Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2310
Gene name
LocationContig_1545:133..2861
Strand+
Gene length (bp)2728
Transcript length (bp)2508
Coding sequence length (bp)2508
Protein length (aa) 836

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08314 Sec39 Secretory pathway protein Sec39 2.7E-209 12 784

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14266|SEC39_SCHPO Protein transport protein sec39 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec39 PE=3 SV=1 483 687 4.0E-10

GO

GO Term Description Terminal node
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0048193 Golgi vesicle transport No
GO:0016192 vesicle-mediated transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2310
MGNSLTPTKIALLAAHLAVYADVNGLRWLISEHSATFSKALLLRILLTYLPETLQPGAYLLLLKDISVNDIAKCH
RSEPDISWINALSDHQALRRARKLRLARLRCLNTAQDQFDLLSTFLVQKAFRIDSEAGVLSYVPDFLVPLLHHSP
ALSTRIVATVLPFARRNVQYYLEIAPAHSLVQFQSLAGPDAVDYLLSRSGGPKFAQSSVVRDLRGLIGPWLCDSA
RWESAAGDQMAPVGESRSSFCSGWEQTLSWLTTQAKLSWDETVGVIEHWDGPADIDLGPGIKPQLSDEKQRYLDH
TYASALLGMAYCMQDATLESLSGAYRVCAKARLLLGHGQGDLSLRDVLLQESLPDMSTVDTTVGAKAIGLIRRFS
QQSWNNCSVAVDQSITDLLMALITSALVLSRLGMPYTVRKVGDLAFAQDDLEQKAEVAKLLHAISSSAHQDHDEH
WIKCRRDILWLRDWGRTTNPATATTATAVLGAVSKEFLESELLKALLSRSRYNLARALFEERAETILAPTRIREL
VLQAALHAFDNASELDRTRGGLKRCGDIIRAFPVTVGDSSPGPQRIWALLRAIHILSRYQVVVQPGEPFSPVVLR
AHPDPIEIINKILQQNPKAYTRLQEFLEMGIDIIQAGLLPHTRADQVHLGSDTHLYIAGQRITAMCVEAALKEDD
FETAYSYVVSRLGLHSLQDPRSCYDKWSWAAASRAGQHVLDARSEQPTHLSNAGGDIEIRHLEQRLECLATSLRL
APTSQVHDILKAFRRCEEQFDSAVMGEMIKEAAWDATHKATVCATARQAEEYHCSLQFAKIRFSGRASQFRAYPA
GTEDQEKRPT*
Coding >Hirsu2|2310
ATGGGCAATTCGCTGACTCCTACCAAGATAGCACTCTTGGCTGCACACTTAGCTGTTTATGCTGATGTGAATGGC
CTTCGCTGGCTAATTAGCGAGCATTCGGCTACCTTTTCCAAGGCTTTGCTCCTACGCATTTTGCTCACGTACCTG
CCGGAGACATTACAACCGGGTGCATACTTATTGCTCCTGAAGGACATCTCTGTCAATGACATCGCCAAGTGCCAT
CGGTCTGAGCCTGATATTTCTTGGATCAACGCCCTGTCTGATCACCAGGCATTGCGGAGGGCCAGGAAGCTACGA
CTCGCTCGTCTCAGGTGTCTCAATACTGCGCAGGACCAATTTGATCTGCTTAGCACGTTTCTGGTCCAAAAAGCG
TTCCGAATAGACTCGGAAGCAGGAGTGCTGTCCTACGTCCCTGACTTTCTGGTCCCTCTTCTTCATCATTCCCCC
GCGCTGTCCACACGTATCGTTGCGACGGTTTTGCCGTTTGCGAGGAGGAATGTGCAATACTACCTTGAGATTGCA
CCAGCTCACTCACTCGTTCAGTTTCAGAGCCTGGCTGGACCAGATGCCGTGGACTATCTTCTGTCTCGCAGTGGC
GGGCCTAAATTTGCTCAGAGCTCTGTCGTTCGGGACCTCAGAGGGCTCATAGGACCGTGGCTGTGTGACAGCGCC
CGTTGGGAGTCAGCGGCTGGAGATCAGATGGCTCCCGTTGGGGAATCACGGTCCTCTTTTTGCTCCGGCTGGGAA
CAGACTTTGAGCTGGCTTACGACCCAGGCCAAATTATCATGGGATGAGACAGTCGGTGTAATCGAACATTGGGAT
GGGCCGGCTGACATTGATCTTGGCCCCGGAATCAAACCGCAGCTGTCCGACGAAAAACAGCGGTATCTGGATCAT
ACCTATGCCAGCGCATTGCTCGGGATGGCGTACTGTATGCAAGACGCAACACTGGAGTCGTTAAGTGGTGCCTAT
CGAGTATGTGCCAAGGCTAGATTGCTCCTAGGCCACGGTCAGGGCGACTTGTCGCTGCGAGATGTTCTCCTCCAG
GAGTCTTTACCGGACATGTCGACTGTCGACACAACAGTCGGAGCAAAAGCAATTGGCCTTATAAGAAGATTTTCG
CAACAGTCTTGGAACAACTGCTCGGTTGCAGTCGACCAATCCATAACTGACCTGTTGATGGCACTCATTACCAGC
GCCCTCGTTTTGAGCCGTCTGGGCATGCCCTACACAGTCAGGAAAGTCGGTGATCTTGCGTTTGCTCAAGACGAC
CTGGAGCAAAAGGCTGAGGTTGCGAAACTTCTACACGCTATATCGAGTAGTGCACATCAGGACCACGATGAACAC
TGGATAAAATGTCGCCGTGATATTCTCTGGCTCCGTGACTGGGGCAGGACTACCAACCCTGCGACCGCTACCACT
GCCACAGCTGTATTAGGGGCGGTCTCGAAGGAGTTTTTGGAAAGTGAGCTTCTGAAAGCGTTGCTCTCTCGATCG
CGCTACAACCTCGCCAGGGCGCTATTCGAGGAAAGGGCGGAAACAATCCTCGCTCCCACTCGTATCCGGGAGTTA
GTTCTCCAAGCAGCCCTCCATGCATTCGATAATGCGTCTGAACTTGATCGCACACGAGGCGGCTTGAAAAGATGT
GGTGACATCATCCGGGCCTTTCCAGTTACTGTGGGCGACTCTTCTCCGGGTCCACAACGGATATGGGCACTCCTC
CGAGCGATACACATATTGAGCAGGTATCAGGTCGTAGTCCAGCCGGGCGAGCCTTTCAGCCCTGTGGTCCTGCGT
GCTCACCCCGATCCTATTGAGATTATCAACAAAATTTTGCAGCAGAATCCCAAAGCATACACCCGCCTGCAAGAA
TTCTTGGAAATGGGCATCGACATCATCCAGGCTGGGCTCCTTCCGCATACCCGAGCTGACCAAGTGCACCTAGGT
TCAGACACACATCTTTACATAGCCGGTCAACGCATCACCGCCATGTGTGTCGAAGCCGCCTTGAAGGAAGATGAT
TTCGAGACGGCGTATTCATATGTAGTCAGCCGCCTAGGATTGCATAGTCTTCAAGATCCCAGGAGCTGTTACGAT
AAATGGTCTTGGGCAGCAGCTTCGAGAGCAGGACAACACGTCCTAGACGCGCGGTCTGAACAGCCCACCCATCTC
AGCAATGCTGGTGGAGACATTGAGATTCGACATTTGGAGCAACGGTTGGAGTGCCTGGCCACATCTCTCAGACTG
GCGCCCACTTCTCAGGTCCATGATATTCTCAAAGCTTTCCGGCGCTGTGAGGAGCAATTTGACTCAGCCGTGATG
GGGGAAATGATCAAGGAAGCTGCTTGGGACGCCACGCATAAAGCCACTGTCTGTGCTACCGCTCGACAGGCGGAG
GAATATCACTGCTCTCTCCAGTTTGCAAAGATCAGATTTTCCGGAAGGGCCAGCCAGTTTAGAGCCTATCCAGCC
GGAACCGAAGACCAGGAAAAAAGACCGACTTAG
Transcript >Hirsu2|2310
ATGGGCAATTCGCTGACTCCTACCAAGATAGCACTCTTGGCTGCACACTTAGCTGTTTATGCTGATGTGAATGGC
CTTCGCTGGCTAATTAGCGAGCATTCGGCTACCTTTTCCAAGGCTTTGCTCCTACGCATTTTGCTCACGTACCTG
CCGGAGACATTACAACCGGGTGCATACTTATTGCTCCTGAAGGACATCTCTGTCAATGACATCGCCAAGTGCCAT
CGGTCTGAGCCTGATATTTCTTGGATCAACGCCCTGTCTGATCACCAGGCATTGCGGAGGGCCAGGAAGCTACGA
CTCGCTCGTCTCAGGTGTCTCAATACTGCGCAGGACCAATTTGATCTGCTTAGCACGTTTCTGGTCCAAAAAGCG
TTCCGAATAGACTCGGAAGCAGGAGTGCTGTCCTACGTCCCTGACTTTCTGGTCCCTCTTCTTCATCATTCCCCC
GCGCTGTCCACACGTATCGTTGCGACGGTTTTGCCGTTTGCGAGGAGGAATGTGCAATACTACCTTGAGATTGCA
CCAGCTCACTCACTCGTTCAGTTTCAGAGCCTGGCTGGACCAGATGCCGTGGACTATCTTCTGTCTCGCAGTGGC
GGGCCTAAATTTGCTCAGAGCTCTGTCGTTCGGGACCTCAGAGGGCTCATAGGACCGTGGCTGTGTGACAGCGCC
CGTTGGGAGTCAGCGGCTGGAGATCAGATGGCTCCCGTTGGGGAATCACGGTCCTCTTTTTGCTCCGGCTGGGAA
CAGACTTTGAGCTGGCTTACGACCCAGGCCAAATTATCATGGGATGAGACAGTCGGTGTAATCGAACATTGGGAT
GGGCCGGCTGACATTGATCTTGGCCCCGGAATCAAACCGCAGCTGTCCGACGAAAAACAGCGGTATCTGGATCAT
ACCTATGCCAGCGCATTGCTCGGGATGGCGTACTGTATGCAAGACGCAACACTGGAGTCGTTAAGTGGTGCCTAT
CGAGTATGTGCCAAGGCTAGATTGCTCCTAGGCCACGGTCAGGGCGACTTGTCGCTGCGAGATGTTCTCCTCCAG
GAGTCTTTACCGGACATGTCGACTGTCGACACAACAGTCGGAGCAAAAGCAATTGGCCTTATAAGAAGATTTTCG
CAACAGTCTTGGAACAACTGCTCGGTTGCAGTCGACCAATCCATAACTGACCTGTTGATGGCACTCATTACCAGC
GCCCTCGTTTTGAGCCGTCTGGGCATGCCCTACACAGTCAGGAAAGTCGGTGATCTTGCGTTTGCTCAAGACGAC
CTGGAGCAAAAGGCTGAGGTTGCGAAACTTCTACACGCTATATCGAGTAGTGCACATCAGGACCACGATGAACAC
TGGATAAAATGTCGCCGTGATATTCTCTGGCTCCGTGACTGGGGCAGGACTACCAACCCTGCGACCGCTACCACT
GCCACAGCTGTATTAGGGGCGGTCTCGAAGGAGTTTTTGGAAAGTGAGCTTCTGAAAGCGTTGCTCTCTCGATCG
CGCTACAACCTCGCCAGGGCGCTATTCGAGGAAAGGGCGGAAACAATCCTCGCTCCCACTCGTATCCGGGAGTTA
GTTCTCCAAGCAGCCCTCCATGCATTCGATAATGCGTCTGAACTTGATCGCACACGAGGCGGCTTGAAAAGATGT
GGTGACATCATCCGGGCCTTTCCAGTTACTGTGGGCGACTCTTCTCCGGGTCCACAACGGATATGGGCACTCCTC
CGAGCGATACACATATTGAGCAGGTATCAGGTCGTAGTCCAGCCGGGCGAGCCTTTCAGCCCTGTGGTCCTGCGT
GCTCACCCCGATCCTATTGAGATTATCAACAAAATTTTGCAGCAGAATCCCAAAGCATACACCCGCCTGCAAGAA
TTCTTGGAAATGGGCATCGACATCATCCAGGCTGGGCTCCTTCCGCATACCCGAGCTGACCAAGTGCACCTAGGT
TCAGACACACATCTTTACATAGCCGGTCAACGCATCACCGCCATGTGTGTCGAAGCCGCCTTGAAGGAAGATGAT
TTCGAGACGGCGTATTCATATGTAGTCAGCCGCCTAGGATTGCATAGTCTTCAAGATCCCAGGAGCTGTTACGAT
AAATGGTCTTGGGCAGCAGCTTCGAGAGCAGGACAACACGTCCTAGACGCGCGGTCTGAACAGCCCACCCATCTC
AGCAATGCTGGTGGAGACATTGAGATTCGACATTTGGAGCAACGGTTGGAGTGCCTGGCCACATCTCTCAGACTG
GCGCCCACTTCTCAGGTCCATGATATTCTCAAAGCTTTCCGGCGCTGTGAGGAGCAATTTGACTCAGCCGTGATG
GGGGAAATGATCAAGGAAGCTGCTTGGGACGCCACGCATAAAGCCACTGTCTGTGCTACCGCTCGACAGGCGGAG
GAATATCACTGCTCTCTCCAGTTTGCAAAGATCAGATTTTCCGGAAGGGCCAGCCAGTTTAGAGCCTATCCAGCC
GGAACCGAAGACCAGGAAAAAAGACCGACTTAG
Gene >Hirsu2|2310
ATGGGCAATTCGCTGACTCCTACCAAGATAGCACTCTTGGCTGCACACTTAGCTGTTTATGCTGATGTGAATGGC
CTTCGCTGGCTAATTAGCGAGCATTCGGCTACCTTTTCCAAGGCTTTGCTCCTACGCATTTTGCTCACGTACCTG
CCGGAGACATTACAACCGGGTGCATACTTATTGCTCCTGAAGGACATCTCTGTCAATGACATCGCCAAGTGCCAT
CGGTCTGAGCCTGATATTTCTTGGATCAACGCCCTGTCTGATCACCAGGCATTGCGGAGGGCCAGGAAGCTACGA
CTCGCTCGTCTCAGGTGTCTCAATACTGCGCAGGACCAATTTGATCTGCTTAGCACGTTTCTGGTCCAAAAAGCG
TTCCGAATAGACTCGGAAGCAGGAGTGCTGTCCTACGTCCCTGACTTTCTGGTCCCTCTTCTTCATCATTCCCCC
GCGCTGTCCACACGTATCGTTGCGACGGTTTTGCCGTTTGCGAGGAGGAATGTGCAATACTACCTTGAGATTGCA
CCAGCTCACTCACTCGTTCAGTTTCAGAGCCTGGCTGGACCAGATGCCGTGGACTATCTTCTGTCTCGCAGTGGC
GGGCCTAAATTTGCTCAGAGCTCTGTCGTTCGGGACCTCAGAGGGCTCATAGGACCGTGGCTGTGTGACAGCGCC
CGTTGGGAGTCAGCGGCTGGAGATCAGATGGCTCCCGTTGGGGAATCACGGTCCTCTTTTTGCTCCGGCTGGGAA
CAGACTTTGAGCTGGCTTACGACCCAGGCCAAATTATCATGGGATGAGACAGTCGGTGTAATCGAACATTGGGAT
GGGCCGGCTGACATTGATCTTGGCCCCGGAATCAAACCGCAGCTGTCCGACGAAAAACAGCGGTATCTGGATCAT
ACCTATGCCAGCGCATTGCTCGGGATGGCGTACTGTATGCAAGACGCAACACTGGAGTCGTTAAGTGGTGCCTAT
CGAGTATGTGCCAAGGCTAGATTGCTCCTAGGCCACGGTCAGGGCGACTTGTCGCTGCGAGATGTTCTCCTCCAG
GAGTCTTTACCGGACATGTCGACTGTCGACACAACAGTCGGAGCAAAAGCAATTGGCCTTATAAGAAGATTTTCG
CAACAGTCTTGGAACAACTGCTCGGTTGCAGTCGACCAATCCATAACTGACCTGTTGATGGCACTCATTACCAGC
GCCCTCGTTTTGAGCCGTCTGGGCATGCCCTACACAGTCAGGAAAGTCGGTGATCTTGCGTTTGCTCAAGACGAC
CTGGAGCAAAAGGCTGAGGTTGCGAAACTTCTACACGCTATATCGAGTAGTGCACATCAGGACCACGATGAACAC
TGGATAAAATGTCGCCGTGATATTCTCTGGCTCCGTGACTGGGGCAGGACTACCAACCCTGCGACCGCTACCACT
GCCACAGCTGTATTAGGGGCGGTCTCGAAGGAGTTTTTGGAAAGTGAGCTTCTGAAAGCGTTGCTCTCTCGATCG
CGTATGTATTACCCTGGCAATCTATTCAGCTGCGTCTTCTCATAGAAGGCAGGCTACAACCTCGCCAGGGCGCTA
TTCGAGGAAAGGGCGGAAACAATCCTCGCTCCCACTCGTATCCGGGAGTTAGTTCTCCAAGCAGCCCTCCATGCA
TTCGATAATGCGTCTGAACTTGATCGCACACGAGGCGGCTTGAAAAGATGTGGTGACATGTACCAGCACTCCGCA
CTCGAGCCGCCAATGACATCAACTGATGATTGCTCATTAGCATCCGGGCCTTTCCAGTTACTGTGGGCGACTCTT
CTCCGGGTCCACAACGGATATGGGCACTCCTCCGAGCGATACACATATTGAGCAGGTATCAGGTCGTAGTCCAGC
CGGGCGAGCCTTTCAGCCCTGTGGTCCTGCGTGCTCACCCCGATCCTATTGAGATTATCAACAAAATTTTGCAGC
AGAATCCCAAAGCATACACCCGCCTGCAAGAATTCTTGGAAATGGGCATCGACATCATCCAGGCTGGGCTCCTTC
CGCATACCCGAGCTGACCAAGTGCACCTAGGTTCAGACACACATCTTTACATAGCCGGTCAACGCATCACCGCCA
TGTGTGTCGAAGCCGCCTTGAAGGAAGATGATTTCGAGACGGCGTATTCATATGTAGTCAGCCGCCTAGGATTGC
ATAGTCTTCAAGATCCCAGGAGCTGTTACGATAAATGGTCTTGGGCAGCAGCTTCGAGAGCAGGACAACACGTCC
TAGACGCGCGGTCTGAACAGCCCACCCATCTCAGCAATGCTGGTGGAGACATTGAGATTCGACATTTGGAGCAAC
GGTTGGAGTGCCTGGCCACATCTCTCAGACTGGCGCCCACTTCTCAGGTCCATGATATTCTCAAAGCTTTCCGGC
GCTGTGAGGAGCAATTTGACTCAGCCGTGATGGGGGAAATGATCAAGGAAGCTGCTTGGGACGCCACGCATAAAG
CCAGTAATATACCCGGCACTGTTCACACAGCACTCGGCACATGCTCACCTTGCAACACAGCTGTCTGTGCTACCG
CTCGACAGGCGGAGGTGGTGCCCATGTCAATTTTTGATCTTTCCCGAACAACAGCTAAAATCACACAAAGGAATA
TCACTGCTCTCTCCAGTTTGCAAAGATCAGATTTTCCGGAAGGGCCAGCCAGTTTAGAGCCTATCCAGCCGGAAC
CGAAGACCAGGAAAAAAGACCGACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail