Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|234
Gene name
LocationContig_1040:1038..2635
Strand-
Gene length (bp)1597
Transcript length (bp)1434
Coding sequence length (bp)1434
Protein length (aa) 478

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 1.8E-17 28 194
PF00271 Helicase_C Helicase conserved C-terminal domain 2.8E-14 273 366
PF16124 RecQ_Zn_bind RecQ zinc-binding 5.8E-13 379 440

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54132|BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 17 444 8.0E-101
sp|O88700|BLM_MOUSE Bloom syndrome protein homolog OS=Mus musculus GN=Blm PE=1 SV=1 17 429 1.0E-98
sp|Q9I920|BLM_CHICK Bloom syndrome protein homolog (Fragment) OS=Gallus gallus GN=BLM PE=2 SV=1 17 444 3.0E-98
sp|Q9DEY9|BLM_XENLA Bloom syndrome protein homolog OS=Xenopus laevis GN=blm PE=2 SV=1 17 430 3.0E-96
sp|Q8VID5|RECQ5_MOUSE ATP-dependent DNA helicase Q5 OS=Mus musculus GN=Recql5 PE=1 SV=1 16 464 8.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54132|BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 17 444 8.0E-101
sp|O88700|BLM_MOUSE Bloom syndrome protein homolog OS=Mus musculus GN=Blm PE=1 SV=1 17 429 1.0E-98
sp|Q9I920|BLM_CHICK Bloom syndrome protein homolog (Fragment) OS=Gallus gallus GN=BLM PE=2 SV=1 17 444 3.0E-98
sp|Q9DEY9|BLM_XENLA Bloom syndrome protein homolog OS=Xenopus laevis GN=blm PE=2 SV=1 17 430 3.0E-96
sp|Q8VID5|RECQ5_MOUSE ATP-dependent DNA helicase Q5 OS=Mus musculus GN=Recql5 PE=1 SV=1 16 464 8.0E-96
sp|Q9VGI8|BLM_DROME Bloom syndrome protein homolog OS=Drosophila melanogaster GN=Blm PE=1 SV=1 5 440 5.0E-95
sp|D4ACP5|RECQ5_RAT ATP-dependent DNA helicase Q5 OS=Rattus norvegicus GN=Recql5 PE=1 SV=1 16 473 8.0E-94
sp|Q9FT72|RQL3_ARATH ATP-dependent DNA helicase Q-like 3 OS=Arabidopsis thaliana GN=RECQL3 PE=1 SV=1 17 477 7.0E-92
sp|O94762|RECQ5_HUMAN ATP-dependent DNA helicase Q5 OS=Homo sapiens GN=RECQL5 PE=1 SV=2 16 464 3.0E-90
sp|Q09811|HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rqh1 PE=1 SV=1 17 440 8.0E-89
sp|Q9FT73|MED34_ARATH Mediator of RNA polymerase II transcription subunit 34 OS=Arabidopsis thaliana GN=MED34 PE=1 SV=1 8 440 2.0E-88
sp|O18017|BLM_CAEEL Bloom syndrome protein homolog OS=Caenorhabditis elegans GN=him-6 PE=2 SV=2 16 448 2.0E-87
sp|A8WK63|RECQ1_CAEBR Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis briggsae GN=CBG24191 PE=3 SV=1 17 440 4.0E-87
sp|Q9TXJ8|RECQ1_CAEEL Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis elegans GN=K02F3.12 PE=3 SV=3 17 440 4.0E-86
sp|P46063|RECQ1_HUMAN ATP-dependent DNA helicase Q1 OS=Homo sapiens GN=RECQL PE=1 SV=3 17 440 3.0E-85
sp|Q5RF63|RECQ1_PONAB ATP-dependent DNA helicase Q1 OS=Pongo abelii GN=RECQL PE=2 SV=1 16 440 4.0E-85
sp|Q9FT74|RQL1_ARATH ATP-dependent DNA helicase Q-like 1 OS=Arabidopsis thaliana GN=RECQL1 PE=2 SV=1 2 430 4.0E-84
sp|Q9Z129|RECQ1_MOUSE ATP-dependent DNA helicase Q1 OS=Mus musculus GN=Recql PE=1 SV=2 16 440 3.0E-83
sp|Q6AYJ1|RECQ1_RAT ATP-dependent DNA helicase Q1 OS=Rattus norvegicus GN=Recql PE=1 SV=1 13 440 3.0E-83
sp|P35187|SGS1_YEAST ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGS1 PE=1 SV=1 12 440 4.0E-82
sp|Q8L840|RQL4A_ARATH ATP-dependent DNA helicase Q-like 4A OS=Arabidopsis thaliana GN=RECQL4A PE=2 SV=1 18 440 1.0E-80
sp|Q9FT70|RQL4B_ARATH ATP-dependent DNA helicase Q-like 4B OS=Arabidopsis thaliana GN=RECQL4B PE=2 SV=1 21 440 2.0E-79
sp|Q9CL21|RECQ_PASMU ATP-dependent DNA helicase RecQ OS=Pasteurella multocida (strain Pm70) GN=recQ PE=3 SV=1 16 445 6.0E-78
sp|P71359|RECQ_HAEIN ATP-dependent DNA helicase RecQ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=recQ PE=3 SV=1 16 445 6.0E-76
sp|P15043|RECQ_ECOLI ATP-dependent DNA helicase RecQ OS=Escherichia coli (strain K12) GN=recQ PE=1 SV=5 16 445 7.0E-76
sp|Q5UPX0|YR290_MIMIV Putative ATP-dependent RNA helicase R290 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R290 PE=3 SV=1 25 444 3.0E-75
sp|P40724|RECQ_SALTY ATP-dependent DNA helicase RecQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=recQ PE=3 SV=3 16 445 7.0E-75
sp|O34748|RECQ_BACSU Probable ATP-dependent DNA helicase RecQ OS=Bacillus subtilis (strain 168) GN=recQ PE=3 SV=1 21 435 1.0E-67
sp|Q19546|WRN_CAEEL Probable Werner syndrome ATP-dependent helicase homolog 1 OS=Caenorhabditis elegans GN=wrn-1 PE=3 SV=2 17 427 6.0E-63
sp|O09053|WRN_MOUSE Werner syndrome ATP-dependent helicase homolog OS=Mus musculus GN=Wrn PE=1 SV=3 17 427 8.0E-61
sp|O93530|WRN_XENLA Werner syndrome ATP-dependent helicase homolog OS=Xenopus laevis GN=wrn PE=2 SV=1 17 427 2.0E-58
sp|Q14191|WRN_HUMAN Werner syndrome ATP-dependent helicase OS=Homo sapiens GN=WRN PE=1 SV=2 17 438 2.0E-58
sp|P50729|RECS_BACSU Probable ATP-dependent DNA helicase RecS OS=Bacillus subtilis (strain 168) GN=recS PE=3 SV=1 11 406 8.0E-56
sp|Q0WVW7|RQL5_ARATH ATP-dependent DNA helicase Q-like 5 OS=Arabidopsis thaliana GN=RECQL5 PE=2 SV=2 26 437 7.0E-48
sp|P73421|RECQ_SYNY3 ATP-dependent DNA helicase RecQ OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=recQ PE=3 SV=1 16 377 5.0E-44
sp|O94761|RECQ4_HUMAN ATP-dependent DNA helicase Q4 OS=Homo sapiens GN=RECQL4 PE=1 SV=1 15 394 6.0E-38
sp|Q75NR7|RECQ4_MOUSE ATP-dependent DNA helicase Q4 OS=Mus musculus GN=Recql4 PE=2 SV=2 26 394 2.0E-34
sp|Q9FT69|RQSIM_ARATH ATP-dependent DNA helicase Q-like SIM OS=Arabidopsis thaliana GN=RECQSIM PE=2 SV=1 13 258 3.0E-30
sp|Q9FT69|RQSIM_ARATH ATP-dependent DNA helicase Q-like SIM OS=Arabidopsis thaliana GN=RECQSIM PE=2 SV=1 260 440 9.0E-21
sp|P0CT33|TLH1_SCHPO ATP-dependent DNA helicase tlh1 (Fragment) OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tlh1 PE=3 SV=1 49 380 6.0E-14
sp|Q1RKN3|TLH2_SCHPO ATP-dependent DNA helicase tlh2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tlh2 PE=2 SV=1 49 380 6.0E-14
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 28 410 1.0E-11
sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=1 SV=1 28 389 4.0E-11
sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 37 377 5.0E-11
sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 22 389 5.0E-11
sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 36 388 1.0E-10
sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 36 388 1.0E-10
sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 36 388 2.0E-10
sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 36 388 4.0E-10
sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1 28 410 5.0E-10
sp|Q755N4|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2 37 377 6.0E-10
sp|A5A6J2|DDX5_PANTR Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes GN=DDX5 PE=2 SV=1 36 388 6.0E-10
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 5 373 7.0E-10
sp|Q6CT49|PRP28_KLULA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP28 PE=3 SV=1 12 424 1.0E-09
sp|A6ZRX0|DBP2_YEAS7 ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP2 PE=3 SV=1 37 388 3.0E-09
sp|P24783|DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1 37 388 3.0E-09
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 28 389 4.0E-09
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 30 384 4.0E-09
sp|Q59W52|PRP28_CANAL Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP28 PE=3 SV=1 269 382 4.0E-09
sp|P24782|DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp2 PE=2 SV=2 28 388 6.0E-09
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 37 388 6.0E-09
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 254 380 6.0E-09
sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Oryza sativa subsp. japonica GN=Os12g0611200 PE=2 SV=1 28 391 7.0E-09
sp|Q5RC67|DDX23_PONAB Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii GN=DDX23 PE=2 SV=1 254 380 7.0E-09
sp|Q0UWC8|PRP28_PHANO Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PRP28 PE=3 SV=1 255 380 1.0E-08
sp|O13792|SUB2_SCHPO ATP-dependent RNA helicase uap56 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uap56 PE=1 SV=3 30 380 2.0E-08
sp|Q41382|RH7_SPIOL DEAD-box ATP-dependent RNA helicase 7 OS=Spinacia oleracea GN=RH7 PE=2 SV=1 274 386 2.0E-08
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 37 377 2.0E-08
sp|A6QSQ0|FAL1_AJECN ATP-dependent RNA helicase FAL1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=FAL1 PE=3 SV=1 30 432 2.0E-08
sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 37 380 2.0E-08
sp|Q5K5B6|RH57_ORYSJ DEAD-box ATP-dependent RNA helicase 57 OS=Oryza sativa subsp. japonica GN=Os07g0647900 PE=2 SV=2 28 380 3.0E-08
sp|A7EIX7|SUB2_SCLS1 ATP-dependent RNA helicase sub2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sub2 PE=3 SV=1 30 388 3.0E-08
sp|P0CQ76|DBP2_CRYNJ ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP2 PE=3 SV=1 37 389 4.0E-08
sp|P0CQ77|DBP2_CRYNB ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP2 PE=3 SV=1 37 389 4.0E-08
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 274 429 5.0E-08
sp|Q2HEB0|PRP28_CHAGB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP28 PE=3 SV=1 272 380 5.0E-08
sp|Q09775|ROK1_SCHPO ATP-dependent RNA helicase rok1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rok1 PE=3 SV=1 274 390 5.0E-08
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 30 380 5.0E-08
sp|Q39189|RH7_ARATH DEAD-box ATP-dependent RNA helicase 7 OS=Arabidopsis thaliana GN=RH7 PE=1 SV=2 274 376 5.0E-08
sp|Q6BME5|SUB2_DEBHA ATP-dependent RNA helicase SUB2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SUB2 PE=3 SV=2 30 389 6.0E-08
sp|Q5A4E2|DED1_CANAL ATP-dependent RNA helicase DED1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED1 PE=3 SV=1 255 388 6.0E-08
sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 28 382 6.0E-08
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 9 377 7.0E-08
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 28 405 7.0E-08
sp|Q4P184|FAL1_USTMA ATP-dependent RNA helicase FAL1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FAL1 PE=3 SV=1 17 382 8.0E-08
sp|A1CMQ7|SUB2_ASPCL ATP-dependent RNA helicase sub2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sub2 PE=3 SV=1 163 388 8.0E-08
sp|Q0TXZ2|SUB2_PHANO ATP-dependent RNA helicase SUB2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SUB2 PE=3 SV=1 30 388 9.0E-08
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 274 387 9.0E-08
sp|Q4WPE9|PRP28_ASPFU Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp28 PE=3 SV=1 255 380 1.0E-07
sp|A1CX72|PRP28_NEOFI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp28 PE=3 SV=1 255 380 1.0E-07
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 39 384 1.0E-07
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 255 388 1.0E-07
sp|Q10055|FAL1_SCHPO ATP-dependent RNA helicase fal1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif412 PE=1 SV=1 29 382 1.0E-07
sp|Q6CDS6|ROK1_YARLI ATP-dependent RNA helicase ROK1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ROK1 PE=3 SV=1 272 380 1.0E-07
sp|Q1DTB3|FAL1_COCIM ATP-dependent RNA helicase FAL1 OS=Coccidioides immitis (strain RS) GN=FAL1 PE=3 SV=2 40 382 1.0E-07
sp|Q0CGJ9|SUB2_ASPTN ATP-dependent RNA helicase sub2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sub2 PE=3 SV=1 163 388 2.0E-07
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 37 388 2.0E-07
sp|A2R0B5|SUB2_ASPNC ATP-dependent RNA helicase sub2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sub2 PE=3 SV=1 163 388 2.0E-07
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 28 380 2.0E-07
sp|A3GHW9|ROK1_PICST ATP-dependent RNA helicase ROK1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ROK1 PE=3 SV=1 272 388 2.0E-07
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 37 388 2.0E-07
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 37 388 2.0E-07
sp|Q5AUL4|FAL1_EMENI ATP-dependent RNA helicase fal1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fal1 PE=3 SV=1 40 382 2.0E-07
sp|A4QSS5|DBP2_MAGO7 ATP-dependent RNA helicase DBP2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP2 PE=3 SV=1 37 380 2.0E-07
sp|Q6C9P3|DBP3_YARLI ATP-dependent RNA helicase DBP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP3 PE=3 SV=1 38 380 2.0E-07
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 28 388 3.0E-07
sp|Q9Y7T7|PRP28_SCHPO Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp28 PE=3 SV=1 272 380 3.0E-07
sp|Q84TG1|RH57_ARATH DEAD-box ATP-dependent RNA helicase 57 OS=Arabidopsis thaliana GN=RH57 PE=2 SV=1 270 381 3.0E-07
sp|P57453|DEAD_BUCAI ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=deaD PE=3 SV=1 274 375 3.0E-07
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 273 398 4.0E-07
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 28 389 4.0E-07
sp|Q0CLX0|PRP28_ASPTN Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp28 PE=3 SV=1 255 380 4.0E-07
sp|A7EM88|FAL1_SCLS1 ATP-dependent RNA helicase fal1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=fal1 PE=3 SV=1 40 382 4.0E-07
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 255 388 4.0E-07
sp|A1DL85|SUB2_NEOFI ATP-dependent RNA helicase sub2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sub2 PE=3 SV=1 30 388 4.0E-07
sp|A1CHL3|PRP28_ASPCL Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp28 PE=3 SV=1 255 380 4.0E-07
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 274 381 4.0E-07
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 274 381 4.0E-07
sp|A5AAE5|FAL1_ASPNC ATP-dependent RNA helicase fal1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fal1 PE=3 SV=2 40 382 4.0E-07
sp|Q2H720|DBP2_CHAGB ATP-dependent RNA helicase DBP2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP2 PE=3 SV=1 37 388 4.0E-07
sp|A6R603|SUB2_AJECN ATP-dependent RNA helicase SUB2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SUB2 PE=3 SV=2 163 388 4.0E-07
sp|Q2GWJ5|FAL1_CHAGB ATP-dependent RNA helicase FAL1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FAL1 PE=3 SV=1 30 382 4.0E-07
sp|Q9Y7C4|ROK1_CANAL ATP-dependent RNA helicase CHR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHR1 PE=3 SV=1 28 380 5.0E-07
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 261 382 5.0E-07
sp|Q9NR30|DDX21_HUMAN Nucleolar RNA helicase 2 OS=Homo sapiens GN=DDX21 PE=1 SV=5 274 384 5.0E-07
sp|Q1DI07|SUB2_COCIM ATP-dependent RNA helicase SUB2 OS=Coccidioides immitis (strain RS) GN=SUB2 PE=3 SV=1 30 380 5.0E-07
sp|Q2U6P7|SUB2_ASPOR ATP-dependent RNA helicase sub2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sub2 PE=3 SV=1 163 388 5.0E-07
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 255 388 5.0E-07
sp|A5E3W5|SUB2_LODEL ATP-dependent RNA helicase SUB2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SUB2 PE=3 SV=1 30 389 5.0E-07
sp|Q2UAK1|FAL1_ASPOR ATP-dependent RNA helicase fal1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fal1 PE=3 SV=1 40 382 5.0E-07
sp|Q0CAS8|FAL1_ASPTN ATP-dependent RNA helicase fal1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fal1 PE=3 SV=1 40 382 5.0E-07
sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 28 380 5.0E-07
sp|A1C595|FAL1_ASPCL ATP-dependent RNA helicase fal1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fal1 PE=3 SV=1 40 382 6.0E-07
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 37 388 6.0E-07
sp|Q8K9H6|DEAD_BUCAP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=deaD PE=3 SV=1 28 388 6.0E-07
sp|Q1DMX8|PRP28_COCIM Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Coccidioides immitis (strain RS) GN=PRP28 PE=3 SV=2 255 380 6.0E-07
sp|Q2UH00|PRP28_ASPOR Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp28 PE=3 SV=1 255 380 7.0E-07
sp|Q5BCU6|PRP28_EMENI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp28 PE=3 SV=2 255 380 7.0E-07
sp|A1D071|FAL1_NEOFI ATP-dependent RNA helicase fal1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fal1 PE=3 SV=1 40 382 7.0E-07
sp|Q9P735|FAL1_NEUCR ATP-dependent RNA helicase fal-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fal-1 PE=3 SV=2 40 382 7.0E-07
sp|P10081|IF4A_YEAST ATP-dependent RNA helicase eIF4A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF1 PE=1 SV=3 30 381 8.0E-07
sp|A6ZQJ1|IF4A_YEAS7 ATP-dependent RNA helicase eIF4A OS=Saccharomyces cerevisiae (strain YJM789) GN=TIF1 PE=3 SV=1 30 381 8.0E-07
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 255 388 8.0E-07
sp|Q7SEL0|PRP28_NEUCR Pre-mRNA-splicing ATP-dependent RNA helicase prp-28 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-28 PE=3 SV=1 255 380 8.0E-07
sp|Q1E1N5|RRP3_COCIM ATP-dependent rRNA helicase RRP3 OS=Coccidioides immitis (strain RS) GN=RRP3 PE=3 SV=1 272 421 9.0E-07
sp|A5DF03|PRP28_PICGU Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRP28 PE=3 SV=2 274 374 9.0E-07
sp|Q4WEB4|FAL1_ASPFU ATP-dependent RNA helicase fal1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fal1 PE=3 SV=2 40 382 1.0E-06
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 273 382 1.0E-06
sp|Q4IAA0|FAL1_GIBZE ATP-dependent RNA helicase FAL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FAL1 PE=3 SV=1 30 382 1.0E-06
sp|Q6FL17|SUB2_CANGA ATP-dependent RNA helicase SUB2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SUB2 PE=3 SV=1 30 387 1.0E-06
sp|A4QU31|FAL1_MAGO7 ATP-dependent RNA helicase FAL1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FAL1 PE=3 SV=1 30 382 1.0E-06
sp|A6S4N4|FAL1_BOTFB ATP-dependent RNA helicase fal1 OS=Botryotinia fuckeliana (strain B05.10) GN=fal1 PE=3 SV=1 40 382 1.0E-06
sp|Q6C024|PRP28_YARLI Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP28 PE=3 SV=1 255 380 1.0E-06
sp|Q6CH90|SUB2_YARLI ATP-dependent RNA helicase SUB2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SUB2 PE=3 SV=2 163 387 1.0E-06
sp|A7TLA0|SUB21_VANPO ATP-dependent RNA helicase SUB2-1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SUB2-1 PE=3 SV=1 30 377 1.0E-06
sp|Q9LYJ9|RH46_ARATH DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana GN=RH46 PE=2 SV=2 10 389 2.0E-06
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 274 389 2.0E-06
sp|A7TJT7|SUB22_VANPO ATP-dependent RNA helicase SUB2-2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SUB2-2 PE=3 SV=1 30 377 2.0E-06
sp|P21693|DBPA_ECOLI ATP-dependent RNA helicase DbpA OS=Escherichia coli (strain K12) GN=dbpA PE=1 SV=2 28 385 2.0E-06
sp|A2QIL2|PRP28_ASPNC Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp28 PE=3 SV=1 255 380 2.0E-06
sp|A5DU73|PRP28_LODEL Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP28 PE=3 SV=1 28 374 2.0E-06
sp|Q4WCW2|SUB2_ASPFU ATP-dependent RNA helicase sub2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sub2 PE=3 SV=1 164 388 2.0E-06
sp|A5DDN0|SUB2_PICGU ATP-dependent RNA helicase SUB2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SUB2 PE=3 SV=3 30 387 2.0E-06
sp|A3GFI4|IF4A_PICST ATP-dependent RNA helicase eIF4A OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TIF1 PE=3 SV=1 29 359 2.0E-06
sp|A7TK55|IF4A_VANPO ATP-dependent RNA helicase eIF4A OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TIF1 PE=3 SV=1 29 381 2.0E-06
sp|A3AVH5|RH13_ORYSJ DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sativa subsp. japonica GN=Os04g0510400 PE=2 SV=2 274 417 2.0E-06
sp|A2XVF7|RH13_ORYSI DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sativa subsp. indica GN=OsI_016050 PE=3 SV=2 274 417 2.0E-06
sp|Q10I26|RH34_ORYSJ DEAD-box ATP-dependent RNA helicase 34 OS=Oryza sativa subsp. japonica GN=Os03g0566800 PE=2 SV=1 2 382 2.0E-06
sp|Q5VNM3|RH2_ORYSJ DEAD-box ATP-dependent RNA helicase 2 OS=Oryza sativa subsp. japonica GN=Os01g0639100 PE=2 SV=1 2 382 2.0E-06
sp|P0CQ72|FAL1_CRYNJ ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FAL1 PE=3 SV=1 17 382 2.0E-06
sp|P0CQ73|FAL1_CRYNB ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FAL1 PE=3 SV=1 17 382 2.0E-06
sp|Q3MSQ8|DDX4_PELLE Probable ATP-dependent RNA helicase DDX4 OS=Pelophylax lessonae GN=ddx4 PE=2 SV=1 28 388 4.0E-06
sp|A6ZXP4|SUB2_YEAS7 ATP-dependent RNA helicase SUB2 OS=Saccharomyces cerevisiae (strain YJM789) GN=SUB2 PE=3 SV=1 30 387 4.0E-06
sp|Q07478|SUB2_YEAST ATP-dependent RNA helicase SUB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUB2 PE=1 SV=1 30 387 4.0E-06
sp|A5DB98|IF4A_PICGU ATP-dependent RNA helicase eIF4A OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TIF1 PE=3 SV=1 29 381 5.0E-06
sp|Q94A52|RH2_ARATH DEAD-box ATP-dependent RNA helicase 2 OS=Arabidopsis thaliana GN=RH2 PE=2 SV=2 3 382 5.0E-06
sp|Q0UAT0|FAL1_PHANO ATP-dependent RNA helicase FAL1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=FAL1 PE=3 SV=3 142 382 6.0E-06
sp|Q5ASK8|SUB2_EMENI ATP-dependent RNA helicase sub2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sub2 PE=3 SV=2 163 388 7.0E-06
sp|Q9VHS8|IF4A3_DROME Eukaryotic initiation factor 4A-III OS=Drosophila melanogaster GN=eIF4AIII PE=1 SV=1 30 382 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0008144 drug binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|234
MPALQRTSSCTDIGFTLRRQFHKHDFRPHQREIIEAALDGHDVYVQAATSFGKSLCFQLPAVVDQGITIVVSPLL
SLMINQVEALRALGIDASSLNSNTPYAEKTRIHRDLETGHPRTRLLYVTPELCSAPAFRDRLQLVYKQRELARVA
IDEAHCISEWGHDFRKDFKRLSWFRETFPDVPIMCLTATANPQVRQDVLSVLRLDVTPERTTTFLMSPQRGNLHL
EIRYTKDEDDNRLSDFLRWIRAVYDRRRAESRKSELAELGERPENVPGIIYTISRDECESLSAALRDEGIGARPF
HAKLPKERKEDTLTRWINNEPGWDIIVATTAFGMGIDKNNVRFVVHWRIPKSFEGYYQEAGRAGRDGNASYCFMY
YSREDLQRVSRMIRGDAKDDSNYGSRLRSLQALALYCENTDSCRHAAICKYFGETAVPECDFACDWHKDPHDLEM
RFLRGLASAEWVSTQAMQGTYDGHYDE*
Coding >Hirsu2|234
ATGCCGGCTCTGCAACGCACAAGCTCGTGCACCGATATCGGATTCACCCTTCGCAGGCAGTTCCACAAGCACGAC
TTCAGGCCGCACCAGCGTGAGATCATCGAAGCGGCGCTCGACGGACACGATGTCTACGTCCAAGCCGCCACGTCC
TTCGGCAAGAGCCTCTGCTTTCAGCTCCCCGCCGTCGTCGACCAGGGCATCACCATCGTCGTCTCCCCGTTGCTG
AGCCTCATGATCAATCAGGTCGAGGCTCTCCGGGCATTGGGCATTGATGCCAGCTCGCTGAACAGCAACACGCCC
TATGCTGAGAAGACCAGGATCCATCGCGACCTCGAGACGGGCCACCCCAGGACTCGGCTCTTGTACGTGACGCCC
GAGCTCTGCTCCGCCCCTGCGTTCCGCGATCGCCTGCAGCTCGTCTACAAGCAGAGAGAGCTCGCGAGAGTCGCG
ATTGATGAAGCCCACTGCATATCGGAGTGGGGCCATGACTTTCGCAAAGACTTCAAGCGGCTTTCATGGTTCAGA
GAAACGTTTCCCGACGTGCCCATCATGTGCCTCACAGCCACGGCAAACCCCCAGGTTCGGCAGGATGTCCTGAGC
GTCTTGCGGCTGGACGTGACGCCGGAGAGAACGACGACGTTCCTCATGAGCCCGCAGCGGGGCAACCTTCACCTC
GAAATCAGATATACCAAAGACGAAGACGACAACAGGCTTTCCGACTTCCTGAGATGGATACGGGCCGTTTACGAT
CGTCGGCGGGCGGAATCGCGCAAGTCGGAGTTGGCCGAGCTGGGCGAGCGACCGGAGAACGTTCCGGGCATCATC
TACACGATATCACGCGACGAGTGCGAGTCTCTGTCGGCGGCGCTGCGGGACGAGGGCATCGGCGCCCGGCCCTTC
CACGCGAAGCTGCCCAAGGAGCGGAAGGAGGACACGCTGACCCGGTGGATCAATAACGAGCCCGGCTGGGACATC
ATCGTGGCGACGACGGCGTTTGGGATGGGCATCGACAAGAACAACGTGCGCTTCGTCGTCCACTGGCGCATCCCC
AAGTCTTTCGAGGGCTACTACCAGGAGGCCGGGCGCGCCGGGCGAGACGGCAACGCGAGCTATTGCTTCATGTAC
TACAGCCGCGAGGACCTGCAGCGAGTGAGCCGCATGATCCGAGGGGACGCAAAGGACGACTCAAACTACGGCTCC
CGACTGCGCAGCCTCCAGGCTCTGGCTCTGTACTGCGAGAACACGGACTCGTGCCGCCACGCCGCGATTTGCAAG
TACTTTGGCGAAACGGCGGTGCCGGAGTGCGACTTCGCCTGCGACTGGCACAAGGACCCGCACGACCTCGAGATG
AGGTTCCTTCGCGGCCTGGCGAGTGCCGAGTGGGTGAGCACCCAGGCCATGCAGGGAACATACGACGGACACTAC
GACGAGTGA
Transcript >Hirsu2|234
ATGCCGGCTCTGCAACGCACAAGCTCGTGCACCGATATCGGATTCACCCTTCGCAGGCAGTTCCACAAGCACGAC
TTCAGGCCGCACCAGCGTGAGATCATCGAAGCGGCGCTCGACGGACACGATGTCTACGTCCAAGCCGCCACGTCC
TTCGGCAAGAGCCTCTGCTTTCAGCTCCCCGCCGTCGTCGACCAGGGCATCACCATCGTCGTCTCCCCGTTGCTG
AGCCTCATGATCAATCAGGTCGAGGCTCTCCGGGCATTGGGCATTGATGCCAGCTCGCTGAACAGCAACACGCCC
TATGCTGAGAAGACCAGGATCCATCGCGACCTCGAGACGGGCCACCCCAGGACTCGGCTCTTGTACGTGACGCCC
GAGCTCTGCTCCGCCCCTGCGTTCCGCGATCGCCTGCAGCTCGTCTACAAGCAGAGAGAGCTCGCGAGAGTCGCG
ATTGATGAAGCCCACTGCATATCGGAGTGGGGCCATGACTTTCGCAAAGACTTCAAGCGGCTTTCATGGTTCAGA
GAAACGTTTCCCGACGTGCCCATCATGTGCCTCACAGCCACGGCAAACCCCCAGGTTCGGCAGGATGTCCTGAGC
GTCTTGCGGCTGGACGTGACGCCGGAGAGAACGACGACGTTCCTCATGAGCCCGCAGCGGGGCAACCTTCACCTC
GAAATCAGATATACCAAAGACGAAGACGACAACAGGCTTTCCGACTTCCTGAGATGGATACGGGCCGTTTACGAT
CGTCGGCGGGCGGAATCGCGCAAGTCGGAGTTGGCCGAGCTGGGCGAGCGACCGGAGAACGTTCCGGGCATCATC
TACACGATATCACGCGACGAGTGCGAGTCTCTGTCGGCGGCGCTGCGGGACGAGGGCATCGGCGCCCGGCCCTTC
CACGCGAAGCTGCCCAAGGAGCGGAAGGAGGACACGCTGACCCGGTGGATCAATAACGAGCCCGGCTGGGACATC
ATCGTGGCGACGACGGCGTTTGGGATGGGCATCGACAAGAACAACGTGCGCTTCGTCGTCCACTGGCGCATCCCC
AAGTCTTTCGAGGGCTACTACCAGGAGGCCGGGCGCGCCGGGCGAGACGGCAACGCGAGCTATTGCTTCATGTAC
TACAGCCGCGAGGACCTGCAGCGAGTGAGCCGCATGATCCGAGGGGACGCAAAGGACGACTCAAACTACGGCTCC
CGACTGCGCAGCCTCCAGGCTCTGGCTCTGTACTGCGAGAACACGGACTCGTGCCGCCACGCCGCGATTTGCAAG
TACTTTGGCGAAACGGCGGTGCCGGAGTGCGACTTCGCCTGCGACTGGCACAAGGACCCGCACGACCTCGAGATG
AGGTTCCTTCGCGGCCTGGCGAGTGCCGAGTGGGTGAGCACCCAGGCCATGCAGGGAACATACGACGGACACTAC
GACGAGTGA
Gene >Hirsu2|234
ATGCCGGCTCTGCAACGCACAAGCTCGTGCACCGATATCGGATTCACCCTTCGCAGGCAGTTCCACAAGCACGAC
TTCAGGTCCGTCAGCCACGCACACTCTGCCTCCTCCCGGCTGACCGCAACGCCCGTAGGCCGCACCAGCGTGAGA
TCATCGAAGCGGCGCTCGACGGACACGATGTCTACGTCCAAGCCGCCACGTCCTTCGGCAAGAGCCTCTGCTTTC
AGCTCCCCGCCGTCGTCGACCAGGGCAGTGAGTTTCGTGCGTCGCCGCTGCTGCCCTCTTCTCTGACGCGCTGGC
AGTCACCATCGTCGTCTCCCCGTTGCTGAGCCTCATGGTGAGCCACCTCTCGCTCCTCCCCTGACAGGCCCTGGT
CCATGCTCCTGACAAGCCGCAGATCAATCAGGTCGAGGCTCTCCGGGCATTGGGCATTGATGCCAGCTCGCTGAA
CAGCAACACGCCCTATGCTGAGAAGACCAGGATCCATCGCGACCTCGAGACGGGCCACCCCAGGACTCGGCTCTT
GTACGTGACGCCCGAGCTCTGCTCCGCCCCTGCGTTCCGCGATCGCCTGCAGCTCGTCTACAAGCAGAGAGAGCT
CGCGAGAGTCGCGATTGATGAAGCCCACTGCATATCGGAGTGGGGCCATGACTTTCGCAAAGACTTCAAGCGGCT
TTCATGGTTCAGAGAAACGTTTCCCGACGTGCCCATCATGTGCCTCACAGCCACGGCAAACCCCCAGGTTCGGCA
GGATGTCCTGAGCGTCTTGCGGCTGGACGTGACGCCGGAGAGAACGACGACGTTCCTCATGAGCCCGCAGCGGGG
CAACCTTCACCTCGAAATCAGATATACCAAAGACGAAGACGACAACAGGCTTTCCGACTTCCTGAGATGGATACG
GGCCGTTTACGATCGTCGGCGGGCGGAATCGCGCAAGTCGGAGTTGGCCGAGCTGGGCGAGCGACCGGAGAACGT
TCCGGGCATCATCTACACGATATCACGCGACGAGTGCGAGTCTCTGTCGGCGGCGCTGCGGGACGAGGGCATCGG
CGCCCGGCCCTTCCACGCGAAGCTGCCCAAGGAGCGGAAGGAGGACACGCTGACCCGGTGGATCAATAACGAGCC
CGGCTGGGACATCATCGTGGCGACGACGGCGTTTGGGATGGGCATCGACAAGAACAACGTGCGCTTCGTCGTCCA
CTGGCGCATCCCCAAGTCTTTCGAGGGCTACTACCAGGAGGCCGGGCGCGCCGGGCGAGACGGCAACGCGAGCTA
TTGCTTCATGTACTACAGCCGCGAGGACCTGCAGCGAGTGAGCCGCATGATCCGAGGGGACGCAAAGGACGACTC
AAACTACGGCTCCCGACTGCGCAGCCTCCAGGCTCTGGCTCTGTACTGCGAGAACACGGACTCGTGCCGCCACGC
CGCGATTTGCAAGTACTTTGGCGAAACGGCGGTGCCGGAGTGCGACTTCGCCTGCGACTGGCACAAGGACCCGCA
CGACCTCGAGATGAGGTTCCTTCGCGGCCTGGCGAGTGCCGAGTGGGTGAGCACCCAGGCCATGCAGGGAACATA
CGACGGACACTACGACGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail