Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2334
Gene name
LocationContig_1552:11..1043
Strand+
Gene length (bp)1032
Transcript length (bp)777
Coding sequence length (bp)777
Protein length (aa) 259

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain 5.4E-24 109 191
PF07650 KH_2 KH domain 1.1E-11 23 97

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60128|RS3_SCHPO 40S ribosomal protein S3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps3 PE=1 SV=1 8 249 4.0E-126
sp|Q9FJA6|RS33_ARATH 40S ribosomal protein S3-3 OS=Arabidopsis thaliana GN=RPS3C PE=1 SV=1 5 225 3.0E-121
sp|Q9M339|RS32_ARATH 40S ribosomal protein S3-2 OS=Arabidopsis thaliana GN=RPS3B PE=1 SV=1 6 222 9.0E-121
sp|P05750|RS3_YEAST 40S ribosomal protein S3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS3 PE=1 SV=5 8 239 1.0E-120
sp|Q9SIP7|RS31_ARATH 40S ribosomal protein S3-1 OS=Arabidopsis thaliana GN=RPS3A PE=1 SV=1 5 225 4.0E-120
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60128|RS3_SCHPO 40S ribosomal protein S3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps3 PE=1 SV=1 8 249 4.0E-126
sp|Q9FJA6|RS33_ARATH 40S ribosomal protein S3-3 OS=Arabidopsis thaliana GN=RPS3C PE=1 SV=1 5 225 3.0E-121
sp|Q9M339|RS32_ARATH 40S ribosomal protein S3-2 OS=Arabidopsis thaliana GN=RPS3B PE=1 SV=1 6 222 9.0E-121
sp|P05750|RS3_YEAST 40S ribosomal protein S3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS3 PE=1 SV=5 8 239 1.0E-120
sp|Q9SIP7|RS31_ARATH 40S ribosomal protein S3-1 OS=Arabidopsis thaliana GN=RPS3A PE=1 SV=1 5 225 4.0E-120
sp|P47835|RS32_XENLA 40S ribosomal protein S3-B OS=Xenopus laevis GN=rps3-b PE=2 SV=1 6 233 5.0E-120
sp|P62909|RS3_RAT 40S ribosomal protein S3 OS=Rattus norvegicus GN=Rps3 PE=1 SV=1 7 246 1.0E-119
sp|P62908|RS3_MOUSE 40S ribosomal protein S3 OS=Mus musculus GN=Rps3 PE=1 SV=1 7 246 1.0E-119
sp|E2RH47|RS3_CANLF 40S ribosomal protein S3 OS=Canis lupus familiaris GN=RPS3 PE=1 SV=1 7 246 1.0E-119
sp|Q0Z8U2|RS3_PIG 40S ribosomal protein S3 OS=Sus scrofa GN=RPS3 PE=1 SV=1 7 246 1.0E-119
sp|P23396|RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 7 246 1.0E-119
sp|Q3T169|RS3_BOVIN 40S ribosomal protein S3 OS=Bos taurus GN=RPS3 PE=2 SV=1 7 246 1.0E-119
sp|Q90YS2|RS3_ICTPU 40S ribosomal protein S3 OS=Ictalurus punctatus GN=rps3 PE=2 SV=1 7 245 2.0E-119
sp|P02350|RS31_XENLA 40S ribosomal protein S3-A OS=Xenopus laevis GN=rps3-a PE=2 SV=2 7 233 2.0E-119
sp|P79891|RS3_AMBME 40S ribosomal protein S3 OS=Ambystoma mexicanum GN=RPS3 PE=2 SV=1 7 233 3.0E-119
sp|Q5R465|RS3_PONAB 40S ribosomal protein S3 OS=Pongo abelii GN=RPS3 PE=2 SV=1 7 246 6.0E-119
sp|P48153|RS3_MANSE 40S ribosomal protein S3 OS=Manduca sexta GN=RpS3 PE=2 SV=1 6 227 1.0E-113
sp|Q06559|RS3_DROME 40S ribosomal protein S3 OS=Drosophila melanogaster GN=RpS3 PE=1 SV=1 8 225 7.0E-112
sp|P48152|RS3_CAEEL 40S ribosomal protein S3 OS=Caenorhabditis elegans GN=rps-3 PE=3 SV=1 7 228 8.0E-104
sp|P90526|RS3_DICDI 40S ribosomal protein S3 OS=Dictyostelium discoideum GN=rps3 PE=1 SV=1 7 213 2.0E-86
sp|Q8SQM3|RS3_ENCCU 40S ribosomal protein S3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPS3 PE=1 SV=2 13 220 2.0E-54
sp|O59424|RS3_PYRHO 30S ribosomal protein S3 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps3 PE=3 SV=1 12 221 2.0E-36
sp|Q46GA1|RS3_METBF 30S ribosomal protein S3 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps3 PE=3 SV=1 12 236 2.0E-35
sp|P54034|RS3_METJA 30S ribosomal protein S3 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps3 PE=3 SV=1 12 224 1.0E-34
sp|C5A280|RS3_THEGJ 30S ribosomal protein S3 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rps3 PE=3 SV=1 12 209 2.0E-34
sp|A3CT03|RS3_METMJ 30S ribosomal protein S3 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps3 PE=3 SV=1 12 226 4.0E-34
sp|Q5JDH5|RS3_THEKO 30S ribosomal protein S3 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps3 PE=3 SV=1 12 209 1.0E-33
sp|Q3IMY2|RS3_NATPD 30S ribosomal protein S3 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps3 PE=3 SV=1 8 224 4.0E-33
sp|P20281|RS3_HALMA 30S ribosomal protein S3 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps3 PE=3 SV=2 8 215 5.0E-33
sp|Q8U004|RS3_PYRFU 30S ribosomal protein S3 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps3 PE=1 SV=1 12 222 7.0E-32
sp|A4FWB6|RS3_METM5 30S ribosomal protein S3 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps3 PE=3 SV=1 12 214 2.0E-31
sp|Q8PV44|RS3_METMA 30S ribosomal protein S3 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps3 PE=3 SV=1 12 225 3.0E-31
sp|Q8TRU1|RS3_METAC 30S ribosomal protein S3 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps3 PE=3 SV=1 12 218 3.0E-31
sp|B6YSL9|RS3_THEON 30S ribosomal protein S3 OS=Thermococcus onnurineus (strain NA1) GN=rps3 PE=3 SV=1 12 222 5.0E-31
sp|Q9V1U1|RS3_PYRAB 30S ribosomal protein S3 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps3 PE=3 SV=1 12 221 6.0E-31
sp|A6VGZ0|RS3_METM7 30S ribosomal protein S3 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps3 PE=3 SV=1 12 214 1.0E-30
sp|O26116|RS3_METTH 30S ribosomal protein S3 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps3 PE=3 SV=1 12 228 2.0E-30
sp|A9A9Q9|RS3_METM6 30S ribosomal protein S3 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rps3 PE=3 SV=1 12 214 2.0E-30
sp|Q0W1Y3|RS3_METAR 30S ribosomal protein S3 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps3 PE=3 SV=1 12 213 3.0E-30
sp|A2SPK9|RS3_METLZ 30S ribosomal protein S3 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps3 PE=3 SV=1 12 213 3.0E-30
sp|Q12ZU5|RS3_METBU 30S ribosomal protein S3 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps3 PE=3 SV=1 12 232 5.0E-30
sp|A7I5P5|RS3_METB6 30S ribosomal protein S3 OS=Methanoregula boonei (strain 6A8) GN=rps3 PE=3 SV=1 12 229 6.0E-30
sp|A1RXG6|RS3_THEPD 30S ribosomal protein S3 OS=Thermofilum pendens (strain Hrk 5) GN=rps3 PE=3 SV=2 12 213 8.0E-30
sp|P15009|RS3_HALSA 30S ribosomal protein S3 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps3 PE=3 SV=3 8 223 9.0E-30
sp|Q18GF5|RS3_HALWD 30S ribosomal protein S3 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps3 PE=3 SV=1 8 228 9.0E-30
sp|Q6LXE7|RS3_METMP 30S ribosomal protein S3 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps3 PE=3 SV=1 12 213 1.0E-29
sp|Q2NFW2|RS3_METST 30S ribosomal protein S3 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps3 PE=3 SV=1 12 229 1.0E-29
sp|C6A165|RS3_THESM 30S ribosomal protein S3 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rps3 PE=3 SV=1 12 221 2.0E-29
sp|A5UL83|RS3_METS3 30S ribosomal protein S3 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps3 PE=3 SV=1 12 217 3.0E-29
sp|A6UWU3|RS3_META3 30S ribosomal protein S3 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps3 PE=3 SV=1 12 222 1.0E-28
sp|A6UQ49|RS3_METVS 30S ribosomal protein S3 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps3 PE=3 SV=1 12 214 2.0E-28
sp|Q2FT39|RS3_METHJ 30S ribosomal protein S3 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps3 PE=3 SV=1 12 209 2.0E-28
sp|A0B9W4|RS3_METTP 30S ribosomal protein S3 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps3 PE=3 SV=1 12 192 1.0E-27
sp|A8AA20|RS3_IGNH4 30S ribosomal protein S3 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps3 PE=3 SV=1 11 252 2.0E-26
sp|Q9UXA0|RS3_SULSO 30S ribosomal protein S3 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps3 PE=3 SV=1 11 213 6.0E-24
sp|O28360|RS3_ARCFU 30S ribosomal protein S3 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps3 PE=3 SV=1 12 209 2.0E-23
sp|Q4JB46|RS3_SULAC 30S ribosomal protein S3 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps3 PE=3 SV=1 11 193 5.0E-23
sp|A2BMC5|RS3_HYPBU 30S ribosomal protein S3 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps3 PE=3 SV=1 11 229 6.0E-22
sp|A3DNB3|RS3_STAMF 30S ribosomal protein S3 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps3 PE=3 SV=1 24 218 1.0E-21
sp|A3MTL3|RS3_PYRCJ 30S ribosomal protein S3 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps3 PE=3 SV=2 24 203 1.0E-20
sp|Q9YF78|RS3_AERPE 30S ribosomal protein S3 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps3 PE=3 SV=1 12 197 2.0E-20
sp|Q6L1C1|RS3_PICTO 30S ribosomal protein S3 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps3 PE=3 SV=1 10 241 4.0E-20
sp|Q975I7|RS3_SULTO 30S ribosomal protein S3 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps3 PE=3 SV=1 24 193 5.0E-20
sp|A1RV98|RS3_PYRIL 30S ribosomal protein S3 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps3 PE=3 SV=1 24 195 4.0E-19
sp|Q8ZWI0|RS3_PYRAE 30S ribosomal protein S3 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps3 PE=3 SV=2 1 191 8.0E-19
sp|Q8TX35|RS3_METKA 30S ribosomal protein S3 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps3 PE=3 SV=1 1 218 3.0E-18
sp|A4WIY8|RS3_PYRAR 30S ribosomal protein S3 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps3 PE=3 SV=2 24 195 1.0E-17
sp|A4YCX2|RS3_METS5 30S ribosomal protein S3 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rps3 PE=3 SV=1 11 193 2.0E-17
sp|Q9HIR5|RS3_THEAC 30S ribosomal protein S3 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps3 PE=3 SV=1 10 213 3.0E-17
sp|Q97BX1|RS3_THEVO 30S ribosomal protein S3 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps3 PE=3 SV=1 10 213 4.0E-17
sp|A0RVX9|RS3_CENSY 30S ribosomal protein S3 OS=Cenarchaeum symbiosum (strain A) GN=rps3 PE=3 SV=1 23 184 7.0E-15
sp|Q74MZ4|RS3_NANEQ 30S ribosomal protein S3 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps3 PE=3 SV=2 12 216 6.0E-11
sp|Q5NHW2|RS3_FRATT 30S ribosomal protein S3 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpsC PE=3 SV=1 11 206 2.0E-10
sp|Q14JB4|RS3_FRAT1 30S ribosomal protein S3 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpsC PE=3 SV=1 11 206 2.0E-10
sp|A0Q4I9|RS3_FRATN 30S ribosomal protein S3 OS=Francisella tularensis subsp. novicida (strain U112) GN=rpsC PE=3 SV=1 11 206 2.0E-10
sp|Q6KI49|RS3_MYCMO 30S ribosomal protein S3 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rpsC PE=3 SV=1 27 201 3.0E-10
sp|A4IZS8|RS3_FRATW 30S ribosomal protein S3 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpsC PE=3 SV=1 11 206 4.0E-10
sp|Q0BNS1|RS3_FRATO 30S ribosomal protein S3 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpsC PE=3 SV=1 11 206 4.0E-10
sp|Q2A5G4|RS3_FRATH 30S ribosomal protein S3 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpsC PE=3 SV=1 11 206 4.0E-10
sp|A7N9T2|RS3_FRATF 30S ribosomal protein S3 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rpsC PE=3 SV=1 11 206 4.0E-10
sp|B2SDX9|RS3_FRATM 30S ribosomal protein S3 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rpsC PE=3 SV=1 11 206 6.0E-10
sp|Q9RXJ6|RS3_DEIRA 30S ribosomal protein S3 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpsC PE=3 SV=1 23 200 7.0E-09
sp|A5VLJ9|RS3_LACRD 30S ribosomal protein S3 OS=Lactobacillus reuteri (strain DSM 20016) GN=rpsC PE=3 SV=1 13 194 4.0E-08
sp|Q88XY0|RS3_LACPL 30S ribosomal protein S3 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsC PE=3 SV=1 13 201 6.0E-08
sp|B9L6M7|RS3_NAUPA 30S ribosomal protein S3 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rpsC PE=3 SV=1 23 208 1.0E-07
sp|P80372|RS3_THET8 30S ribosomal protein S3 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsC PE=1 SV=3 27 194 1.0E-07
sp|P62663|RS3_THET2 30S ribosomal protein S3 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsC PE=1 SV=2 27 194 1.0E-07
sp|Q03ZN9|RS3_LEUMM 30S ribosomal protein S3 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpsC PE=3 SV=1 13 195 1.0E-07
sp|Q1IX78|RS3_DEIGD 30S ribosomal protein S3 OS=Deinococcus geothermalis (strain DSM 11300) GN=rpsC PE=3 SV=1 23 200 3.0E-07
sp|A8F991|RS3_BACP2 30S ribosomal protein S3 OS=Bacillus pumilus (strain SAFR-032) GN=rpsC PE=3 SV=1 23 194 3.0E-07
sp|B8E1D9|RS3_DICTD 30S ribosomal protein S3 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rpsC PE=3 SV=1 24 209 5.0E-07
sp|C1CXG0|RS3_DEIDV 30S ribosomal protein S3 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rpsC PE=3 SV=1 23 194 6.0E-07
sp|A5IYY0|RS3_MYCAP 30S ribosomal protein S3 OS=Mycoplasma agalactiae (strain PG2) GN=rpsC PE=3 SV=1 22 199 7.0E-07
sp|Q1WS96|RS3_LACS1 30S ribosomal protein S3 OS=Lactobacillus salivarius (strain UCC118) GN=rpsC PE=3 SV=1 13 194 7.0E-07
sp|C5D3S3|RS3_GEOSW 30S ribosomal protein S3 OS=Geobacillus sp. (strain WCH70) GN=rpsC PE=3 SV=1 23 194 8.0E-07
sp|P59186|RS3_STRMU 30S ribosomal protein S3 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpsC PE=3 SV=1 3 194 8.0E-07
sp|Q74L83|RS3_LACJO 30S ribosomal protein S3 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpsC PE=3 SV=1 13 205 8.0E-07
sp|B1MW08|RS3_LEUCK 30S ribosomal protein S3 OS=Leuconostoc citreum (strain KM20) GN=rpsC PE=3 SV=1 13 195 9.0E-07
sp|A4VSG0|RS3_STRSY 30S ribosomal protein S3 OS=Streptococcus suis (strain 05ZYH33) GN=rpsC PE=3 SV=1 3 194 1.0E-06
sp|A4VYP9|RS3_STRS2 30S ribosomal protein S3 OS=Streptococcus suis (strain 98HAH33) GN=rpsC PE=3 SV=1 3 194 1.0E-06
sp|A7Z0P4|RS3_BACMF 30S ribosomal protein S3 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpsC PE=3 SV=1 23 194 2.0E-06
sp|Q7M8E0|RS3_WOLSU 30S ribosomal protein S3 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpsC PE=3 SV=1 23 205 2.0E-06
sp|Q046B9|RS3_LACGA 30S ribosomal protein S3 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpsC PE=3 SV=1 13 205 2.0E-06
sp|Q04G79|RS3_OENOB 30S ribosomal protein S3 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpsC PE=3 SV=1 43 200 2.0E-06
sp|Q65PA1|RS3_BACLD 30S ribosomal protein S3 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpsC PE=3 SV=1 23 194 2.0E-06
sp|A8AZL9|RS3_STRGC 30S ribosomal protein S3 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpsC PE=3 SV=1 3 194 2.0E-06
sp|Q1RHM7|RS3_RICBR 30S ribosomal protein S3 OS=Rickettsia bellii (strain RML369-C) GN=rpsC PE=3 SV=1 17 200 3.0E-06
sp|A8GVC0|RS3_RICB8 30S ribosomal protein S3 OS=Rickettsia bellii (strain OSU 85-389) GN=rpsC PE=3 SV=1 17 200 3.0E-06
sp|Q9HWE1|RS3_PSEAE 30S ribosomal protein S3 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsC PE=3 SV=1 12 194 3.0E-06
sp|Q02T74|RS3_PSEAB 30S ribosomal protein S3 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsC PE=3 SV=1 12 194 3.0E-06
sp|A6UZJ4|RS3_PSEA7 30S ribosomal protein S3 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsC PE=3 SV=1 12 194 3.0E-06
sp|Q7MPI2|RS3_VIBVY 30S ribosomal protein S3 OS=Vibrio vulnificus (strain YJ016) GN=rpsC PE=3 SV=1 17 220 3.0E-06
sp|Q8DE45|RS3_VIBVU 30S ribosomal protein S3 OS=Vibrio vulnificus (strain CMCP6) GN=rpsC PE=3 SV=1 17 220 3.0E-06
sp|Q839F8|RS3_ENTFA 30S ribosomal protein S3 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpsC PE=3 SV=1 3 194 3.0E-06
sp|Q4FLM4|RS3_PELUB 30S ribosomal protein S3 OS=Pelagibacter ubique (strain HTCC1062) GN=rpsC PE=3 SV=1 17 194 3.0E-06
sp|O84527|RS3_CHLTR 30S ribosomal protein S3 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsC PE=3 SV=1 13 203 4.0E-06
sp|Q1IFW0|RS3_PSEE4 30S ribosomal protein S3 OS=Pseudomonas entomophila (strain L48) GN=rpsC PE=3 SV=1 14 194 4.0E-06
sp|P47403|RS3_MYCGE 30S ribosomal protein S3 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpsC PE=3 SV=2 38 194 4.0E-06
sp|Q88QM9|RS3_PSEPK 30S ribosomal protein S3 OS=Pseudomonas putida (strain KT2440) GN=rpsC PE=3 SV=2 14 194 4.0E-06
sp|A5VXQ3|RS3_PSEP1 30S ribosomal protein S3 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsC PE=3 SV=1 14 194 4.0E-06
sp|A3CK69|RS3_STRSV 30S ribosomal protein S3 OS=Streptococcus sanguinis (strain SK36) GN=rpsC PE=3 SV=1 3 194 4.0E-06
sp|B9DSV6|RS3_STRU0 30S ribosomal protein S3 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpsC PE=3 SV=1 3 194 4.0E-06
sp|A4VHN6|RS3_PSEU5 30S ribosomal protein S3 OS=Pseudomonas stutzeri (strain A1501) GN=rpsC PE=3 SV=1 14 194 6.0E-06
sp|B3PMP1|RS3_MYCA5 30S ribosomal protein S3 OS=Mycoplasma arthritidis (strain 158L3-1) GN=rpsC PE=3 SV=1 2 194 6.0E-06
sp|Q03PW3|RS3_LACBA 30S ribosomal protein S3 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpsC PE=3 SV=1 13 194 6.0E-06
sp|Q4A5C7|RS3_MYCS5 30S ribosomal protein S3 OS=Mycoplasma synoviae (strain 53) GN=rpsC PE=3 SV=1 61 199 6.0E-06
sp|Q03IF7|RS3_STRTD 30S ribosomal protein S3 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpsC PE=3 SV=1 3 194 7.0E-06
sp|A8GPE4|RS3_RICAH 30S ribosomal protein S3 OS=Rickettsia akari (strain Hartford) GN=rpsC PE=3 SV=1 17 200 7.0E-06
sp|Q6MJ20|RS3_BDEBA 30S ribosomal protein S3 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpsC PE=3 SV=1 24 194 7.0E-06
sp|B7GJ73|RS3_ANOFW 30S ribosomal protein S3 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpsC PE=3 SV=1 23 194 8.0E-06
sp|C0MCB6|RS3_STRS7 30S ribosomal protein S3 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpsC PE=3 SV=1 3 194 8.0E-06
sp|B4U506|RS3_STREM 30S ribosomal protein S3 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rpsC PE=3 SV=1 3 194 8.0E-06
sp|C0M8D5|RS3_STRE4 30S ribosomal protein S3 OS=Streptococcus equi subsp. equi (strain 4047) GN=rpsC PE=3 SV=1 3 194 8.0E-06
sp|Q65QW1|RS3_MANSM 30S ribosomal protein S3 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsC PE=3 SV=2 17 194 8.0E-06
sp|A4IJJ5|RS3_GEOTN 30S ribosomal protein S3 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpsC PE=3 SV=1 23 194 9.0E-06
sp|Q5M2B9|RS3_STRT2 30S ribosomal protein S3 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpsC PE=3 SV=1 3 194 9.0E-06
sp|Q5LXR7|RS3_STRT1 30S ribosomal protein S3 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpsC PE=3 SV=1 3 194 9.0E-06
sp|A2BTD1|RS3_PROMS 30S ribosomal protein S3 OS=Prochlorococcus marinus (strain AS9601) GN=rpsC PE=3 SV=1 23 222 9.0E-06
sp|A3PF41|RS3_PROM0 30S ribosomal protein S3 OS=Prochlorococcus marinus (strain MIT 9301) GN=rpsC PE=3 SV=1 23 222 9.0E-06
sp|C3LRQ2|RS3_VIBCM 30S ribosomal protein S3 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsC PE=3 SV=1 17 220 9.0E-06
sp|Q9KNZ0|RS3_VIBCH 30S ribosomal protein S3 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsC PE=3 SV=1 17 220 9.0E-06
sp|A5F543|RS3_VIBC3 30S ribosomal protein S3 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsC PE=3 SV=1 17 220 9.0E-06
sp|Q2JV87|RS3_SYNJA 30S ribosomal protein S3 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rpsC PE=3 SV=1 11 208 9.0E-06
sp|C1CP94|RS3_STRZT 30S ribosomal protein S3 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpsC PE=3 SV=1 3 194 9.0E-06
sp|C1CIA3|RS3_STRZP 30S ribosomal protein S3 OS=Streptococcus pneumoniae (strain P1031) GN=rpsC PE=3 SV=1 3 194 9.0E-06
sp|C1CC12|RS3_STRZJ 30S ribosomal protein S3 OS=Streptococcus pneumoniae (strain JJA) GN=rpsC PE=3 SV=1 3 194 9.0E-06
sp|P0A4C4|RS3_STRR6 30S ribosomal protein S3 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsC PE=3 SV=1 3 194 9.0E-06
sp|B2IS46|RS3_STRPS 30S ribosomal protein S3 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpsC PE=3 SV=1 3 194 9.0E-06
sp|P0A4C3|RS3_STRPN 30S ribosomal protein S3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsC PE=3 SV=1 3 194 9.0E-06
sp|B8ZKG3|RS3_STRPJ 30S ribosomal protein S3 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpsC PE=3 SV=1 3 194 9.0E-06
sp|B1I8K4|RS3_STRPI 30S ribosomal protein S3 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpsC PE=3 SV=1 3 194 9.0E-06
sp|C1CAL8|RS3_STRP7 30S ribosomal protein S3 OS=Streptococcus pneumoniae (strain 70585) GN=rpsC PE=3 SV=1 3 194 9.0E-06
sp|B5E6G1|RS3_STRP4 30S ribosomal protein S3 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpsC PE=3 SV=1 3 194 9.0E-06
sp|Q04MN0|RS3_STRP2 30S ribosomal protein S3 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsC PE=3 SV=1 3 194 9.0E-06
sp|P55827|RS3_AGGAC 30S ribosomal protein S3 OS=Aggregatibacter actinomycetemcomitans GN=rpsC PE=3 SV=2 23 194 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0003723 RNA binding Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043604 amide biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0044267 cellular protein metabolic process No
GO:0005488 binding No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0005198 structural molecule activity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:1990904 ribonucleoprotein complex No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043043 peptide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2334
MAHPGSQISKRRKFVADGVFYAELNEFFQRELAEEGYSGVEVRVTPTVTDIIIRATHTQEVLGEQGRRIRELTSL
IQKRFKFPENSVSLYAAKVQNRGLSAVAQCESLRYKLLNGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRAARA
KSMKFTDGFMIHSGQPAKDFIDSATRHVLLRQGVLGIKVKIMRGSDPEGKAGPQKSLPDAVTIIEPKEEQTVVQP
ISQDYGAKAAQAQASQDARVAEQEGEEEPAAEQ*
Coding >Hirsu2|2334
ATGGCGCACCCCGGTTCCCAAATCTCCAAACGGAGAAAGTTCGTCGCCGACGGCGTCTTCTACGCCGAGCTCAAC
GAGTTCTTCCAGCGTGAGCTCGCGGAGGAGGGCTACTCGGGCGTCGAGGTCCGCGTCACACCGACCGTGACCGAT
ATCATCATCCGCGCGACGCACACGCAGGAGGTGCTGGGCGAGCAGGGCCGCCGGATTCGCGAGCTCACGTCGCTC
ATCCAGAAGCGCTTCAAGTTCCCCGAGAACTCCGTCTCCCTCTACGCCGCCAAGGTGCAGAACCGCGGCCTGTCA
GCCGTCGCCCAGTGCGAGTCGCTCCGCTACAAGCTGCTCAATGGCCTGGCCGTCCGCCGCGCCTGCTACGGCGTC
CTCCGCTTCATCATGGAGAGCGGCGCCAAGGGCTGCGAGGTGGTCGTCTCCGGCAAGCTCCGCGCCGCCCGCGCC
AAGAGCATGAAGTTCACCGACGGCTTCATGATCCATTCGGGCCAGCCGGCCAAGGACTTCATTGACTCGGCCACG
CGCCACGTTCTGCTCCGCCAGGGCGTGCTCGGCATCAAGGTCAAGATCATGCGTGGCTCCGACCCCGAGGGCAAG
GCTGGCCCCCAGAAGTCCCTGCCCGACGCCGTCACCATCATCGAGCCCAAGGAGGAGCAGACGGTCGTTCAGCCC
ATCAGCCAGGACTACGGCGCTAAGGCCGCCCAAGCCCAGGCCAGCCAGGACGCGCGGGTGGCCGAGCAGGAGGGC
GAGGAGGAGCCGGCCGCCGAGCAATAA
Transcript >Hirsu2|2334
ATGGCGCACCCCGGTTCCCAAATCTCCAAACGGAGAAAGTTCGTCGCCGACGGCGTCTTCTACGCCGAGCTCAAC
GAGTTCTTCCAGCGTGAGCTCGCGGAGGAGGGCTACTCGGGCGTCGAGGTCCGCGTCACACCGACCGTGACCGAT
ATCATCATCCGCGCGACGCACACGCAGGAGGTGCTGGGCGAGCAGGGCCGCCGGATTCGCGAGCTCACGTCGCTC
ATCCAGAAGCGCTTCAAGTTCCCCGAGAACTCCGTCTCCCTCTACGCCGCCAAGGTGCAGAACCGCGGCCTGTCA
GCCGTCGCCCAGTGCGAGTCGCTCCGCTACAAGCTGCTCAATGGCCTGGCCGTCCGCCGCGCCTGCTACGGCGTC
CTCCGCTTCATCATGGAGAGCGGCGCCAAGGGCTGCGAGGTGGTCGTCTCCGGCAAGCTCCGCGCCGCCCGCGCC
AAGAGCATGAAGTTCACCGACGGCTTCATGATCCATTCGGGCCAGCCGGCCAAGGACTTCATTGACTCGGCCACG
CGCCACGTTCTGCTCCGCCAGGGCGTGCTCGGCATCAAGGTCAAGATCATGCGTGGCTCCGACCCCGAGGGCAAG
GCTGGCCCCCAGAAGTCCCTGCCCGACGCCGTCACCATCATCGAGCCCAAGGAGGAGCAGACGGTCGTTCAGCCC
ATCAGCCAGGACTACGGCGCTAAGGCCGCCCAAGCCCAGGCCAGCCAGGACGCGCGGGTGGCCGAGCAGGAGGGC
GAGGAGGAGCCGGCCGCCGAGCAATAA
Gene >Hirsu2|2334
ATGGCGCACCCCGGTTCCCAAATGTGAGTCCTCTCTTTCGACGTGGAGCCGCTCTCACTCCCCCTGGTCTGCCGA
ATCGCCAAATCGATCGCCGCCGTGGTGTCTCCCAAGAGGGGGGGCAAGGCCATGTCGAAGGGGGTGCGGGCGAAC
CGCAACGGGTGCGGCGCGGAAGAGAGACCGTCGGCGCACAATTGGTTGCTGGTTGGCTCGAGAGGCATTTTTACG
AGCGTAAGAATAAGAGAAAGGCCGCTGACCGAGAGTTTCTCGACATGGCACAGCTCCAAACGGAGAAAGTTCGTC
GCCGACGGCGTCTTCTACGCCGAGCTCAACGAGTTCTTCCAGCGTGAGCTCGCGGAGGAGGGCTACTCGGGCGTC
GAGGTCCGCGTCACACCGACCGTGACCGATATCATCATCCGCGCGACGCACACGCAGGAGGTGCTGGGCGAGCAG
GGCCGCCGGATTCGCGAGCTCACGTCGCTCATCCAGAAGCGCTTCAAGTTCCCCGAGAACTCCGTCTCCCTCTAC
GCCGCCAAGGTGCAGAACCGCGGCCTGTCAGCCGTCGCCCAGTGCGAGTCGCTCCGCTACAAGCTGCTCAATGGC
CTGGCCGTCCGCCGCGCCTGCTACGGCGTCCTCCGCTTCATCATGGAGAGCGGCGCCAAGGGCTGCGAGGTGGTC
GTCTCCGGCAAGCTCCGCGCCGCCCGCGCCAAGAGCATGAAGTTCACCGACGGCTTCATGATCCATTCGGGCCAG
CCGGCCAAGGACTTCATTGACTCGGCCACGCGCCACGTTCTGCTCCGCCAGGGCGTGCTCGGCATCAAGGTCAAG
ATCATGCGTGGCTCCGACCCCGAGGGCAAGGCTGGCCCCCAGAAGTCCCTGCCCGACGCCGTCACCATCATCGAG
CCCAAGGAGGAGCAGACGGTCGTTCAGCCCATCAGCCAGGACTACGGCGCTAAGGCCGCCCAAGCCCAGGCCAGC
CAGGACGCGCGGGTGGCCGAGCAGGAGGGCGAGGAGGAGCCGGCCGCCGAGCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail