Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2331
Gene name
LocationContig_1551:82..1310
Strand-
Gene length (bp)1228
Transcript length (bp)699
Coding sequence length (bp)699
Protein length (aa) 233

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00743 FMO-like Flavin-binding monooxygenase-like 5.0E-49 5 215
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 1.5E-15 8 209
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.0E-12 5 214
PF13434 Lys_Orn_oxgnase L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase 9.3E-08 87 201
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.5E-05 8 44

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 1 230 2.0E-46
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 5 211 2.0E-46
sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=1 SV=4 1 230 3.0E-45
sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 1 231 3.0E-44
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 5 230 7.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 1 230 2.0E-46
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 5 211 2.0E-46
sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=1 SV=4 1 230 3.0E-45
sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 1 231 3.0E-44
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 5 230 7.0E-44
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 5 230 2.0E-42
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 5 230 6.0E-42
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 5 230 1.0E-41
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 5 230 1.0E-41
sp|Q8K4B7|FMO4_RAT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Rattus norvegicus GN=Fmo4 PE=2 SV=3 5 211 1.0E-41
sp|Q6IRI9|FMO2_RAT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Rattus norvegicus GN=Fmo2 PE=2 SV=3 5 230 2.0E-41
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 5 230 3.0E-41
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 5 230 4.0E-41
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 5 230 1.0E-40
sp|Q01740|FMO1_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Homo sapiens GN=FMO1 PE=2 SV=3 5 230 1.0E-39
sp|Q8VHG0|FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus GN=Fmo4 PE=1 SV=3 5 211 1.0E-39
sp|P31512|FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens GN=FMO4 PE=1 SV=3 5 211 2.0E-39
sp|P49326|FMO5_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Homo sapiens GN=FMO5 PE=1 SV=2 1 211 5.0E-39
sp|P36367|FMO4_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Oryctolagus cuniculus GN=FMO4 PE=2 SV=2 5 230 1.0E-37
sp|Q9EQ76|FMO3_RAT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Rattus norvegicus GN=Fmo3 PE=1 SV=1 3 230 2.0E-37
sp|Q95LA2|FMO1_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Canis lupus familiaris GN=FMO1 PE=2 SV=3 5 230 6.0E-37
sp|P17636|FMO1_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Oryctolagus cuniculus GN=FMO1 PE=1 SV=3 5 230 2.0E-36
sp|P16549|FMO1_PIG Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Sus scrofa GN=FMO1 PE=1 SV=3 5 230 2.0E-35
sp|P97501|FMO3_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Mus musculus GN=Fmo3 PE=1 SV=1 3 211 1.0E-34
sp|Q8SPQ7|FMO3_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Macaca mulatta GN=FMO3 PE=2 SV=3 5 216 5.0E-34
sp|O60774|FMO6_HUMAN Putative dimethylaniline monooxygenase [N-oxide-forming] 6 OS=Homo sapiens GN=FMO6P PE=5 SV=1 5 209 6.0E-34
sp|P36365|FMO1_RAT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Rattus norvegicus GN=Fmo1 PE=1 SV=2 5 230 7.0E-34
sp|P50285|FMO1_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Mus musculus GN=Fmo1 PE=1 SV=1 5 230 3.0E-33
sp|Q95LA1|FMO3_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis lupus familiaris GN=FMO3 PE=2 SV=3 5 211 5.0E-33
sp|Q9SXD5|GSXL3_ARATH Flavin-containing monooxygenase FMO GS-OX-like 3 OS=Arabidopsis thaliana GN=At1g62620 PE=2 SV=2 5 209 1.0E-28
sp|Q9FWW6|GSXL1_ARATH Flavin-containing monooxygenase FMO GS-OX-like 1 OS=Arabidopsis thaliana GN=At1g12160 PE=2 SV=1 5 207 3.0E-28
sp|Q8VZ59|YUC6_ARATH Indole-3-pyruvate monooxygenase YUCCA6 OS=Arabidopsis thaliana GN=YUC6 PE=1 SV=1 7 202 1.0E-27
sp|Q8HYJ9|FMO3_BOVIN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Bos taurus GN=FMO3 PE=2 SV=1 5 211 4.0E-27
sp|Q9C8U0|GSXL5_ARATH Flavin-containing monooxygenase FMO GS-OX-like 5 OS=Arabidopsis thaliana GN=At1g63370 PE=2 SV=2 5 209 4.0E-27
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 7 202 9.0E-27
sp|P31513|FMO3_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Homo sapiens GN=FMO3 PE=1 SV=5 5 230 1.0E-26
sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 5 209 1.0E-26
sp|Q7YS44|FMO3_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Pan troglodytes GN=FMO3 PE=3 SV=3 5 211 1.0E-26
sp|Q9SS04|GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana GN=FMOGS-OX1 PE=2 SV=1 5 209 2.0E-26
sp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA9 OS=Arabidopsis thaliana GN=YUC9 PE=2 SV=1 7 202 4.0E-26
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 7 202 4.0E-26
sp|P32417|FMO3_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Oryctolagus cuniculus GN=FMO3 PE=1 SV=3 5 216 5.0E-26
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 7 202 6.0E-26
sp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=2 SV=1 7 203 2.0E-24
sp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=1 SV=1 8 210 6.0E-24
sp|Q9FWW9|GSXL2_ARATH Flavin-containing monooxygenase FMO GS-OX-like 2 OS=Arabidopsis thaliana GN=At1g12200 PE=2 SV=1 5 209 3.0E-23
sp|Q9FWW3|GSXL6_ARATH Flavin-containing monooxygenase FMO GS-OX-like 6 OS=Arabidopsis thaliana GN=At1g12130 PE=2 SV=1 6 205 7.0E-23
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 8 202 1.0E-22
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 8 203 3.0E-22
sp|Q94BV5|GSXL4_ARATH Flavin-containing monooxygenase FMO GS-OX-like 4 OS=Arabidopsis thaliana GN=At1g62600 PE=2 SV=1 5 209 8.0E-22
sp|Q94K43|GSOX2_ARATH Flavin-containing monooxygenase FMO GS-OX2 OS=Arabidopsis thaliana GN=FMOGS-OX2 PE=2 SV=1 5 209 1.0E-21
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 2 197 2.0E-21
sp|A8MRX0|GSOX5_ARATH Flavin-containing monooxygenase FMO GS-OX5 OS=Arabidopsis thaliana GN=FMOGS-OX5 PE=2 SV=2 1 209 4.0E-21
sp|Q93Y23|GSOX4_ARATH Flavin-containing monooxygenase FMO GS-OX4 OS=Arabidopsis thaliana GN=FMOGS-OX4 PE=2 SV=1 1 212 6.0E-21
sp|Q8MP06|SNO1_TYRJA Senecionine N-oxygenase OS=Tyria jacobaeae GN=sno1 PE=1 SV=1 5 207 2.0E-20
sp|Q9FF12|GSXL9_ARATH Flavin-containing monooxygenase FMO GS-OX-like 9 OS=Arabidopsis thaliana GN=At5g07800 PE=2 SV=1 5 209 1.0E-19
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 5 204 2.0E-19
sp|Q9FLK4|GSXL8_ARATH Flavin-containing monooxygenase FMO GS-OX-like 8 OS=Arabidopsis thaliana GN=At5g61290 PE=2 SV=1 6 209 4.0E-19
sp|Q9SXD9|GSXL7_ARATH Flavin-containing monooxygenase FMO GS-OX-like 7 OS=Arabidopsis thaliana GN=At1g62580 PE=3 SV=2 5 212 5.0E-19
sp|P55487|Y4ID_RHISN Uncharacterized monooxygenase y4iD OS=Rhizobium sp. (strain NGR234) GN=NGR_a03290 PE=3 SV=1 5 204 1.0E-18
sp|Q9FVQ0|YUC10_ARATH Probable indole-3-pyruvate monooxygenase YUCCA10 OS=Arabidopsis thaliana GN=YUC10 PE=2 SV=1 6 216 2.0E-18
sp|Q9C8T8|GSXLX_ARATH Putative flavin-containing monooxygenase FMO GS-OX-like 10 OS=Arabidopsis thaliana GN=At1g63340 PE=5 SV=3 5 212 1.0E-17
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 6 221 1.0E-17
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 6 221 1.0E-17
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 6 221 1.0E-17
sp|Q9LMA1|FMO1_ARATH Probable flavin-containing monooxygenase 1 OS=Arabidopsis thaliana GN=FMO1 PE=2 SV=1 5 198 2.0E-16
sp|Q9LPL3|YUC11_ARATH Probable indole-3-pyruvate monooxygenase YUCCA11 OS=Arabidopsis thaliana GN=YUC11 PE=2 SV=1 3 198 1.0E-12
sp|Q9I3H5|BVMO_PSEAE Baeyer-Villiger monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1538 PE=1 SV=1 5 204 4.0E-12
sp|Q9FKE7|FMO2_ARATH Putative flavin-containing monooxygenase 2 OS=Arabidopsis thaliana GN=FMO2 PE=3 SV=2 5 198 5.0E-12
sp|Q47PU3|PAMO_THEFY Phenylacetone monooxygenase OS=Thermobifida fusca (strain YX) GN=pamO PE=1 SV=1 2 205 6.0E-12
sp|A0R665|ETHA_MYCS2 FAD-containing monooxygenase EthA OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ethA PE=3 SV=1 6 210 7.0E-12
sp|Q9SH25|GSXLY_ARATH Putative flavin-containing monooxygenase FMO GS-OX-like 11 OS=Arabidopsis thaliana GN=At1g63390 PE=5 SV=1 6 123 1.0E-11
sp|Q9HFE4|FMO1_SCHPO Thiol-specific monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fmo1 PE=1 SV=1 5 211 3.0E-11
sp|A3U3H1|BVMO_OCEBH Baeyer-Villiger monooxygenase OS=Oceanicola batsensis (strain ATCC BAA-863 / DSM 15984 / HTCC2597) GN=OB2597_18631 PE=1 SV=1 8 221 3.0E-11
sp|P12015|CHMO_ACISP Cyclohexanone 1,2-monooxygenase OS=Acinetobacter sp. PE=1 SV=2 8 221 2.0E-10
sp|A7HU16|BVMO_PARL1 Baeyer-Villiger monooxygenase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=Plav_1781 PE=1 SV=1 8 204 1.0E-09
sp|Q8GAW0|CPMO_COMS9 Cyclopentanone 1,2-monooxygenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnB PE=1 SV=3 2 206 1.0E-09
sp|P38866|FMO1_YEAST Thiol-specific monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMO1 PE=1 SV=2 26 210 5.0E-08
sp|Q8U195|SUDHA_PYRFU Sulfide dehydrogenase subunit alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=sudA PE=1 SV=1 5 216 2.0E-07
sp|E3VWI7|PNTE_STRAE Pentalenolactone D synthase OS=Streptomyces arenae GN=pntE PE=1 SV=1 2 205 2.0E-07
sp|P9WNF9|ETHA_MYCTU FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ethA PE=1 SV=1 2 202 3.0E-07
sp|P9WNF8|ETHA_MYCTO FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ethA PE=3 SV=1 2 202 3.0E-07
sp|Q7TVI2|ETHA_MYCBO FAD-containing monooxygenase EthA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ethA PE=1 SV=1 2 202 3.0E-07
sp|Q88J44|BVMO_PSEPK Baeyer-Villiger monooxygenase OS=Pseudomonas putida (strain KT2440) GN=PP_2805 PE=1 SV=1 1 204 4.0E-07
sp|Q5L2G3|CZCO_GEOKA Uncharacterized oxidoreductase CzcO-like OS=Geobacillus kaustophilus (strain HTA426) GN=GK0582 PE=4 SV=1 4 198 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0050661 NADP binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0003824 catalytic activity No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0004497 monooxygenase activity No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2331
MDKVRIAVVGLGPAGLTALKNLREEGFDAVAFERRDQVGGVWSYSPDTSYTSVIRETVSNISKFVSGFSDFPMPK
EYPPYLSGSQVAEYFQSYARHFGLEPHIRFNSTVKRVTRDEARGAWRLRIAGPDGESDALFDKVVFGTGSETKAV
WPAMPGRDKFKGVVMHGQNYRSPAPLAGKRVLVVGIGNTACDVSLSLAGHAAALYQSYRRGRLMVTFWTGPCRAC
RSGWPTA*
Coding >Hirsu2|2331
ATGGACAAGGTCCGGATCGCAGTCGTCGGCCTCGGCCCGGCCGGCCTGACGGCCCTAAAGAACCTGCGCGAGGAG
GGCTTCGACGCCGTCGCCTTCGAGCGGCGCGACCAGGTCGGAGGCGTGTGGTCTTACAGCCCCGACACGAGCTAC
ACCTCCGTCATCCGCGAGACCGTCTCCAACATCAGCAAGTTTGTGTCGGGCTTCAGCGACTTTCCCATGCCCAAA
GAATACCCACCATATCTCTCCGGCTCGCAGGTGGCGGAATACTTCCAGTCGTACGCCCGCCACTTCGGGCTCGAG
CCGCACATCCGCTTCAACTCGACGGTCAAGAGGGTGACGCGGGACGAGGCCCGGGGCGCATGGCGGCTGCGGATC
GCCGGGCCGGACGGCGAGTCGGACGCCCTCTTCGACAAGGTCGTCTTCGGCACCGGCTCCGAGACCAAGGCCGTG
TGGCCGGCGATGCCGGGGCGGGACAAGTTCAAGGGCGTCGTCATGCACGGGCAGAACTACCGGAGTCCCGCGCCG
TTGGCCGGCAAGCGAGTGCTGGTCGTCGGCATCGGTAACACGGCATGCGACGTCTCGCTCAGCCTGGCGGGCCAT
GCGGCAGCGCTGTACCAGTCGTACCGGCGCGGGCGGCTGATGGTTACCTTCTGGACCGGGCCGTGCCGCGCCTGT
CGTTCTGGCTGGCCGACGGCCTGA
Transcript >Hirsu2|2331
ATGGACAAGGTCCGGATCGCAGTCGTCGGCCTCGGCCCGGCCGGCCTGACGGCCCTAAAGAACCTGCGCGAGGAG
GGCTTCGACGCCGTCGCCTTCGAGCGGCGCGACCAGGTCGGAGGCGTGTGGTCTTACAGCCCCGACACGAGCTAC
ACCTCCGTCATCCGCGAGACCGTCTCCAACATCAGCAAGTTTGTGTCGGGCTTCAGCGACTTTCCCATGCCCAAA
GAATACCCACCATATCTCTCCGGCTCGCAGGTGGCGGAATACTTCCAGTCGTACGCCCGCCACTTCGGGCTCGAG
CCGCACATCCGCTTCAACTCGACGGTCAAGAGGGTGACGCGGGACGAGGCCCGGGGCGCATGGCGGCTGCGGATC
GCCGGGCCGGACGGCGAGTCGGACGCCCTCTTCGACAAGGTCGTCTTCGGCACCGGCTCCGAGACCAAGGCCGTG
TGGCCGGCGATGCCGGGGCGGGACAAGTTCAAGGGCGTCGTCATGCACGGGCAGAACTACCGGAGTCCCGCGCCG
TTGGCCGGCAAGCGAGTGCTGGTCGTCGGCATCGGTAACACGGCATGCGACGTCTCGCTCAGCCTGGCGGGCCAT
GCGGCAGCGCTGTACCAGTCGTACCGGCGCGGGCGGCTGATGGTTACCTTCTGGACCGGGCCGTGCCGCGCCTGT
CGTTCTGGCTGGCCGACGGCCTGA
Gene >Hirsu2|2331
ATGGACAAGGTCCGGATCGCAGTCGTCGGCCTCGGTAACCGCCCCTGCCCGTCGCCCGCCCACGGCCACGGGGCC
CGACTGACAGCATCGTCCACAGGCCCGGCCGGCCTGACGGCCCTAAAGAACCTGCGCGAGGAGGGCTTCGACGCC
GTCGCCTTCGAGCGGCGCGACCAGGTCGGAGGCGTGTGGTCTTACAGCCCCGACACGAGCTACACCTCCGTCATC
CGCGAGACCGTCTCCAACATCAGCAAGTTTGTGGTGAGGACGAAGCCGCCGGGCCTCGCGGATGCTCGACGCTGA
CGTTGCCACCGCCAGTCGGGCTTCAGCGACTTTCCCATGCCCAAAGGTTCGTTGCACCACTTTACGAGTTGACGA
TGGGGGGCGGGGAAAGACGACGGAGGAAGAGAAAAGAAGAAAGGAAAAAATAAGATAAACCGATGGCGGGCCCTG
GCTAAGAAGAGATCCATCCTCTCTCTCGTCCGGCTCCCTCTAGAATACCCACCATATCTCTCCGGCTCGCAGGTG
GCGGAATACTTCCAGTCGTACGCCCGCCACTTCGGGCTCGAGCCGCACATCCGCTTCAACTCGACGGTCAAGAGG
GTGACGCGGGACGAGGCCCGGGGCGCATGGCGGCTGCGGATCGCCGGGCCGGACGGCGAGTCGGACGCCCTCTTC
GACAAGGTCGTCTTCGGCACCGGCTCCGAGACCAAGGCCGTGTGGCCGGCGATGCCGGGGCGGGACAAGTTCAAG
GGCGTCGTCATGCACGGGCAGAACTACCGGAGGTGCGTTTTTTTTTTGCTTCTGTTCCAAGCGGCAGTGACACAG
CATGGAGACGAGGGGAAGAAAAAACAAAGAAGATGGGCAGGAAAAAAAAAGAAACACAGGAGGACGCGGGCGCAA
AAAAAAAAGAAAACATAACAGGTCGTGGGCGGCGAGAGAATGCGGCTGACGACGTCATGGACGGGCCGGCCCTCC
AGTCCCGCGCCGTTGGCCGGCAAGCGAGTGCTGGTCGTCGGCATCGGTAACACGGCATGCGACGTCTCGCTCAGC
CTGGCGGGCCATGCGGCAGCGCTGTACCAGTCGTACCGGCGCGGGCGGCTGATGGTGTCGCGCTACCTCGACGAC
GGCGTGCCGACCGACAGCACGATCCCGTGGCCGGCGCTACGGCTCAAGTACCTTCTGGACCGGGCCGTGCCGCGC
CTGTCGTTCTGGCTGGCCGACGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail