGAVGGPSMPVTSFLTGGGGGSGGGESGTGGVGGGVD
KGDDSVFIFKLMPPRTGLSRAVNFTKPTVHYFAVPSLKQGRLWMAALMKATIDRDDTHPVTSTYQQKTISLSKAK
QMRHRPPALMNLDEANEEEHKARGGGGGGGKKANGLGILGESDSGVSGLDRLASTKSDGPPLGAEAAAGGDEAAP
AQGA*
Coding >Hirsu2|2361
ATGGCCTCGAGACCTGCCAATAACGAGCCCCAGCCTCGGCCTGAGGTTGGAGATGCCCTGATCGTGATACACGAC
TTCCAGGCTCGGAGCTCCGACGAGTTGAGCCTGGCAAAGGGCGATCGAGTCGAGCTAATCGAGCGAGATGACGAA
TTCGGCGATGGATGGTTCTTGGGCCGCCACCTCGTCAACAACAACACAGGCCTCTTTCCCGAAGTATACACTCGG
CCCGCACCCAAATCCGCAAATGCCTTCACGCCCTCCAAGACCCTGCCCCCTGTTGCCGAGGTAAGCCACGACCTG
GATCTCGACGCCTCGTCCCTGGCCTCCCCGAACCCGACTCAACCGGCCGATGCGCCCGCCTCGCCGCCCGCCGCC
CAGGCCGGCGAGACGTCGACGACAACCTTGCCCTTGGGCTCGGCCAGGTCGGATCCGACCGTGTCCCCCAGCGTC
GCAAGCACCAGCGGCTCCCCCTCTGTCGCGCTCGACGACCAGAGCCAAGACAGCCAGGTTTTAAACGAGACCCTT
CACGTCATCAACGAGCACATCACCGACCTGCGCTCTCCTCCCAGCAGTGGAGCCCTTGGCGCGCCGACCGACTCT
GGTAGCGAATATAGCGCCCCGCTCGACCAGCGGATGTCTTACATCCAGGGTGAGGAGACGGACGAAGAGGAGGAC
ATGGCGCACACCCGCACCGAGGTCGAAACCTGGAACCCTGAAGACGTTGCCGAATACCTCTTCACCGCCGGTGTC
GAGAAGCACCACTGCGAGGTGTTTCGGGAGCAGGAAATTTCGGGAGAGGTGCTCCTCGGCATGGACCAGAGCTCG
CTCTTCATCAAGGCCTTCGACCTGGGCTCCGTCGGCCGCCGCCTGAAAACATGGCAGAAAATCAAGGCTCTCCAG
GATGAGGTCAGCAGCCACGGCCTAGCGATCAAGGGCCCGGGCCGGACGCACGACGGCGAGGCCGCCTCTGATGAT
GTCAAGCGGACTAGGAGCCGCACTAATACCCTCACAAGCCCCCTCCTGAACCGACCCATGTCCGCCCAAACCCAG
CGCCTCTCTTCGACGCAAACGCCCAAGGCCTCCCCGACGACGCTTGGCACCACCCCGACCTCGCCCCCGGCGCCG
CGAGATAGTCCGCCCCGACCCGGCAACGCGAAGCGGCCGTCGGCTGCCTCGGTCAGAGAGCTCAACCACTCGCGT
CGTCATTCGTCGACCGATTTCCGACTCTCTGGCACCATCCCGAACAGTCTGGTACCTGGCCTGAGCGCTAGCAGG
AGTAGCGCCGGCGCCGACGGTACGCACAAGAAGCAGCCGTCCTTCGACCGGAACTGGACTCTGGGAACCGCCTTC
TCACAGTCGTCGTCGCGCCCCCTCTCGTCCGCAGGCCTCCACGAGATCGCGGGCGGCTCAGATGCCGACATGCTG
CAGGACTCGGCCGTCGATCTCGACCGCGGATACTTCTCCGGCACTGACGTGGACGGGCGGAAGCGCAATGTGCTG
AGGAAGCGAGACAGCGTCGGCCACTCGCGCAAGTCGAGCTACACGGAGGAGCAGAGGGTGCGCAGCGCGACGGCG
CTCTCGAAGCACTCGAGATTCGGGAGCGTCGACTCCTTCCGCGACGTCGTCCCGTCGCCGGCCATACAAAAATAC
TATGGGCTGCAGCCGTCGCCGCACAGGAGGACGGCGTCGACCAACACGGCCGAGTCTGCGCGCCCGCTGCCCCCC
GCCAAGGACGCGCCGTCGCCGACCGTCACCAACCTCGACTCCGCGTCGGGGCCGGGCCGGCCGCACGCGTCGCCG
GTAGCCACGAAGCACCCCGGCTTCCACTCCGACTGGTTCTCGTCCGTCGTCAGCCGGCCGATCGGCAAGGGCCGC
CCGGGCATGCGTGCCATCTCGGACAAGCTGACGAGCAGCCGGACGCGAGAGGCCGAGGCACCCGAGGTGCCGTCC
AAGGAGCCGTCGCTGAACTCGCCCGCCAGGACGGGGTCCAGCACGCCCTCGGCAGGGCCGAGCCTCTTGGACCTG
GAGTCGCCGGGAACGGCCAAGAGCTCGAGCACGACGGCGACTCCCGCGAGCCGGGCCGCCAAGAAGAAGACGAAG
AAGGAGACGAGCGCGTACACGCGAGGGTTGTTGAACACGCCGCCGCTCGAGGCCAAGAAGGACGCCGACTACTAC
GGCTGGATGAGGAAGAAGAGCTCGAACCTGATGACGACGTGGAAGCCGCGTCTGTTCGTGCTCAAGGGGCGGCGG
CTGGCCTACTACTACTCGGAGGACGACGACCAGGAGAGGGGCCTGATCGACATCTCGTTCCACCGCGTCCTGCCG
GCCGACAACGAGAAGCTGACGGGCTTCCACGCGACCATCACGGGCGCGGTGGGCGGCCCGAGCATGCCGGTCACC
AGCTTCCTGACGGGCGGCGGCGGCGGCAGCGGCGGCGGCGAATCGGGGACCGGCGGTGTCGGCGGCGGCGTGGAC
AAGGGCGACGACTCGGTCTTCATCTTCAAGCTGATGCCGCCGCGGACGGGCCTGTCGCGAGCGGTCAACTTCACG
AAGCCGACGGTGCACTACTTCGCGGTGCCGAGCCTCAAGCAGGGCCGGCTGTGGATGGCGGCGCTGATGAAGGCG
ACGATCGACCGCGACGACACGCACCCGGTGACGAGCACGTACCAGCAGAAGACGATATCGCTCAGCAAGGCCAAG
CAGATGCGGCACCGGCCGCCGGCGCTGATGAACCTGGACGAGGCCAACGAGGAGGAGCACAAGGCGCGGGGCGGC
GGCGGCGGCGGCGGCAAGAAGGCCAACGGGCTGGGCATCCTGGGCGAGTCGGACAGCGGCGTGTCGGGGCTGGAC
CGGCTGGCCAGCACCAAGTCGGACGGCCCGCCGCTGGGCGCCGAGGCCGCGGCCGGCGGCGACGAGGCCGCCCCC
GCGCAGGGCGCCTAG
Transcript >Hirsu2|2361
ATGGCCTCGAGACCTGCCAATAACGAGCCCCAGCCTCGGCCTGAGGTTGGAGATGCCCTGATCGTGATACACGAC
TTCCAGGCTCGGAGCTCCGACGAGTTGAGCCTGGCAAAGGGCGATCGAGTCGAGCTAATCGAGCGAGATGACGAA
TTCGGCGATGGATGGTTCTTGGGCCGCCACCTCGTCAACAACAACACAGGCCTCTTTCCCGAAGTATACACTCGG
CCCGCACCCAAATCCGCAAATGCCTTCACGCCCTCCAAGACCCTGCCCCCTGTTGCCGAGGTAAGCCACGACCTG
GATCTCGACGCCTCGTCCCTGGCCTCCCCGAACCCGACTCAACCGGCCGATGCGCCCGCCTCGCCGCCCGCCGCC
CAGGCCGGCGAGACGTCGACGACAACCTTGCCCTTGGGCTCGGCCAGGTCGGATCCGACCGTGTCCCCCAGCGTC
GCAAGCACCAGCGGCTCCCCCTCTGTCGCGCTCGACGACCAGAGCCAAGACAGCCAGGTTTTAAACGAGACCCTT
CACGTCATCAACGAGCACATCACCGACCTGCGCTCTCCTCCCAGCAGTGGAGCCCTTGGCGCGCCGACCGACTCT
GGTAGCGAATATAGCGCCCCGCTCGACCAGCGGATGTCTTACATCCAGGGTGAGGAGACGGACGAAGAGGAGGAC
ATGGCGCACACCCGCACCGAGGTCGAAACCTGGAACCCTGAAGACGTTGCCGAATACCTCTTCACCGCCGGTGTC
GAGAAGCACCACTGCGAGGTGTTTCGGGAGCAGGAAATTTCGGGAGAGGTGCTCCTCGGCATGGACCAGAGCTCG
CTCTTCATCAAGGCCTTCGACCTGGGCTCCGTCGGCCGCCGCCTGAAAACATGGCAGAAAATCAAGGCTCTCCAG
GATGAGGTCAGCAGCCACGGCCTAGCGATCAAGGGCCCGGGCCGGACGCACGACGGCGAGGCCGCCTCTGATGAT
GTCAAGCGGACTAGGAGCCGCACTAATACCCTCACAAGCCCCCTCCTGAACCGACCCATGTCCGCCCAAACCCAG
CGCCTCTCTTCGACGCAAACGCCCAAGGCCTCCCCGACGACGCTTGGCACCACCCCGACCTCGCCCCCGGCGCCG
CGAGATAGTCCGCCCCGACCCGGCAACGCGAAGCGGCCGTCGGCTGCCTCGGTCAGAGAGCTCAACCACTCGCGT
CGTCATTCGTCGACCGATTTCCGACTCTCTGGCACCATCCCGAACAGTCTGGTACCTGGCCTGAGCGCTAGCAGG
AGTAGCGCCGGCGCCGACGGTACGCACAAGAAGCAGCCGTCCTTCGACCGGAACTGGACTCTGGGAACCGCCTTC
TCACAGTCGTCGTCGCGCCCCCTCTCGTCCGCAGGCCTCCACGAGATCGCGGGCGGCTCAGATGCCGACATGCTG
CAGGACTCGGCCGTCGATCTCGACCGCGGATACTTCTCCGGCACTGACGTGGACGGGCGGAAGCGCAATGTGCTG
AGGAAGCGAGACAGCGTCGGCCACTCGCGCAAGTCGAGCTACACGGAGGAGCAGAGGGTGCGCAGCGCGACGGCG
CTCTCGAAGCACTCGAGATTCGGGAGCGTCGACTCCTTCCGCGACGTCGTCCCGTCGCCGGCCATACAAAAATAC
TATGGGCTGCAGCCGTCGCCGCACAGGAGGACGGCGTCGACCAACACGGCCGAGTCTGCGCGCCCGCTGCCCCCC
GCCAAGGACGCGCCGTCGCCGACCGTCACCAACCTCGACTCCGCGTCGGGGCCGGGCCGGCCGCACGCGTCGCCG
GTAGCCACGAAGCACCCCGGCTTCCACTCCGACTGGTTCTCGTCCGTCGTCAGCCGGCCGATCGGCAAGGGCCGC
CCGGGCATGCGTGCCATCTCGGACAAGCTGACGAGCAGCCGGACGCGAGAGGCCGAGGCACCCGAGGTGCCGTCC
AAGGAGCCGTCGCTGAACTCGCCCGCCAGGACGGGGTCCAGCACGCCCTCGGCAGGGCCGAGCCTCTTGGACCTG
GAGTCGCCGGGAACGGCCAAGAGCTCGAGCACGACGGCGACTCCCGCGAGCCGGGCCGCCAAGAAGAAGACGAAG
AAGGAGACGAGCGCGTACACGCGAGGGTTGTTGAACACGCCGCCGCTCGAGGCCAAGAAGGACGCCGACTACTAC
GGCTGGATGAGGAAGAAGAGCTCGAACCTGATGACGACGTGGAAGCCGCGTCTGTTCGTGCTCAAGGGGCGGCGG
CTGGCCTACTACTACTCGGAGGACGACGACCAGGAGAGGGGCCTGATCGACATCTCGTTCCACCGCGTCCTGCCG
GCCGACAACGAGAAGCTGACGGGCTTCCACGCGACCATCACGGGCGCGGTGGGCGGCCCGAGCATGCCGGTCACC
AGCTTCCTGACGGGCGGCGGCGGCGGCAGCGGCGGCGGCGAATCGGGGACCGGCGGTGTCGGCGGCGGCGTGGAC
AAGGGCGACGACTCGGTCTTCATCTTCAAGCTGATGCCGCCGCGGACGGGCCTGTCGCGAGCGGTCAACTTCACG
AAGCCGACGGTGCACTACTTCGCGGTGCCGAGCCTCAAGCAGGGCCGGCTGTGGATGGCGGCGCTGATGAAGGCG
ACGATCGACCGCGACGACACGCACCCGGTGACGAGCACGTACCAGCAGAAGACGATATCGCTCAGCAAGGCCAAG
CAGATGCGGCACCGGCCGCCGGCGCTGATGAACCTGGACGAGGCCAACGAGGAGGAGCACAAGGCGCGGGGCGGC
GGCGGCGGCGGCGGCAAGAAGGCCAACGGGCTGGGCATCCTGGGCGAGTCGGACAGCGGCGTGTCGGGGCTGGAC
CGGCTGGCCAGCACCAAGTCGGACGGCCCGCCGCTGGGCGCCGAGGCCGCGGCCGGCGGCGACGAGGCCGCCCCC
GCGCAGGGCGCCTAG
Gene >Hirsu2|2361
ATGGCCTCGAGACCTGCCAATAACGAGCCCCAGCCTCGGCCTGAGGTTGGAGATGCCCTGATCGTGATACGTAAG
CTTTTGGCTTCCCTCCGCCCTCCACTCTCCACCCGCTGCCGCGCCCTCGACCGCCGGCCCCCCGTCCCGTCTGCC
TGCCTCGGAGGGAGAAAACCTCTCGTGGGCCCGCAGCGTGGATGGCTGGTGGCAACGTGGATGCACGGCCGGCCG
CCCGGGTGCACACGGAGCTGACCTGCCTCCCCCCCCCCTGCAGACGACTTCCAGGCTCGGAGCTCCGACGAGTTG
AGCCTGGCAAAGGGCGATCGAGTCGAGCTAATCGAGCGAGATGACGAATTCGGCGATGGATGGTTCTTGGGCCGC
CACCTCGTCAACAACAACACAGGCCTCTTTCCCGAAGGTTCGTACTCGTCGAGGCCTCGTCGCCGGCAGCCGTGC
ATCCTCTGACCTGCGTCAGTATACACTCGGCCCGCACCCAAATCCGCAAATGCCTTCACGCCCTCCAAGACCCTG
CCCCCTGTTGCCGAGGTAAGCCACGACCTGGATCTCGACGCCTCGTCCCTGGCCTCCCCGAACCCGACTCAACCG
GCCGATGCGCCCGCCTCGCCGCCCGCCGCCCAGGCCGGCGAGACGTCGACGACAACCTTGCCCTTGGGCTCGGCC
AGGTCGGATCCGACCGTGTCCCCCAGCGTCGCAAGCACCAGCGGCTCCCCCTCTGTCGCGCTCGACGACCAGAGC
CAAGACAGCCAGGTTTTAAACGAGACCCTTCACGTCATCAACGAGCACATCACCGACCTGCGCTCTCCTCCCAGC
AGTGGAGCCCTTGGCGCGCCGACCGACTCTGGTAGCGAATATAGCGCCCCGCTCGACCAGCGGATGTCTTACATC
CAGGGTGAGGAGACGGACGAAGAGGAGGACATGGCGCACACCCGCACCGAGGTCGAAACCTGGAACCCTGAAGAC
GTTGCCGAATACCTCTTCACCGCCGGTGTCGAGAAGCACCACTGCGAGGTGTTTCGGGAGCAGGAAATTTCGGGA
GAGGTGCTCCTCGGCATGGACCAGAGCTCGCTCTTCATCAAGGCCTTCGACCTGGGCTCCGTCGGCCGCCGCCTG
AAAACATGGCAGAAAATCAAGGCTCTCCAGGATGAGGTCAGCAGCCACGGCCTAGCGATCAAGGGCCCGGGCCGG
ACGCACGACGGCGAGGCCGCCTCTGATGATGTCAAGCGGACTAGGAGCCGCACTAATACCCTCACAAGCCCCCTC
CTGAACCGACCCATGTCCGCCCAAACCCAGCGCCTCTCTTCGACGCAAACGCCCAAGGCCTCCCCGACGACGCTT
GGCACCACCCCGACCTCGCCCCCGGCGCCGCGAGATAGTCCGCCCCGACCCGGCAACGCGAAGCGGCCGTCGGCT
GCCTCGGTCAGAGAGCTCAACCACTCGCGTCGTCATTCGTCGACCGATTTCCGACTCTCTGGCACCATCCCGAAC
AGTCTGGTACCTGGCCTGAGCGCTAGCAGGAGTAGCGCCGGCGCCGACGGTACGCACAAGAAGCAGCCGTCCTTC
GACCGGAACTGGACTCTGGGAACCGCCTTCTCACAGTCGTCGTCGCGCCCCCTCTCGTCCGCAGGCCTCCACGAG
ATCGCGGGCGGCTCAGATGCCGACATGCTGCAGGACTCGGCCGTCGATCTCGACCGCGGATACTTCTCCGGCACT
GACGTGGACGGGCGGAAGCGCAATGTGCTGAGGAAGCGAGACAGCGTCGGCCACTCGCGCAAGTCGAGCTACACG
GAGGAGCAGAGGGTGCGCAGCGCGACGGCGCTCTCGAAGCACTCGAGATTCGGGAGCGTCGACTCCTTCCGCGAC
GTCGTCCCGTCGCCGGCCATACAAAAATACTATGGGCTGCAGCCGTCGCCGCACAGGAGGACGGCGTCGACCAAC
ACGGCCGAGTCTGCGCGCCCGCTGCCCCCCGCCAAGGACGCGCCGTCGCCGACCGTCACCAACCTCGACTCCGCG
TCGGGGCCGGGCCGGCCGCACGCGTCGCCGGTAGCCACGAAGCACCCCGGCTTCCACTCCGACTGGTTCTCGTCC
GTCGTCAGCCGGCCGATCGGCAAGGGCCGCCCGGGCATGCGTGCCATCTCGGACAAGCTGACGAGCAGCCGGACG
CGAGAGGCCGAGGCACCCGAGGTGCCGTCCAAGGAGCCGTCGCTGAACTCGCCCGCCAGGACGGGGTCCAGCACG
CCCTCGGCAGGGCCGAGCCTCTTGGACCTGGAGTCGCCGGGAACGGCCAAGAGCTCGAGCACGACGGCGACTCCC
GCGAGCCGGGCCGCCAAGAAGAAGACGAAGAAGGAGACGAGCGCGTACACGCGAGGGTTGTTGAACACGCCGCCG
CTCGAGGCCAAGAAGGACGCCGACTACTACGGCTGGATGAGGAAGAAGAGCTCGAACCTGATGACGACGTGGAAG
CCGCGTCTGTTCGTGCTCAAGGGGCGGCGGCTGGCCTACTACTACTCGGAGGACGACGACCAGGAGAGGGGCCTG
ATCGACATCTCGTTCCACCGCGTCCTGCCGGCCGACAACGAGAAGCTGACGGGCTTCCACGCGACCATCACGGGC
GCGGTGGGCGGCCCGAGCATGCCGGTCACCAGCTTCCTGACGGGCGGCGGCGGCGGCAGCGGCGGCGGCGAATCG
GGGACCGGCGGTGTCGGCGGCGGCGTGGACAAGGGCGACGACTCGGTCTTCATCTTCAAGCTGATGCCGCCGCGG
ACGGGCCTGTCGCGAGCGGTCAACTTCACGAAGCCGACGGTGCACTACTTCGCGGTGCCGAGCCTCAAGCAGGGC
CGGCTGTGGATGGCGGCGCTGATGAAGGCGACGATCGACCGCGACGACACGCACCCGGTGACGAGCACGTACCAG
CAGAAGACGATATCGCTCAGCAAGGCCAAGCAGATGCGGCACCGGCCGCCGGCGCTGATGAACCTGGACGAGGCC
AACGAGGAGGAGCACAAGGCGCGGGGCGGCGGCGGCGGCGGCGGCAAGAAGGCCAACGGGCTGGGCATCCTGGGC
GAGTCGGACAGCGGCGTGTCGGGGCTGGACCGGCTGGCCAGCACCAAGTCGGACGGCCCGCCGCTGGGCGCCGAG
GCCGCGGCCGGCGGCGACGAGGCCGCCCCCGCGCAGGGCGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail