© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|2334 |
| Gene name | |
| Location | Contig_1552:11..1043 |
| Strand | + |
| Gene length (bp) | 1032 |
| Transcript length (bp) | 777 |
| Coding sequence length (bp) | 777 |
| Protein length (aa) | 259 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00189 | Ribosomal_S3_C | Ribosomal protein S3, C-terminal domain | 2.5E-24 | 109 | 191 |
| PF07650 | KH_2 | KH domain | 8.6E-12 | 23 | 97 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O60128|RS3_SCHPO | 40S ribosomal protein S3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps3 PE=1 SV=1 | 8 | 249 | 4.0E-126 |
| sp|Q9FJA6|RS33_ARATH | 40S ribosomal protein S3-3 OS=Arabidopsis thaliana GN=RPS3C PE=1 SV=1 | 5 | 225 | 3.0E-121 |
| sp|Q9M339|RS32_ARATH | 40S ribosomal protein S3-2 OS=Arabidopsis thaliana GN=RPS3B PE=1 SV=1 | 6 | 222 | 9.0E-121 |
| sp|P05750|RS3_YEAST | 40S ribosomal protein S3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS3 PE=1 SV=5 | 8 | 239 | 1.0E-120 |
| sp|Q9SIP7|RS31_ARATH | 40S ribosomal protein S3-1 OS=Arabidopsis thaliana GN=RPS3A PE=1 SV=1 | 5 | 225 | 4.0E-120 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O60128|RS3_SCHPO | 40S ribosomal protein S3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps3 PE=1 SV=1 | 8 | 249 | 4.0E-126 |
| sp|Q9FJA6|RS33_ARATH | 40S ribosomal protein S3-3 OS=Arabidopsis thaliana GN=RPS3C PE=1 SV=1 | 5 | 225 | 3.0E-121 |
| sp|Q9M339|RS32_ARATH | 40S ribosomal protein S3-2 OS=Arabidopsis thaliana GN=RPS3B PE=1 SV=1 | 6 | 222 | 9.0E-121 |
| sp|P05750|RS3_YEAST | 40S ribosomal protein S3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS3 PE=1 SV=5 | 8 | 239 | 1.0E-120 |
| sp|Q9SIP7|RS31_ARATH | 40S ribosomal protein S3-1 OS=Arabidopsis thaliana GN=RPS3A PE=1 SV=1 | 5 | 225 | 4.0E-120 |
| sp|P47835|RS32_XENLA | 40S ribosomal protein S3-B OS=Xenopus laevis GN=rps3-b PE=2 SV=1 | 6 | 233 | 5.0E-120 |
| sp|P62909|RS3_RAT | 40S ribosomal protein S3 OS=Rattus norvegicus GN=Rps3 PE=1 SV=1 | 7 | 246 | 1.0E-119 |
| sp|P62908|RS3_MOUSE | 40S ribosomal protein S3 OS=Mus musculus GN=Rps3 PE=1 SV=1 | 7 | 246 | 1.0E-119 |
| sp|E2RH47|RS3_CANLF | 40S ribosomal protein S3 OS=Canis lupus familiaris GN=RPS3 PE=1 SV=1 | 7 | 246 | 1.0E-119 |
| sp|Q0Z8U2|RS3_PIG | 40S ribosomal protein S3 OS=Sus scrofa GN=RPS3 PE=1 SV=1 | 7 | 246 | 1.0E-119 |
| sp|P23396|RS3_HUMAN | 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 | 7 | 246 | 1.0E-119 |
| sp|Q3T169|RS3_BOVIN | 40S ribosomal protein S3 OS=Bos taurus GN=RPS3 PE=2 SV=1 | 7 | 246 | 1.0E-119 |
| sp|Q90YS2|RS3_ICTPU | 40S ribosomal protein S3 OS=Ictalurus punctatus GN=rps3 PE=2 SV=1 | 7 | 245 | 2.0E-119 |
| sp|P02350|RS31_XENLA | 40S ribosomal protein S3-A OS=Xenopus laevis GN=rps3-a PE=2 SV=2 | 7 | 233 | 2.0E-119 |
| sp|P79891|RS3_AMBME | 40S ribosomal protein S3 OS=Ambystoma mexicanum GN=RPS3 PE=2 SV=1 | 7 | 233 | 3.0E-119 |
| sp|Q5R465|RS3_PONAB | 40S ribosomal protein S3 OS=Pongo abelii GN=RPS3 PE=2 SV=1 | 7 | 246 | 6.0E-119 |
| sp|P48153|RS3_MANSE | 40S ribosomal protein S3 OS=Manduca sexta GN=RpS3 PE=2 SV=1 | 6 | 227 | 1.0E-113 |
| sp|Q06559|RS3_DROME | 40S ribosomal protein S3 OS=Drosophila melanogaster GN=RpS3 PE=1 SV=1 | 8 | 225 | 7.0E-112 |
| sp|P48152|RS3_CAEEL | 40S ribosomal protein S3 OS=Caenorhabditis elegans GN=rps-3 PE=3 SV=1 | 7 | 228 | 8.0E-104 |
| sp|P90526|RS3_DICDI | 40S ribosomal protein S3 OS=Dictyostelium discoideum GN=rps3 PE=1 SV=1 | 7 | 213 | 2.0E-86 |
| sp|Q8SQM3|RS3_ENCCU | 40S ribosomal protein S3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPS3 PE=1 SV=2 | 13 | 220 | 2.0E-54 |
| sp|O59424|RS3_PYRHO | 30S ribosomal protein S3 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps3 PE=3 SV=1 | 12 | 221 | 2.0E-36 |
| sp|Q46GA1|RS3_METBF | 30S ribosomal protein S3 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps3 PE=3 SV=1 | 12 | 236 | 2.0E-35 |
| sp|P54034|RS3_METJA | 30S ribosomal protein S3 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps3 PE=3 SV=1 | 12 | 224 | 1.0E-34 |
| sp|C5A280|RS3_THEGJ | 30S ribosomal protein S3 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rps3 PE=3 SV=1 | 12 | 209 | 2.0E-34 |
| sp|A3CT03|RS3_METMJ | 30S ribosomal protein S3 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps3 PE=3 SV=1 | 12 | 226 | 4.0E-34 |
| sp|Q5JDH5|RS3_THEKO | 30S ribosomal protein S3 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps3 PE=3 SV=1 | 12 | 209 | 1.0E-33 |
| sp|Q3IMY2|RS3_NATPD | 30S ribosomal protein S3 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps3 PE=3 SV=1 | 8 | 224 | 4.0E-33 |
| sp|P20281|RS3_HALMA | 30S ribosomal protein S3 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps3 PE=3 SV=2 | 8 | 215 | 5.0E-33 |
| sp|Q8U004|RS3_PYRFU | 30S ribosomal protein S3 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps3 PE=1 SV=1 | 12 | 222 | 7.0E-32 |
| sp|A4FWB6|RS3_METM5 | 30S ribosomal protein S3 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps3 PE=3 SV=1 | 12 | 214 | 2.0E-31 |
| sp|Q8PV44|RS3_METMA | 30S ribosomal protein S3 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps3 PE=3 SV=1 | 12 | 225 | 3.0E-31 |
| sp|Q8TRU1|RS3_METAC | 30S ribosomal protein S3 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps3 PE=3 SV=1 | 12 | 218 | 3.0E-31 |
| sp|B6YSL9|RS3_THEON | 30S ribosomal protein S3 OS=Thermococcus onnurineus (strain NA1) GN=rps3 PE=3 SV=1 | 12 | 222 | 5.0E-31 |
| sp|Q9V1U1|RS3_PYRAB | 30S ribosomal protein S3 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps3 PE=3 SV=1 | 12 | 221 | 6.0E-31 |
| sp|A6VGZ0|RS3_METM7 | 30S ribosomal protein S3 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps3 PE=3 SV=1 | 12 | 214 | 1.0E-30 |
| sp|O26116|RS3_METTH | 30S ribosomal protein S3 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps3 PE=3 SV=1 | 12 | 228 | 2.0E-30 |
| sp|A9A9Q9|RS3_METM6 | 30S ribosomal protein S3 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rps3 PE=3 SV=1 | 12 | 214 | 2.0E-30 |
| sp|Q0W1Y3|RS3_METAR | 30S ribosomal protein S3 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps3 PE=3 SV=1 | 12 | 213 | 3.0E-30 |
| sp|A2SPK9|RS3_METLZ | 30S ribosomal protein S3 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps3 PE=3 SV=1 | 12 | 213 | 3.0E-30 |
| sp|Q12ZU5|RS3_METBU | 30S ribosomal protein S3 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps3 PE=3 SV=1 | 12 | 232 | 5.0E-30 |
| sp|A7I5P5|RS3_METB6 | 30S ribosomal protein S3 OS=Methanoregula boonei (strain 6A8) GN=rps3 PE=3 SV=1 | 12 | 229 | 6.0E-30 |
| sp|A1RXG6|RS3_THEPD | 30S ribosomal protein S3 OS=Thermofilum pendens (strain Hrk 5) GN=rps3 PE=3 SV=2 | 12 | 213 | 8.0E-30 |
| sp|P15009|RS3_HALSA | 30S ribosomal protein S3 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps3 PE=3 SV=3 | 8 | 223 | 9.0E-30 |
| sp|Q18GF5|RS3_HALWD | 30S ribosomal protein S3 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps3 PE=3 SV=1 | 8 | 228 | 9.0E-30 |
| sp|Q6LXE7|RS3_METMP | 30S ribosomal protein S3 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps3 PE=3 SV=1 | 12 | 213 | 1.0E-29 |
| sp|Q2NFW2|RS3_METST | 30S ribosomal protein S3 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps3 PE=3 SV=1 | 12 | 229 | 1.0E-29 |
| sp|C6A165|RS3_THESM | 30S ribosomal protein S3 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rps3 PE=3 SV=1 | 12 | 221 | 2.0E-29 |
| sp|A5UL83|RS3_METS3 | 30S ribosomal protein S3 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps3 PE=3 SV=1 | 12 | 217 | 3.0E-29 |
| sp|A6UWU3|RS3_META3 | 30S ribosomal protein S3 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps3 PE=3 SV=1 | 12 | 222 | 1.0E-28 |
| sp|A6UQ49|RS3_METVS | 30S ribosomal protein S3 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps3 PE=3 SV=1 | 12 | 214 | 2.0E-28 |
| sp|Q2FT39|RS3_METHJ | 30S ribosomal protein S3 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps3 PE=3 SV=1 | 12 | 209 | 2.0E-28 |
| sp|A0B9W4|RS3_METTP | 30S ribosomal protein S3 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps3 PE=3 SV=1 | 12 | 192 | 1.0E-27 |
| sp|A8AA20|RS3_IGNH4 | 30S ribosomal protein S3 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps3 PE=3 SV=1 | 11 | 252 | 2.0E-26 |
| sp|Q9UXA0|RS3_SULSO | 30S ribosomal protein S3 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps3 PE=3 SV=1 | 11 | 213 | 6.0E-24 |
| sp|O28360|RS3_ARCFU | 30S ribosomal protein S3 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps3 PE=3 SV=1 | 12 | 209 | 2.0E-23 |
| sp|Q4JB46|RS3_SULAC | 30S ribosomal protein S3 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps3 PE=3 SV=1 | 11 | 193 | 5.0E-23 |
| sp|A2BMC5|RS3_HYPBU | 30S ribosomal protein S3 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps3 PE=3 SV=1 | 11 | 229 | 6.0E-22 |
| sp|A3DNB3|RS3_STAMF | 30S ribosomal protein S3 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps3 PE=3 SV=1 | 24 | 218 | 1.0E-21 |
| sp|A3MTL3|RS3_PYRCJ | 30S ribosomal protein S3 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps3 PE=3 SV=2 | 24 | 203 | 1.0E-20 |
| sp|Q9YF78|RS3_AERPE | 30S ribosomal protein S3 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps3 PE=3 SV=1 | 12 | 197 | 2.0E-20 |
| sp|Q6L1C1|RS3_PICTO | 30S ribosomal protein S3 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps3 PE=3 SV=1 | 10 | 241 | 4.0E-20 |
| sp|Q975I7|RS3_SULTO | 30S ribosomal protein S3 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps3 PE=3 SV=1 | 24 | 193 | 5.0E-20 |
| sp|A1RV98|RS3_PYRIL | 30S ribosomal protein S3 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps3 PE=3 SV=1 | 24 | 195 | 4.0E-19 |
| sp|Q8ZWI0|RS3_PYRAE | 30S ribosomal protein S3 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps3 PE=3 SV=2 | 1 | 191 | 8.0E-19 |
| sp|Q8TX35|RS3_METKA | 30S ribosomal protein S3 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps3 PE=3 SV=1 | 1 | 218 | 3.0E-18 |
| sp|A4WIY8|RS3_PYRAR | 30S ribosomal protein S3 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps3 PE=3 SV=2 | 24 | 195 | 1.0E-17 |
| sp|A4YCX2|RS3_METS5 | 30S ribosomal protein S3 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rps3 PE=3 SV=1 | 11 | 193 | 2.0E-17 |
| sp|Q9HIR5|RS3_THEAC | 30S ribosomal protein S3 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps3 PE=3 SV=1 | 10 | 213 | 3.0E-17 |
| sp|Q97BX1|RS3_THEVO | 30S ribosomal protein S3 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps3 PE=3 SV=1 | 10 | 213 | 4.0E-17 |
| sp|A0RVX9|RS3_CENSY | 30S ribosomal protein S3 OS=Cenarchaeum symbiosum (strain A) GN=rps3 PE=3 SV=1 | 23 | 184 | 7.0E-15 |
| sp|Q74MZ4|RS3_NANEQ | 30S ribosomal protein S3 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps3 PE=3 SV=2 | 12 | 216 | 6.0E-11 |
| sp|Q5NHW2|RS3_FRATT | 30S ribosomal protein S3 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpsC PE=3 SV=1 | 11 | 206 | 2.0E-10 |
| sp|Q14JB4|RS3_FRAT1 | 30S ribosomal protein S3 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpsC PE=3 SV=1 | 11 | 206 | 2.0E-10 |
| sp|A0Q4I9|RS3_FRATN | 30S ribosomal protein S3 OS=Francisella tularensis subsp. novicida (strain U112) GN=rpsC PE=3 SV=1 | 11 | 206 | 2.0E-10 |
| sp|Q6KI49|RS3_MYCMO | 30S ribosomal protein S3 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rpsC PE=3 SV=1 | 27 | 201 | 3.0E-10 |
| sp|A4IZS8|RS3_FRATW | 30S ribosomal protein S3 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpsC PE=3 SV=1 | 11 | 206 | 4.0E-10 |
| sp|Q0BNS1|RS3_FRATO | 30S ribosomal protein S3 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpsC PE=3 SV=1 | 11 | 206 | 4.0E-10 |
| sp|Q2A5G4|RS3_FRATH | 30S ribosomal protein S3 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpsC PE=3 SV=1 | 11 | 206 | 4.0E-10 |
| sp|A7N9T2|RS3_FRATF | 30S ribosomal protein S3 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rpsC PE=3 SV=1 | 11 | 206 | 4.0E-10 |
| sp|B2SDX9|RS3_FRATM | 30S ribosomal protein S3 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rpsC PE=3 SV=1 | 11 | 206 | 6.0E-10 |
| sp|Q9RXJ6|RS3_DEIRA | 30S ribosomal protein S3 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpsC PE=3 SV=1 | 23 | 200 | 7.0E-09 |
| sp|A5VLJ9|RS3_LACRD | 30S ribosomal protein S3 OS=Lactobacillus reuteri (strain DSM 20016) GN=rpsC PE=3 SV=1 | 13 | 194 | 4.0E-08 |
| sp|Q88XY0|RS3_LACPL | 30S ribosomal protein S3 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsC PE=3 SV=1 | 13 | 201 | 6.0E-08 |
| sp|B9L6M7|RS3_NAUPA | 30S ribosomal protein S3 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rpsC PE=3 SV=1 | 23 | 208 | 1.0E-07 |
| sp|P80372|RS3_THET8 | 30S ribosomal protein S3 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsC PE=1 SV=3 | 27 | 194 | 1.0E-07 |
| sp|P62663|RS3_THET2 | 30S ribosomal protein S3 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsC PE=1 SV=2 | 27 | 194 | 1.0E-07 |
| sp|Q03ZN9|RS3_LEUMM | 30S ribosomal protein S3 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpsC PE=3 SV=1 | 13 | 195 | 1.0E-07 |
| sp|Q1IX78|RS3_DEIGD | 30S ribosomal protein S3 OS=Deinococcus geothermalis (strain DSM 11300) GN=rpsC PE=3 SV=1 | 23 | 200 | 3.0E-07 |
| sp|A8F991|RS3_BACP2 | 30S ribosomal protein S3 OS=Bacillus pumilus (strain SAFR-032) GN=rpsC PE=3 SV=1 | 23 | 194 | 3.0E-07 |
| sp|B8E1D9|RS3_DICTD | 30S ribosomal protein S3 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rpsC PE=3 SV=1 | 24 | 209 | 5.0E-07 |
| sp|C1CXG0|RS3_DEIDV | 30S ribosomal protein S3 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rpsC PE=3 SV=1 | 23 | 194 | 6.0E-07 |
| sp|A5IYY0|RS3_MYCAP | 30S ribosomal protein S3 OS=Mycoplasma agalactiae (strain PG2) GN=rpsC PE=3 SV=1 | 22 | 199 | 7.0E-07 |
| sp|Q1WS96|RS3_LACS1 | 30S ribosomal protein S3 OS=Lactobacillus salivarius (strain UCC118) GN=rpsC PE=3 SV=1 | 13 | 194 | 7.0E-07 |
| sp|C5D3S3|RS3_GEOSW | 30S ribosomal protein S3 OS=Geobacillus sp. (strain WCH70) GN=rpsC PE=3 SV=1 | 23 | 194 | 8.0E-07 |
| sp|P59186|RS3_STRMU | 30S ribosomal protein S3 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpsC PE=3 SV=1 | 3 | 194 | 8.0E-07 |
| sp|Q74L83|RS3_LACJO | 30S ribosomal protein S3 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpsC PE=3 SV=1 | 13 | 205 | 8.0E-07 |
| sp|B1MW08|RS3_LEUCK | 30S ribosomal protein S3 OS=Leuconostoc citreum (strain KM20) GN=rpsC PE=3 SV=1 | 13 | 195 | 9.0E-07 |
| sp|A4VSG0|RS3_STRSY | 30S ribosomal protein S3 OS=Streptococcus suis (strain 05ZYH33) GN=rpsC PE=3 SV=1 | 3 | 194 | 1.0E-06 |
| sp|A4VYP9|RS3_STRS2 | 30S ribosomal protein S3 OS=Streptococcus suis (strain 98HAH33) GN=rpsC PE=3 SV=1 | 3 | 194 | 1.0E-06 |
| sp|A7Z0P4|RS3_BACMF | 30S ribosomal protein S3 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpsC PE=3 SV=1 | 23 | 194 | 2.0E-06 |
| sp|Q7M8E0|RS3_WOLSU | 30S ribosomal protein S3 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpsC PE=3 SV=1 | 23 | 205 | 2.0E-06 |
| sp|Q046B9|RS3_LACGA | 30S ribosomal protein S3 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpsC PE=3 SV=1 | 13 | 205 | 2.0E-06 |
| sp|Q04G79|RS3_OENOB | 30S ribosomal protein S3 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpsC PE=3 SV=1 | 43 | 200 | 2.0E-06 |
| sp|Q65PA1|RS3_BACLD | 30S ribosomal protein S3 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpsC PE=3 SV=1 | 23 | 194 | 2.0E-06 |
| sp|A8AZL9|RS3_STRGC | 30S ribosomal protein S3 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpsC PE=3 SV=1 | 3 | 194 | 2.0E-06 |
| sp|Q1RHM7|RS3_RICBR | 30S ribosomal protein S3 OS=Rickettsia bellii (strain RML369-C) GN=rpsC PE=3 SV=1 | 17 | 200 | 3.0E-06 |
| sp|A8GVC0|RS3_RICB8 | 30S ribosomal protein S3 OS=Rickettsia bellii (strain OSU 85-389) GN=rpsC PE=3 SV=1 | 17 | 200 | 3.0E-06 |
| sp|Q9HWE1|RS3_PSEAE | 30S ribosomal protein S3 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsC PE=3 SV=1 | 12 | 194 | 3.0E-06 |
| sp|Q02T74|RS3_PSEAB | 30S ribosomal protein S3 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsC PE=3 SV=1 | 12 | 194 | 3.0E-06 |
| sp|A6UZJ4|RS3_PSEA7 | 30S ribosomal protein S3 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsC PE=3 SV=1 | 12 | 194 | 3.0E-06 |
| sp|Q7MPI2|RS3_VIBVY | 30S ribosomal protein S3 OS=Vibrio vulnificus (strain YJ016) GN=rpsC PE=3 SV=1 | 17 | 220 | 3.0E-06 |
| sp|Q8DE45|RS3_VIBVU | 30S ribosomal protein S3 OS=Vibrio vulnificus (strain CMCP6) GN=rpsC PE=3 SV=1 | 17 | 220 | 3.0E-06 |
| sp|Q839F8|RS3_ENTFA | 30S ribosomal protein S3 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpsC PE=3 SV=1 | 3 | 194 | 3.0E-06 |
| sp|Q4FLM4|RS3_PELUB | 30S ribosomal protein S3 OS=Pelagibacter ubique (strain HTCC1062) GN=rpsC PE=3 SV=1 | 17 | 194 | 3.0E-06 |
| sp|O84527|RS3_CHLTR | 30S ribosomal protein S3 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsC PE=3 SV=1 | 13 | 203 | 4.0E-06 |
| sp|Q1IFW0|RS3_PSEE4 | 30S ribosomal protein S3 OS=Pseudomonas entomophila (strain L48) GN=rpsC PE=3 SV=1 | 14 | 194 | 4.0E-06 |
| sp|P47403|RS3_MYCGE | 30S ribosomal protein S3 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpsC PE=3 SV=2 | 38 | 194 | 4.0E-06 |
| sp|Q88QM9|RS3_PSEPK | 30S ribosomal protein S3 OS=Pseudomonas putida (strain KT2440) GN=rpsC PE=3 SV=2 | 14 | 194 | 4.0E-06 |
| sp|A5VXQ3|RS3_PSEP1 | 30S ribosomal protein S3 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsC PE=3 SV=1 | 14 | 194 | 4.0E-06 |
| sp|A3CK69|RS3_STRSV | 30S ribosomal protein S3 OS=Streptococcus sanguinis (strain SK36) GN=rpsC PE=3 SV=1 | 3 | 194 | 4.0E-06 |
| sp|B9DSV6|RS3_STRU0 | 30S ribosomal protein S3 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpsC PE=3 SV=1 | 3 | 194 | 4.0E-06 |
| sp|A4VHN6|RS3_PSEU5 | 30S ribosomal protein S3 OS=Pseudomonas stutzeri (strain A1501) GN=rpsC PE=3 SV=1 | 14 | 194 | 6.0E-06 |
| sp|B3PMP1|RS3_MYCA5 | 30S ribosomal protein S3 OS=Mycoplasma arthritidis (strain 158L3-1) GN=rpsC PE=3 SV=1 | 2 | 194 | 6.0E-06 |
| sp|Q03PW3|RS3_LACBA | 30S ribosomal protein S3 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpsC PE=3 SV=1 | 13 | 194 | 6.0E-06 |
| sp|Q4A5C7|RS3_MYCS5 | 30S ribosomal protein S3 OS=Mycoplasma synoviae (strain 53) GN=rpsC PE=3 SV=1 | 61 | 199 | 6.0E-06 |
| sp|Q03IF7|RS3_STRTD | 30S ribosomal protein S3 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpsC PE=3 SV=1 | 3 | 194 | 7.0E-06 |
| sp|A8GPE4|RS3_RICAH | 30S ribosomal protein S3 OS=Rickettsia akari (strain Hartford) GN=rpsC PE=3 SV=1 | 17 | 200 | 7.0E-06 |
| sp|Q6MJ20|RS3_BDEBA | 30S ribosomal protein S3 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpsC PE=3 SV=1 | 24 | 194 | 7.0E-06 |
| sp|B7GJ73|RS3_ANOFW | 30S ribosomal protein S3 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpsC PE=3 SV=1 | 23 | 194 | 8.0E-06 |
| sp|C0MCB6|RS3_STRS7 | 30S ribosomal protein S3 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpsC PE=3 SV=1 | 3 | 194 | 8.0E-06 |
| sp|B4U506|RS3_STREM | 30S ribosomal protein S3 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rpsC PE=3 SV=1 | 3 | 194 | 8.0E-06 |
| sp|C0M8D5|RS3_STRE4 | 30S ribosomal protein S3 OS=Streptococcus equi subsp. equi (strain 4047) GN=rpsC PE=3 SV=1 | 3 | 194 | 8.0E-06 |
| sp|Q65QW1|RS3_MANSM | 30S ribosomal protein S3 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsC PE=3 SV=2 | 17 | 194 | 8.0E-06 |
| sp|A4IJJ5|RS3_GEOTN | 30S ribosomal protein S3 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpsC PE=3 SV=1 | 23 | 194 | 9.0E-06 |
| sp|Q5M2B9|RS3_STRT2 | 30S ribosomal protein S3 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpsC PE=3 SV=1 | 3 | 194 | 9.0E-06 |
| sp|Q5LXR7|RS3_STRT1 | 30S ribosomal protein S3 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpsC PE=3 SV=1 | 3 | 194 | 9.0E-06 |
| sp|A2BTD1|RS3_PROMS | 30S ribosomal protein S3 OS=Prochlorococcus marinus (strain AS9601) GN=rpsC PE=3 SV=1 | 23 | 222 | 9.0E-06 |
| sp|A3PF41|RS3_PROM0 | 30S ribosomal protein S3 OS=Prochlorococcus marinus (strain MIT 9301) GN=rpsC PE=3 SV=1 | 23 | 222 | 9.0E-06 |
| sp|C3LRQ2|RS3_VIBCM | 30S ribosomal protein S3 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsC PE=3 SV=1 | 17 | 220 | 9.0E-06 |
| sp|Q9KNZ0|RS3_VIBCH | 30S ribosomal protein S3 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsC PE=3 SV=1 | 17 | 220 | 9.0E-06 |
| sp|A5F543|RS3_VIBC3 | 30S ribosomal protein S3 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsC PE=3 SV=1 | 17 | 220 | 9.0E-06 |
| sp|Q2JV87|RS3_SYNJA | 30S ribosomal protein S3 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rpsC PE=3 SV=1 | 11 | 208 | 9.0E-06 |
| sp|C1CP94|RS3_STRZT | 30S ribosomal protein S3 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpsC PE=3 SV=1 | 3 | 194 | 9.0E-06 |
| sp|C1CIA3|RS3_STRZP | 30S ribosomal protein S3 OS=Streptococcus pneumoniae (strain P1031) GN=rpsC PE=3 SV=1 | 3 | 194 | 9.0E-06 |
| sp|C1CC12|RS3_STRZJ | 30S ribosomal protein S3 OS=Streptococcus pneumoniae (strain JJA) GN=rpsC PE=3 SV=1 | 3 | 194 | 9.0E-06 |
| sp|P0A4C4|RS3_STRR6 | 30S ribosomal protein S3 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsC PE=3 SV=1 | 3 | 194 | 9.0E-06 |
| sp|B2IS46|RS3_STRPS | 30S ribosomal protein S3 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpsC PE=3 SV=1 | 3 | 194 | 9.0E-06 |
| sp|P0A4C3|RS3_STRPN | 30S ribosomal protein S3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsC PE=3 SV=1 | 3 | 194 | 9.0E-06 |
| sp|B8ZKG3|RS3_STRPJ | 30S ribosomal protein S3 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpsC PE=3 SV=1 | 3 | 194 | 9.0E-06 |
| sp|B1I8K4|RS3_STRPI | 30S ribosomal protein S3 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpsC PE=3 SV=1 | 3 | 194 | 9.0E-06 |
| sp|C1CAL8|RS3_STRP7 | 30S ribosomal protein S3 OS=Streptococcus pneumoniae (strain 70585) GN=rpsC PE=3 SV=1 | 3 | 194 | 9.0E-06 |
| sp|B5E6G1|RS3_STRP4 | 30S ribosomal protein S3 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpsC PE=3 SV=1 | 3 | 194 | 9.0E-06 |
| sp|Q04MN0|RS3_STRP2 | 30S ribosomal protein S3 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsC PE=3 SV=1 | 3 | 194 | 9.0E-06 |
| sp|P55827|RS3_AGGAC | 30S ribosomal protein S3 OS=Aggregatibacter actinomycetemcomitans GN=rpsC PE=3 SV=2 | 23 | 194 | 1.0E-05 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0006412 | translation | Yes |
| GO:0003723 | RNA binding | Yes |
| GO:0003735 | structural constituent of ribosome | Yes |
| GO:0044260 | cellular macromolecule metabolic process | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0003676 | nucleic acid binding | No |
| GO:0034641 | cellular nitrogen compound metabolic process | No |
| GO:0009059 | macromolecule biosynthetic process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0044271 | cellular nitrogen compound biosynthetic process | No |
| GO:0019538 | protein metabolic process | No |
| GO:0005488 | binding | No |
| GO:0044249 | cellular biosynthetic process | No |
| GO:0009058 | biosynthetic process | No |
| GO:0008150 | biological_process | No |
| GO:0034645 | cellular macromolecule biosynthetic process | No |
| GO:0009987 | cellular process | No |
| GO:0043043 | peptide biosynthetic process | No |
| GO:0008152 | metabolic process | No |
| GO:0005198 | structural molecule activity | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:0043603 | cellular amide metabolic process | No |
| GO:0044238 | primary metabolic process | No |
| GO:1901566 | organonitrogen compound biosynthetic process | No |
| GO:1901564 | organonitrogen compound metabolic process | No |
| GO:0003674 | molecular_function | No |
| GO:1901576 | organic substance biosynthetic process | No |
| GO:0044237 | cellular metabolic process | No |
| GO:0043170 | macromolecule metabolic process | No |
| GO:0006518 | peptide metabolic process | No |
| GO:0043604 | amide biosynthetic process | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 12 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|2334 MAHPGSQISKRRKFVADGVFYAELNEFFQRELAEEGYSGVEVRVTPTVTDIIIRATHTQEVLGEQGRRIRELTSL IQKRFKFPENSVSLYAAKVQNRGLSAVAQCESLRYKLLNGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRAARA KSMKFTDGFMIHSGQPAKDFIDSATRHVLLRQGVLGIKVKIMRGSDPEGKAGPQKSLPDAVTIIEPKEEQTVVQP ISQDYGAKAAQAQASQDARVAEQEGEEEPAAEQ* |
| Coding | >Hirsu2|2334 ATGGCGCACCCCGGTTCCCAAATCTCCAAACGGAGAAAGTTCGTCGCCGACGGCGTCTTCTACGCCGAGCTCAAC GAGTTCTTCCAGCGTGAGCTCGCGGAGGAGGGCTACTCGGGCGTCGAGGTCCGCGTCACACCGACCGTGACCGAT ATCATCATCCGCGCGACGCACACGCAGGAGGTGCTGGGCGAGCAGGGCCGCCGGATTCGCGAGCTCACGTCGCTC ATCCAGAAGCGCTTCAAGTTCCCCGAGAACTCCGTCTCCCTCTACGCCGCCAAGGTGCAGAACCGCGGCCTGTCA GCCGTCGCCCAGTGCGAGTCGCTCCGCTACAAGCTGCTCAATGGCCTGGCCGTCCGCCGCGCCTGCTACGGCGTC CTCCGCTTCATCATGGAGAGCGGCGCCAAGGGCTGCGAGGTGGTCGTCTCCGGCAAGCTCCGCGCCGCCCGCGCC AAGAGCATGAAGTTCACCGACGGCTTCATGATCCATTCGGGCCAGCCGGCCAAGGACTTCATTGACTCGGCCACG CGCCACGTTCTGCTCCGCCAGGGCGTGCTCGGCATCAAGGTCAAGATCATGCGTGGCTCCGACCCCGAGGGCAAG GCTGGCCCCCAGAAGTCCCTGCCCGACGCCGTCACCATCATCGAGCCCAAGGAGGAGCAGACGGTCGTTCAGCCC ATCAGCCAGGACTACGGCGCTAAGGCCGCCCAAGCCCAGGCCAGCCAGGACGCGCGGGTGGCCGAGCAGGAGGGC GAGGAGGAGCCGGCCGCCGAGCAATAA |
| Transcript | >Hirsu2|2334 ATGGCGCACCCCGGTTCCCAAATCTCCAAACGGAGAAAGTTCGTCGCCGACGGCGTCTTCTACGCCGAGCTCAAC GAGTTCTTCCAGCGTGAGCTCGCGGAGGAGGGCTACTCGGGCGTCGAGGTCCGCGTCACACCGACCGTGACCGAT ATCATCATCCGCGCGACGCACACGCAGGAGGTGCTGGGCGAGCAGGGCCGCCGGATTCGCGAGCTCACGTCGCTC ATCCAGAAGCGCTTCAAGTTCCCCGAGAACTCCGTCTCCCTCTACGCCGCCAAGGTGCAGAACCGCGGCCTGTCA GCCGTCGCCCAGTGCGAGTCGCTCCGCTACAAGCTGCTCAATGGCCTGGCCGTCCGCCGCGCCTGCTACGGCGTC CTCCGCTTCATCATGGAGAGCGGCGCCAAGGGCTGCGAGGTGGTCGTCTCCGGCAAGCTCCGCGCCGCCCGCGCC AAGAGCATGAAGTTCACCGACGGCTTCATGATCCATTCGGGCCAGCCGGCCAAGGACTTCATTGACTCGGCCACG CGCCACGTTCTGCTCCGCCAGGGCGTGCTCGGCATCAAGGTCAAGATCATGCGTGGCTCCGACCCCGAGGGCAAG GCTGGCCCCCAGAAGTCCCTGCCCGACGCCGTCACCATCATCGAGCCCAAGGAGGAGCAGACGGTCGTTCAGCCC ATCAGCCAGGACTACGGCGCTAAGGCCGCCCAAGCCCAGGCCAGCCAGGACGCGCGGGTGGCCGAGCAGGAGGGC GAGGAGGAGCCGGCCGCCGAGCAATAA |
| Gene | >Hirsu2|2334 ATGGCGCACCCCGGTTCCCAAATGTGAGTCCTCTCTTTCGACGTGGAGCCGCTCTCACTCCCCCTGGTCTGCCGA ATCGCCAAATCGATCGCCGCCGTGGTGTCTCCCAAGAGGGGGGGCAAGGCCATGTCGAAGGGGGTGCGGGCGAAC CGCAACGGGTGCGGCGCGGAAGAGAGACCGTCGGCGCACAATTGGTTGCTGGTTGGCTCGAGAGGCATTTTTACG AGCGTAAGAATAAGAGAAAGGCCGCTGACCGAGAGTTTCTCGACATGGCACAGCTCCAAACGGAGAAAGTTCGTC GCCGACGGCGTCTTCTACGCCGAGCTCAACGAGTTCTTCCAGCGTGAGCTCGCGGAGGAGGGCTACTCGGGCGTC GAGGTCCGCGTCACACCGACCGTGACCGATATCATCATCCGCGCGACGCACACGCAGGAGGTGCTGGGCGAGCAG GGCCGCCGGATTCGCGAGCTCACGTCGCTCATCCAGAAGCGCTTCAAGTTCCCCGAGAACTCCGTCTCCCTCTAC GCCGCCAAGGTGCAGAACCGCGGCCTGTCAGCCGTCGCCCAGTGCGAGTCGCTCCGCTACAAGCTGCTCAATGGC CTGGCCGTCCGCCGCGCCTGCTACGGCGTCCTCCGCTTCATCATGGAGAGCGGCGCCAAGGGCTGCGAGGTGGTC GTCTCCGGCAAGCTCCGCGCCGCCCGCGCCAAGAGCATGAAGTTCACCGACGGCTTCATGATCCATTCGGGCCAG CCGGCCAAGGACTTCATTGACTCGGCCACGCGCCACGTTCTGCTCCGCCAGGGCGTGCTCGGCATCAAGGTCAAG ATCATGCGTGGCTCCGACCCCGAGGGCAAGGCTGGCCCCCAGAAGTCCCTGCCCGACGCCGTCACCATCATCGAG CCCAAGGAGGAGCAGACGGTCGTTCAGCCCATCAGCCAGGACTACGGCGCTAAGGCCGCCCAAGCCCAGGCCAGC CAGGACGCGCGGGTGGCCGAGCAGGAGGGCGAGGAGGAGCCGGCCGCCGAGCAATAA |