Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2325
Gene name
LocationContig_155:11187..13158
Strand-
Gene length (bp)1971
Transcript length (bp)1971
Coding sequence length (bp)1971
Protein length (aa) 657

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AQ27|A6334_ARTBC Putative secreted metallopeptidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_06334 PE=1 SV=1 19 655 0.0E+00

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2325
MAAAVLLAAVPLGACGAGPFDIIDRQDWVNPDNMTWADFKPAPGTTWNDASRKGSVRNFDIALITVDYRDKPFVV
TRPPNSTIFGNPLPIAANIARKNVPAFYRDLLNKPTRLNRGHTLHEYWMQDSAGLFGVDLTAYGVYRLPSLSYQY
GVDSWKNPGACPPGPPCDVDIRADALEMWRRDVGNETADRFELVFILSAGQDESSSWQEFGEMKFGSKEDVPDSF
GPPRGPGGNASLPNYAATRYVEWTSWAAAASLWPNALGGSTIQCESSGMSTYAHELSHLLHIRDNYNNPYGHPLR
RSFTGPWSMLSRGSFNGPGGPHTRWQIPALQGGAMGSLHTMRDKNQLGLLANNSMMRISRAALARAGPVVARITA
RAVVSDLMGVRVEMDGDRSPRCDIAKDVLCDGGGYNNYEVEVVARMGADSFQPDSGVMISKTKDIDREPFQWTID
ANPQDIQLVDFYRPNGTVAMVTMGDYRQLADALFHAGTRSGSEFEYVDAPNGLHFYIAQKHLDRDGVLSYTIGIR
SLNSTDRSRHGVRLSAGKARTGGQDKPTGRGALCSFDLTNSGTPSGHHSHQPHSAALGSEIYRLRAEVEGSGWRV
EVRNALAVARFGETVCVDVAVGALADAADTGTVTLTASSESDSSVKAVARCEVAKA*
Coding >Hirsu2|2325
ATGGCGGCCGCCGTGCTGCTCGCCGCCGTGCCGCTCGGGGCGTGCGGCGCCGGCCCGTTCGACATCATTGACCGG
CAAGACTGGGTGAACCCGGACAACATGACCTGGGCCGACTTCAAGCCGGCTCCGGGCACGACATGGAACGATGCC
TCGCGCAAAGGCTCCGTCCGCAACTTCGACATCGCCCTCATCACCGTCGACTACCGAGACAAGCCCTTTGTCGTG
ACCCGGCCGCCCAACTCGACCATCTTCGGCAATCCCCTTCCTATCGCGGCCAACATTGCTCGCAAAAATGTGCCG
GCCTTTTATCGCGACTTGCTCAACAAGCCCACACGCCTCAACCGCGGCCACACCCTTCACGAGTACTGGATGCAG
GACTCGGCCGGCCTCTTCGGCGTCGACCTGACGGCATACGGCGTCTACCGCCTGCCCTCGCTCTCCTACCAGTAC
GGGGTGGACAGTTGGAAGAACCCCGGGGCCTGTCCTCCCGGGCCGCCCTGCGACGTCGACATCCGCGCAGACGCG
CTCGAGATGTGGCGCCGAGACGTGGGCAACGAGACAGCTGACCGCTTCGAGCTGGTCTTCATCCTTTCGGCCGGC
CAGGACGAGTCGTCCTCGTGGCAAGAGTTCGGGGAAATGAAATTCGGCTCCAAGGAGGACGTGCCCGATTCTTTC
GGCCCGCCTCGAGGCCCCGGCGGAAACGCCTCGCTGCCCAACTACGCCGCGACTCGGTATGTCGAGTGGACGTCG
TGGGCCGCCGCCGCCAGCCTCTGGCCGAACGCCCTGGGCGGCTCGACGATCCAGTGCGAAAGCTCGGGGATGAGC
ACGTACGCGCACGAACTGAGCCATCTGCTCCACATCCGAGACAACTACAACAACCCCTATGGCCACCCTCTGCGC
CGCTCGTTCACCGGGCCATGGTCGATGCTGTCTCGCGGGTCCTTCAACGGCCCGGGAGGGCCGCACACCCGCTGG
CAAATCCCGGCGCTTCAGGGCGGAGCCATGGGCTCCCTCCACACGATGCGCGACAAGAACCAGCTCGGGCTCCTC
GCGAACAACAGCATGATGAGGATCTCGAGGGCGGCCTTGGCCCGGGCGGGACCCGTCGTGGCTCGGATCACGGCG
CGGGCCGTGGTGTCGGATCTGATGGGCGTGCGCGTCGAGATGGACGGCGACCGGTCGCCGCGTTGCGACATCGCC
AAGGACGTGCTCTGCGACGGCGGAGGATACAACAACTACGAAGTAGAAGTCGTCGCCCGTATGGGTGCCGACTCC
TTCCAGCCCGACTCGGGCGTCATGATCAGCAAGACGAAGGACATCGACCGAGAGCCTTTCCAGTGGACCATCGAC
GCGAACCCGCAGGACATACAGCTCGTCGACTTCTACCGGCCCAACGGTACGGTAGCCATGGTCACCATGGGTGAC
TACCGTCAACTGGCAGATGCGCTGTTCCACGCCGGCACCCGTTCCGGTAGCGAGTTCGAGTACGTGGACGCGCCC
AACGGCCTCCACTTTTACATCGCCCAGAAGCACCTGGACAGGGACGGCGTCCTCTCGTACACGATCGGGATCCGC
TCGCTGAACAGCACCGACCGGAGCAGGCACGGCGTGCGGCTGTCCGCCGGCAAGGCGCGCACGGGCGGACAGGAC
AAGCCGACGGGCAGGGGGGCGCTCTGCTCTTTCGACCTCACCAACAGCGGCACGCCGTCGGGGCACCACAGTCAC
CAGCCACACTCGGCCGCTCTGGGGTCAGAGATATACCGACTGCGGGCCGAGGTCGAGGGCTCCGGGTGGCGGGTC
GAGGTCCGCAACGCACTGGCCGTGGCGAGGTTCGGCGAGACGGTCTGCGTCGACGTCGCGGTCGGCGCCTTGGCA
GACGCCGCGGACACGGGCACGGTAACGCTGACGGCCAGCTCCGAGTCGGACTCGAGTGTCAAGGCTGTGGCGAGG
TGCGAGGTGGCCAAGGCTTGA
Transcript >Hirsu2|2325
ATGGCGGCCGCCGTGCTGCTCGCCGCCGTGCCGCTCGGGGCGTGCGGCGCCGGCCCGTTCGACATCATTGACCGG
CAAGACTGGGTGAACCCGGACAACATGACCTGGGCCGACTTCAAGCCGGCTCCGGGCACGACATGGAACGATGCC
TCGCGCAAAGGCTCCGTCCGCAACTTCGACATCGCCCTCATCACCGTCGACTACCGAGACAAGCCCTTTGTCGTG
ACCCGGCCGCCCAACTCGACCATCTTCGGCAATCCCCTTCCTATCGCGGCCAACATTGCTCGCAAAAATGTGCCG
GCCTTTTATCGCGACTTGCTCAACAAGCCCACACGCCTCAACCGCGGCCACACCCTTCACGAGTACTGGATGCAG
GACTCGGCCGGCCTCTTCGGCGTCGACCTGACGGCATACGGCGTCTACCGCCTGCCCTCGCTCTCCTACCAGTAC
GGGGTGGACAGTTGGAAGAACCCCGGGGCCTGTCCTCCCGGGCCGCCCTGCGACGTCGACATCCGCGCAGACGCG
CTCGAGATGTGGCGCCGAGACGTGGGCAACGAGACAGCTGACCGCTTCGAGCTGGTCTTCATCCTTTCGGCCGGC
CAGGACGAGTCGTCCTCGTGGCAAGAGTTCGGGGAAATGAAATTCGGCTCCAAGGAGGACGTGCCCGATTCTTTC
GGCCCGCCTCGAGGCCCCGGCGGAAACGCCTCGCTGCCCAACTACGCCGCGACTCGGTATGTCGAGTGGACGTCG
TGGGCCGCCGCCGCCAGCCTCTGGCCGAACGCCCTGGGCGGCTCGACGATCCAGTGCGAAAGCTCGGGGATGAGC
ACGTACGCGCACGAACTGAGCCATCTGCTCCACATCCGAGACAACTACAACAACCCCTATGGCCACCCTCTGCGC
CGCTCGTTCACCGGGCCATGGTCGATGCTGTCTCGCGGGTCCTTCAACGGCCCGGGAGGGCCGCACACCCGCTGG
CAAATCCCGGCGCTTCAGGGCGGAGCCATGGGCTCCCTCCACACGATGCGCGACAAGAACCAGCTCGGGCTCCTC
GCGAACAACAGCATGATGAGGATCTCGAGGGCGGCCTTGGCCCGGGCGGGACCCGTCGTGGCTCGGATCACGGCG
CGGGCCGTGGTGTCGGATCTGATGGGCGTGCGCGTCGAGATGGACGGCGACCGGTCGCCGCGTTGCGACATCGCC
AAGGACGTGCTCTGCGACGGCGGAGGATACAACAACTACGAAGTAGAAGTCGTCGCCCGTATGGGTGCCGACTCC
TTCCAGCCCGACTCGGGCGTCATGATCAGCAAGACGAAGGACATCGACCGAGAGCCTTTCCAGTGGACCATCGAC
GCGAACCCGCAGGACATACAGCTCGTCGACTTCTACCGGCCCAACGGTACGGTAGCCATGGTCACCATGGGTGAC
TACCGTCAACTGGCAGATGCGCTGTTCCACGCCGGCACCCGTTCCGGTAGCGAGTTCGAGTACGTGGACGCGCCC
AACGGCCTCCACTTTTACATCGCCCAGAAGCACCTGGACAGGGACGGCGTCCTCTCGTACACGATCGGGATCCGC
TCGCTGAACAGCACCGACCGGAGCAGGCACGGCGTGCGGCTGTCCGCCGGCAAGGCGCGCACGGGCGGACAGGAC
AAGCCGACGGGCAGGGGGGCGCTCTGCTCTTTCGACCTCACCAACAGCGGCACGCCGTCGGGGCACCACAGTCAC
CAGCCACACTCGGCCGCTCTGGGGTCAGAGATATACCGACTGCGGGCCGAGGTCGAGGGCTCCGGGTGGCGGGTC
GAGGTCCGCAACGCACTGGCCGTGGCGAGGTTCGGCGAGACGGTCTGCGTCGACGTCGCGGTCGGCGCCTTGGCA
GACGCCGCGGACACGGGCACGGTAACGCTGACGGCCAGCTCCGAGTCGGACTCGAGTGTCAAGGCTGTGGCGAGG
TGCGAGGTGGCCAAGGCTTGA
Gene >Hirsu2|2325
ATGGCGGCCGCCGTGCTGCTCGCCGCCGTGCCGCTCGGGGCGTGCGGCGCCGGCCCGTTCGACATCATTGACCGG
CAAGACTGGGTGAACCCGGACAACATGACCTGGGCCGACTTCAAGCCGGCTCCGGGCACGACATGGAACGATGCC
TCGCGCAAAGGCTCCGTCCGCAACTTCGACATCGCCCTCATCACCGTCGACTACCGAGACAAGCCCTTTGTCGTG
ACCCGGCCGCCCAACTCGACCATCTTCGGCAATCCCCTTCCTATCGCGGCCAACATTGCTCGCAAAAATGTGCCG
GCCTTTTATCGCGACTTGCTCAACAAGCCCACACGCCTCAACCGCGGCCACACCCTTCACGAGTACTGGATGCAG
GACTCGGCCGGCCTCTTCGGCGTCGACCTGACGGCATACGGCGTCTACCGCCTGCCCTCGCTCTCCTACCAGTAC
GGGGTGGACAGTTGGAAGAACCCCGGGGCCTGTCCTCCCGGGCCGCCCTGCGACGTCGACATCCGCGCAGACGCG
CTCGAGATGTGGCGCCGAGACGTGGGCAACGAGACAGCTGACCGCTTCGAGCTGGTCTTCATCCTTTCGGCCGGC
CAGGACGAGTCGTCCTCGTGGCAAGAGTTCGGGGAAATGAAATTCGGCTCCAAGGAGGACGTGCCCGATTCTTTC
GGCCCGCCTCGAGGCCCCGGCGGAAACGCCTCGCTGCCCAACTACGCCGCGACTCGGTATGTCGAGTGGACGTCG
TGGGCCGCCGCCGCCAGCCTCTGGCCGAACGCCCTGGGCGGCTCGACGATCCAGTGCGAAAGCTCGGGGATGAGC
ACGTACGCGCACGAACTGAGCCATCTGCTCCACATCCGAGACAACTACAACAACCCCTATGGCCACCCTCTGCGC
CGCTCGTTCACCGGGCCATGGTCGATGCTGTCTCGCGGGTCCTTCAACGGCCCGGGAGGGCCGCACACCCGCTGG
CAAATCCCGGCGCTTCAGGGCGGAGCCATGGGCTCCCTCCACACGATGCGCGACAAGAACCAGCTCGGGCTCCTC
GCGAACAACAGCATGATGAGGATCTCGAGGGCGGCCTTGGCCCGGGCGGGACCCGTCGTGGCTCGGATCACGGCG
CGGGCCGTGGTGTCGGATCTGATGGGCGTGCGCGTCGAGATGGACGGCGACCGGTCGCCGCGTTGCGACATCGCC
AAGGACGTGCTCTGCGACGGCGGAGGATACAACAACTACGAAGTAGAAGTCGTCGCCCGTATGGGTGCCGACTCC
TTCCAGCCCGACTCGGGCGTCATGATCAGCAAGACGAAGGACATCGACCGAGAGCCTTTCCAGTGGACCATCGAC
GCGAACCCGCAGGACATACAGCTCGTCGACTTCTACCGGCCCAACGGTACGGTAGCCATGGTCACCATGGGTGAC
TACCGTCAACTGGCAGATGCGCTGTTCCACGCCGGCACCCGTTCCGGTAGCGAGTTCGAGTACGTGGACGCGCCC
AACGGCCTCCACTTTTACATCGCCCAGAAGCACCTGGACAGGGACGGCGTCCTCTCGTACACGATCGGGATCCGC
TCGCTGAACAGCACCGACCGGAGCAGGCACGGCGTGCGGCTGTCCGCCGGCAAGGCGCGCACGGGCGGACAGGAC
AAGCCGACGGGCAGGGGGGCGCTCTGCTCTTTCGACCTCACCAACAGCGGCACGCCGTCGGGGCACCACAGTCAC
CAGCCACACTCGGCCGCTCTGGGGTCAGAGATATACCGACTGCGGGCCGAGGTCGAGGGCTCCGGGTGGCGGGTC
GAGGTCCGCAACGCACTGGCCGTGGCGAGGTTCGGCGAGACGGTCTGCGTCGACGTCGCGGTCGGCGCCTTGGCA
GACGCCGCGGACACGGGCACGGTAACGCTGACGGCCAGCTCCGAGTCGGACTCGAGTGTCAAGGCTGTGGCGAGG
TGCGAGGTGGCCAAGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail