Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2357
Gene name
LocationContig_156:18821..20008
Strand-
Gene length (bp)1187
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17144 Ribosomal_L5e Ribosomal large subunit proteins 60S L5, and 50S L18 1.4E-79 14 179
PF14204 Ribosomal_L18_c Ribosomal L18 C-terminal region 1.5E-32 195 294

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59953|RL5_NEUCR 60S ribosomal protein L5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpl-5 PE=3 SV=1 1 301 0.0E+00
sp|P52822|RL5A_SCHPO 60S ribosomal protein L5-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl501 PE=1 SV=2 1 295 5.0E-129
sp|O74306|RL5B_SCHPO 60S ribosomal protein L5-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl502 PE=2 SV=1 1 295 3.0E-128
sp|P26321|RL5_YEAST 60S ribosomal protein L5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL5 PE=1 SV=4 1 287 2.0E-127
sp|Q9W5R8|RL5_DROME 60S ribosomal protein L5 OS=Drosophila melanogaster GN=RpL5 PE=1 SV=2 1 296 4.0E-109
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59953|RL5_NEUCR 60S ribosomal protein L5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpl-5 PE=3 SV=1 1 301 0.0E+00
sp|P52822|RL5A_SCHPO 60S ribosomal protein L5-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl501 PE=1 SV=2 1 295 5.0E-129
sp|O74306|RL5B_SCHPO 60S ribosomal protein L5-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl502 PE=2 SV=1 1 295 3.0E-128
sp|P26321|RL5_YEAST 60S ribosomal protein L5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL5 PE=1 SV=4 1 287 2.0E-127
sp|Q9W5R8|RL5_DROME 60S ribosomal protein L5 OS=Drosophila melanogaster GN=RpL5 PE=1 SV=2 1 296 4.0E-109
sp|O65353|RL5_HELAN 60S ribosomal protein L5 OS=Helianthus annuus GN=RPL5A PE=2 SV=1 1 292 7.0E-109
sp|Q26481|RL5_STYCL 60S ribosomal protein L5 OS=Styela clava GN=RPL5 PE=3 SV=3 1 302 5.0E-108
sp|Q56FG6|RL5_LYSTE 60S ribosomal protein L5 OS=Lysiphlebus testaceipes GN=RpL5 PE=2 SV=1 1 301 3.0E-106
sp|Q4KTI3|RL5_SUBDO 60S ribosomal protein L5 OS=Suberites domuncula GN=RPL5 PE=2 SV=1 1 294 4.0E-106
sp|Q5XUC7|RL5_TOXCI 60S ribosomal protein L5 OS=Toxoptera citricida GN=RpL5 PE=2 SV=1 1 301 7.0E-106
sp|P22451|RL5_CHICK 60S ribosomal protein L5 OS=Gallus gallus GN=RPL5 PE=2 SV=2 1 254 5.0E-104
sp|Q4UDE7|RL5_THEAN 60S ribosomal protein L5 OS=Theileria annulata GN=RPL5 PE=3 SV=1 1 301 7.0E-104
sp|Q4N655|RL5_THEPA 60S ribosomal protein L5 OS=Theileria parva GN=RPL5 PE=3 SV=1 1 301 7.0E-104
sp|P15125|RL5A_XENLA 60S ribosomal protein L5-A OS=Xenopus laevis GN=rpl5-a PE=2 SV=2 1 254 2.0E-103
sp|P15126|RL5B_XENLA 60S ribosomal protein L5-B OS=Xenopus laevis GN=rpl5-b PE=2 SV=2 1 254 4.0E-103
sp|Q8LBI1|RL51_ARATH 60S ribosomal protein L5-1 OS=Arabidopsis thaliana GN=ATL5 PE=2 SV=2 1 298 2.0E-102
sp|Q6UNT2|RL5_CUCSA 60S ribosomal protein L5 OS=Cucumis sativus GN=RPL5 PE=2 SV=1 1 298 2.0E-102
sp|A2WXX3|RL51_ORYSI 60S ribosomal protein L5-1 OS=Oryza sativa subsp. indica GN=RPL5A PE=3 SV=2 3 298 7.0E-102
sp|P49227|RL52_ARATH 60S ribosomal protein L5-2 OS=Arabidopsis thaliana GN=RPL5B PE=2 SV=3 1 298 1.0E-101
sp|Q0JGY1|RL51_ORYSJ 60S ribosomal protein L5-1 OS=Oryza sativa subsp. japonica GN=RPL5A PE=2 SV=1 3 298 4.0E-101
sp|O22608|RL5_DUNSA 60S ribosomal protein L5 OS=Dunaliella salina GN=RPL5 PE=2 SV=1 1 255 5.0E-101
sp|Q627R7|RL5_CAEBR 60S ribosomal protein L5 OS=Caenorhabditis briggsae GN=rpl-5 PE=3 SV=2 1 294 5.0E-100
sp|Q1HQU2|RL5_AEDAE 60S ribosomal protein L5 OS=Aedes aegypti GN=RpL5 PE=2 SV=1 1 254 6.0E-98
sp|Q8L4L4|RL52_ORYSJ 60S ribosomal protein L5-2 OS=Oryza sativa subsp. japonica GN=RPL5B PE=3 SV=1 3 298 4.0E-97
sp|P49405|RL5_CAEEL 60S ribosomal protein L5 OS=Caenorhabditis elegans GN=rpl-5 PE=3 SV=1 1 253 5.0E-96
sp|P46777|RL5_HUMAN 60S ribosomal protein L5 OS=Homo sapiens GN=RPL5 PE=1 SV=3 1 254 2.0E-95
sp|Q58DW5|RL5_BOVIN 60S ribosomal protein L5 OS=Bos taurus GN=RPL5 PE=2 SV=3 1 254 2.0E-95
sp|Q5EY89|RL5_EIMTE 60S ribosomal protein L5 OS=Eimeria tenella GN=RPL5 PE=2 SV=1 1 286 2.0E-95
sp|O76190|RL5_BOMMO 60S ribosomal protein L5 OS=Bombyx mori GN=RpL5 PE=2 SV=1 1 294 9.0E-95
sp|Q4R5M0|RL5_MACFA 60S ribosomal protein L5 OS=Macaca fascicularis GN=RPL5 PE=2 SV=3 1 254 1.0E-94
sp|O44248|RL5_ANOGA 60S ribosomal protein L5 OS=Anopheles gambiae GN=RpL5 PE=2 SV=3 1 250 2.0E-93
sp|P47962|RL5_MOUSE 60S ribosomal protein L5 OS=Mus musculus GN=Rpl5 PE=1 SV=3 1 254 4.0E-92
sp|Q54XX3|RL5_DICDI 60S ribosomal protein L5 OS=Dictyostelium discoideum GN=rpl5 PE=1 SV=1 1 289 5.0E-92
sp|P09895|RL5_RAT 60S ribosomal protein L5 OS=Rattus norvegicus GN=Rpl5 PE=1 SV=3 1 254 2.0E-91
sp|Q6JWW5|RL5_OIKDI 60S ribosomal protein L5 OS=Oikopleura dioica GN=RPL5 PE=3 SV=1 3 258 5.0E-91
sp|Q231U7|RL5_TETTS 60S ribosomal protein L5 OS=Tetrahymena thermophila (strain SB210) GN=RPL5 PE=1 SV=2 1 301 3.0E-83
sp|Q95276|RL5_PIG 60S ribosomal protein L5 (Fragment) OS=Sus scrofa GN=RPL5 PE=2 SV=3 1 121 2.0E-43
sp|Q8ZVV7|RL18_PYRAE 50S ribosomal protein L18 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl18 PE=3 SV=1 11 252 1.0E-30
sp|A4WMD6|RL18_PYRAR 50S ribosomal protein L18 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rpl18 PE=3 SV=1 11 252 4.0E-30
sp|O26130|RL18_METTH 50S ribosomal protein L18 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl18 PE=3 SV=1 11 253 5.0E-30
sp|A7I5Q8|RL18_METB6 50S ribosomal protein L18 OS=Methanoregula boonei (strain 6A8) GN=rpl18 PE=3 SV=1 15 216 1.0E-29
sp|A8M9I3|RL18_CALMQ 50S ribosomal protein L18 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rpl18 PE=3 SV=1 11 252 2.0E-29
sp|A6UWV7|RL18_META3 50S ribosomal protein L18 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl18 PE=3 SV=1 11 250 7.0E-29
sp|A3CT16|RL18_METMJ 50S ribosomal protein L18 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl18 PE=3 SV=1 15 217 3.0E-28
sp|Q2FSH0|RL18_METHJ 50S ribosomal protein L18 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl18 PE=3 SV=1 15 210 5.0E-28
sp|P54044|RL18_METJA 50S ribosomal protein L18 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl18 PE=3 SV=1 16 245 1.0E-27
sp|A3MSJ3|RL18_PYRCJ 50S ribosomal protein L18 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rpl18 PE=3 SV=1 14 252 2.0E-27
sp|B8GKF2|RL18_METPE 50S ribosomal protein L18 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rpl18 PE=3 SV=1 15 230 2.0E-27
sp|A1RVN4|RL18_PYRIL 50S ribosomal protein L18 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rpl18 PE=3 SV=1 14 252 4.0E-27
sp|Q9YF94|RL18_AERPE 50S ribosomal protein L18 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl18 PE=3 SV=1 25 252 5.0E-27
sp|B1Y8V2|RL18_PYRNV 50S ribosomal protein L18 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rpl18 PE=3 SV=1 14 252 2.0E-26
sp|A5UL69|RL18_METS3 50S ribosomal protein L18 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl18 PE=3 SV=1 14 252 3.0E-26
sp|A1RWR7|RL18_THEPD 50S ribosomal protein L18 OS=Thermofilum pendens (strain Hrk 5) GN=rpl18 PE=3 SV=1 14 252 2.0E-25
sp|A2SPM1|RL18_METLZ 50S ribosomal protein L18 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rpl18 PE=3 SV=1 11 215 4.0E-25
sp|Q0W1W9|RL18_METAR 50S ribosomal protein L18 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rpl18 PE=3 SV=1 15 187 3.0E-24
sp|A3DNC6|RL18_STAMF 50S ribosomal protein L18 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl18 PE=3 SV=1 14 253 2.0E-23
sp|O28373|RL18_ARCFU 50S ribosomal protein L18 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl18 PE=3 SV=1 14 184 2.0E-23
sp|Q975J9|RL18_SULTO 50S ribosomal protein L18 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl18 PE=3 SV=1 11 252 4.0E-23
sp|A6UQ63|RL18_METVS 50S ribosomal protein L18 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl18 PE=3 SV=1 11 245 8.0E-23
sp|P50562|RL18_HALSA 50S ribosomal protein L18 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl18 PE=1 SV=3 15 253 8.0E-23
sp|B0R675|RL18_HALS3 50S ribosomal protein L18 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl18 PE=3 SV=1 15 253 8.0E-23
sp|P14033|RL18_METVA 50S ribosomal protein L18 OS=Methanococcus vannielii GN=rpl18 PE=3 SV=1 11 245 8.0E-23
sp|C6A179|RL18_THESM 50S ribosomal protein L18 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rpl18 PE=3 SV=1 25 252 2.0E-22
sp|B1L785|RL18_KORCO 50S ribosomal protein L18 OS=Korarchaeum cryptofilum (strain OPF8) GN=rpl18 PE=3 SV=1 14 230 3.0E-22
sp|A4FWA2|RL18_METM5 50S ribosomal protein L18 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl18 PE=3 SV=1 11 250 4.0E-22
sp|P93779|RL5_SOLME 60S ribosomal protein L5 (Fragment) OS=Solanum melongena GN=RPL5 PE=2 SV=1 189 298 4.0E-22
sp|A6VH04|RL18_METM7 50S ribosomal protein L18 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl18 PE=3 SV=1 11 250 5.0E-22
sp|A9A9P5|RL18_METM6 50S ribosomal protein L18 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl18 PE=3 SV=1 11 250 5.0E-22
sp|A0B9V1|RL18_METTP 50S ribosomal protein L18 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rpl18 PE=3 SV=1 25 201 1.0E-21
sp|Q12ZT2|RL18_METBU 50S ribosomal protein L18 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl18 PE=3 SV=1 15 212 2.0E-21
sp|Q8TZA5|RL18_METKA 50S ribosomal protein L18 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl18 PE=3 SV=1 25 253 2.0E-21
sp|Q2NFX6|RL18_METST 50S ribosomal protein L18 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl18 PE=3 SV=1 16 252 1.0E-20
sp|Q9V1V4|RL18_PYRAB 50S ribosomal protein L18 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl18 PE=3 SV=1 25 252 1.0E-20
sp|A2BMD8|RL18_HYPBU 50S ribosomal protein L18 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpl18 PE=3 SV=1 11 253 1.0E-20
sp|A4YCY5|RL18_METS5 50S ribosomal protein L18 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpl18 PE=3 SV=1 11 252 1.0E-20
sp|Q6LXD4|RL18_METMP 50S ribosomal protein L18 OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl18 PE=3 SV=1 11 250 1.0E-20
sp|P50563|RL18_HALVD 50S ribosomal protein L18 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=rpl18 PE=1 SV=2 15 253 1.0E-20
sp|B6YSN3|RL18_THEON 50S ribosomal protein L18 OS=Thermococcus onnurineus (strain NA1) GN=rpl18 PE=3 SV=1 25 252 1.0E-20
sp|O59438|RL18_PYRHO 50S ribosomal protein L18 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl18 PE=3 SV=2 25 252 2.0E-20
sp|Q9HH80|RL18_PYRFU 50S ribosomal protein L18 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl18 PE=1 SV=1 25 252 5.0E-20
sp|P14123|RL18_HALMA 50S ribosomal protein L18 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl18 PE=1 SV=3 15 226 1.0E-19
sp|P50561|RL18_HALMT 50S ribosomal protein L18 OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=rpl18 PE=1 SV=2 15 226 3.0E-19
sp|Q3IMW9|RL18_NATPD 50S ribosomal protein L18 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl18 PE=3 SV=1 11 216 5.0E-19
sp|B8D5V1|RL18_DESK1 50S ribosomal protein L18 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rpl18 PE=3 SV=1 15 252 5.0E-19
sp|Q9UX88|RL18_SULSO 50S ribosomal protein L18 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl18 PE=3 SV=1 16 253 6.0E-19
sp|O05640|RL18_SULAC 50S ribosomal protein L18 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl18 PE=3 SV=1 16 256 7.0E-19
sp|Q74MJ4|RL18_NANEQ 50S ribosomal protein L18 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl18 PE=3 SV=1 25 250 1.0E-18
sp|C3NH90|RL18_SULIN 50S ribosomal protein L18 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpl18 PE=3 SV=1 16 251 3.0E-18
sp|Q8PV31|RL18_METMA 50S ribosomal protein L18 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl18 PE=3 SV=2 15 220 3.0E-18
sp|Q46GB4|RL18_METBF 50S ribosomal protein L18 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl18 PE=3 SV=1 15 220 4.0E-18
sp|Q8TRS8|RL18_METAC 50S ribosomal protein L18 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl18 PE=3 SV=1 15 220 6.0E-18
sp|C3NEG2|RL18_SULIY 50S ribosomal protein L18 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpl18 PE=3 SV=1 16 251 7.0E-18
sp|C3MVJ7|RL18_SULIM 50S ribosomal protein L18 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpl18 PE=3 SV=1 16 251 7.0E-18
sp|C3MQ78|RL18_SULIL 50S ribosomal protein L18 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpl18 PE=3 SV=1 16 251 7.0E-18
sp|C4KHH5|RL18_SULIK 50S ribosomal protein L18 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpl18 PE=3 SV=1 16 251 7.0E-18
sp|C3N5U6|RL18_SULIA 50S ribosomal protein L18 OS=Sulfolobus islandicus (strain M.16.27) GN=rpl18 PE=3 SV=1 16 251 7.0E-18
sp|A8AC01|RL18_IGNH4 50S ribosomal protein L18 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rpl18 PE=3 SV=1 14 253 1.0E-17
sp|Q18GG8|RL18_HALWD 50S ribosomal protein L18 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpl18 PE=3 SV=1 15 226 2.0E-17
sp|C5A266|RL18_THEGJ 50S ribosomal protein L18 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl18 PE=3 SV=1 52 252 1.0E-16
sp|Q5JJG7|RL18_THEKO 50S ribosomal protein L18 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl18 PE=3 SV=1 52 252 2.0E-16
sp|B9LSQ8|RL18_HALLT 50S ribosomal protein L18 OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rpl18 PE=3 SV=1 15 226 7.0E-16
sp|P19949|RL5_RABIT 60S ribosomal protein L5 (Fragments) OS=Oryctolagus cuniculus GN=RPL5 PE=1 SV=2 3 47 2.0E-14
sp|Q97BV7|RL18_THEVO 50S ribosomal protein L18 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl18 PE=3 SV=1 20 184 7.0E-13
sp|Q9HIS6|RL18_THEAC 50S ribosomal protein L18 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl18 PE=3 SV=1 20 184 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0008097 5S rRNA binding Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0005622 intracellular Yes
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043604 amide biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0044267 cellular protein metabolic process No
GO:0043229 intracellular organelle No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0019843 rRNA binding No
GO:0005575 cellular_component No
GO:0009058 biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003723 RNA binding No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0005198 structural molecule activity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1990904 ribonucleoprotein complex No
GO:0019538 protein metabolic process No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043043 peptide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2357
MPFHKLVKNSAYYSRYQTKYKRRRQGKTDYYARKRLITQAKNKYNAPKYRLVVRFTNKDIVMQIVTSEITGDKVL
VAAYAHELKAYGIKHGLTNWAAAYATGLLIARRVLSKLGLDKDFVGVEEPDGEFSLTEAAETDDGERRPFKAFLD
VGLARTSTGARVFGAMKGASDGGILVPHSEKRFPGYDMETKELDAEVLRKYIYGGHVAEYMETLADDDEERYHSQ
FQKYIDDDLEADGLEDLYTEAHQAIREDPWKKASSDAPKKSKEEWKAISKKHKLTKTSKAEKQKKIQEKIQKILQ
EE*
Coding >Hirsu2|2357
ATGCCTTTCCACAAGCTGGTGAAGAACAGCGCGTACTACAGCCGCTACCAGACCAAGTACAAGCGCAGACGCCAA
GGCAAGACCGACTACTACGCCCGCAAGCGCCTCATCACCCAGGCCAAGAACAAGTACAATGCGCCCAAGTACCGC
CTGGTGGTGCGATTCACCAACAAGGACATCGTGATGCAAATCGTCACGTCGGAGATCACGGGCGACAAGGTCCTC
GTCGCGGCCTACGCCCACGAGCTCAAGGCCTACGGCATCAAGCACGGCCTGACCAACTGGGCCGCCGCCTACGCC
ACCGGTCTCCTGATCGCGCGTCGTGTTCTCAGCAAGCTCGGCCTCGACAAGGACTTTGTCGGTGTCGAGGAGCCC
GATGGTGAATTTAGCCTGACGGAGGCGGCCGAGACGGACGACGGCGAGCGCCGCCCCTTCAAGGCCTTCCTCGAC
GTCGGCCTTGCGCGCACCTCGACCGGTGCCCGTGTCTTTGGCGCCATGAAGGGTGCCTCTGACGGCGGCATCTTG
GTGCCGCACTCGGAGAAGCGATTCCCCGGCTACGACATGGAGACCAAGGAGCTCGACGCCGAGGTTCTCCGCAAG
TACATCTACGGCGGCCACGTGGCTGAGTACATGGAGACGCTCGCCGACGACGACGAGGAGCGCTACCACAGCCAG
TTCCAGAAGTACATCGACGACGACCTCGAGGCCGACGGCCTGGAGGACCTGTACACCGAGGCCCACCAGGCCATC
CGCGAGGATCCGTGGAAGAAGGCGTCGAGCGACGCGCCCAAGAAGAGCAAGGAGGAGTGGAAGGCCATTTCCAAG
AAGCACAAGCTGACCAAGACGAGCAAGGCCGAGAAGCAGAAGAAGATCCAGGAGAAGATCCAGAAGATCCTGCAA
GAGGAGTAA
Transcript >Hirsu2|2357
ATGCCTTTCCACAAGCTGGTGAAGAACAGCGCGTACTACAGCCGCTACCAGACCAAGTACAAGCGCAGACGCCAA
GGCAAGACCGACTACTACGCCCGCAAGCGCCTCATCACCCAGGCCAAGAACAAGTACAATGCGCCCAAGTACCGC
CTGGTGGTGCGATTCACCAACAAGGACATCGTGATGCAAATCGTCACGTCGGAGATCACGGGCGACAAGGTCCTC
GTCGCGGCCTACGCCCACGAGCTCAAGGCCTACGGCATCAAGCACGGCCTGACCAACTGGGCCGCCGCCTACGCC
ACCGGTCTCCTGATCGCGCGTCGTGTTCTCAGCAAGCTCGGCCTCGACAAGGACTTTGTCGGTGTCGAGGAGCCC
GATGGTGAATTTAGCCTGACGGAGGCGGCCGAGACGGACGACGGCGAGCGCCGCCCCTTCAAGGCCTTCCTCGAC
GTCGGCCTTGCGCGCACCTCGACCGGTGCCCGTGTCTTTGGCGCCATGAAGGGTGCCTCTGACGGCGGCATCTTG
GTGCCGCACTCGGAGAAGCGATTCCCCGGCTACGACATGGAGACCAAGGAGCTCGACGCCGAGGTTCTCCGCAAG
TACATCTACGGCGGCCACGTGGCTGAGTACATGGAGACGCTCGCCGACGACGACGAGGAGCGCTACCACAGCCAG
TTCCAGAAGTACATCGACGACGACCTCGAGGCCGACGGCCTGGAGGACCTGTACACCGAGGCCCACCAGGCCATC
CGCGAGGATCCGTGGAAGAAGGCGTCGAGCGACGCGCCCAAGAAGAGCAAGGAGGAGTGGAAGGCCATTTCCAAG
AAGCACAAGCTGACCAAGACGAGCAAGGCCGAGAAGCAGAAGAAGATCCAGGAGAAGATCCAGAAGATCCTGCAA
GAGGAGTAA
Gene >Hirsu2|2357
ATGGTAAGTCGAGGCCTACTGGAACCGCTGCCTCAAGAGGCGAGCGAGGCTACCAAGGAAGAAATTCCAATTGCT
CGTCCTGGAGAGTCACCGCAAGATGCTTCGGAGCAAAGACGAGCAAGTCTGAAGCGCAAATTGCTGACTCGGGGA
TTCGACAATAGCCTTTCCACAAGCTGGTGAAGAACAGCGCGTACTACAGGTGAGTTTTTTTTCTTCTCCCCTTCT
CCTGTCGATTCCTCCAGGCGTAGCGACGACAGACATCAGTATTTGTCGCTTTCCCGTCATAGGGATGGACCGACT
GACCAGAGGTTCGCCGCAGCCGCTACCAGACCAAGTACAAGCGCAGACGCCAAGGCAAGACCGACTACTACGCCC
GCAAGCGCCTCATCACCCAGGCCAAGAACAAGTACAATGCGCCCAAGTACCGCCTGGTGGTGCGATTCACCAACA
AGGACATCGTGATGCAAATCGTCACGTCGGAGATCACGGGCGACAAGGTCCTCGTCGCGGCCTACGCCCACGAGC
TCAAGGCCTACGGCATCAAGCACGGCCTGACCAACTGGGCCGCCGCCTACGCCACCGGTCTCCTGATCGCGCGTC
GTGTTCTCAGCAAGCTCGGCCTCGACAAGGACTTTGTCGGTGTCGAGGAGCCCGATGGTGAATTTAGCCTGACGG
AGGCGGCCGAGACGGACGACGGCGAGCGCCGCCCCTTCAAGGCCTTCCTCGACGTCGGCCTTGCGCGCACCTCGA
CCGGTGCCCGTGTCTTTGGCGCCATGAAGGGTGCCTCTGACGGCGGCATCTTGGTGCCGCACTCGGAGAAGCGAT
TCCCCGGCTACGACATGGAGACCAAGGAGCTCGACGCCGAGGTTCTCCGCAAGTACATCTACGGCGGCCACGTGG
CTGAGTACATGGAGACGCTCGCCGACGACGACGAGGAGCGCTACCACAGCCAGTTCCAGAAGTACATCGACGACG
ACCTCGAGGCCGACGGCCTGGAGGACCTGTACACCGAGGCCCACCAGGCCATCCGCGAGGATCCGTGGAAGAAGG
CGTCGAGCGACGCGCCCAAGAAGAGCAAGGAGGAGTGGAAGGCCATTTCCAAGAAGCACAAGCTGACCAAGACGA
GCAAGGCCGAGAAGCAGAAGAAGATCCAGGAGAAGATCCAGAAGATCCTGCAAGAGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail