Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2308
Gene name
LocationContig_1543:3837..5218
Strand-
Gene length (bp)1381
Transcript length (bp)1098
Coding sequence length (bp)1098
Protein length (aa) 366

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Signal peptide|Transmembrane domain 0.0914 0.0523 0.0508 0.767 0.0271 0.0029 0.0671 0.3566 0.2815 0.0097

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 27 49 22
2 62 81 19
3 105 127 22
4 147 169 22
5 200 222 22
6 229 251 22
7 261 283 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6557
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1843
Ophiocordyceps subramaniannii Hirsu2|2308 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6698

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2308
MDASSSQKAPAANPNPSQLSPSVSQTALLAVLWTGTTISLLTVAARLAIRWRLLAKFKTDDYLVMFAMVTYATST
ITLTAARENLVPYLRINIIDVTKLPDVLAAAAVGLHANLASYICSWTCLWAIKLSFMAFFHALGRQIRFQRIIWW
SILFLILATYIVCISILDYGCLTGTADIIMEKCMSQKTVDYEYANTRVTTTFDIVTDLSIVGLSANIVWRAGIPL
RKKLMLACICSLTVFMVVVAIVRITVGAPGKAPDLSWLLLWNSVEMTLAIFVACIASFRSLYCQTRRPHRASDGT
PPHPRKKTSARTAFLSTLNTGTLFEEETTQWFRQGLTEAGEPRFGPDTSGVKIIALSDVSDSNHV*
Coding >Hirsu2|2308
ATGGATGCCTCCTCCTCGCAGAAAGCCCCGGCCGCGAACCCCAATCCCTCCCAACTGTCGCCCTCCGTCTCCCAG
ACGGCTCTTCTCGCAGTCTTATGGACCGGCACCACCATCTCCCTGCTCACCGTCGCCGCACGGCTGGCCATCCGC
TGGAGGCTGCTGGCCAAGTTCAAGACGGACGACTACCTGGTCATGTTTGCCATGGTGACGTACGCGACGTCGACC
ATCACCCTGACGGCCGCGCGTGAAAACCTCGTGCCGTACCTCAGAATCAACATCATCGACGTGACCAAGCTGCCG
GACGTGCTGGCCGCGGCCGCCGTCGGCCTGCACGCCAACCTGGCCAGCTACATCTGCTCGTGGACCTGCCTGTGG
GCCATCAAGCTGTCCTTCATGGCCTTCTTCCACGCGCTCGGCCGCCAGATCCGGTTCCAGAGAATCATCTGGTGG
TCCATCCTTTTCCTCATCCTGGCAACCTACATCGTCTGCATCTCCATCCTCGACTACGGCTGCTTGACCGGCACC
GCCGACATCATCATGGAGAAGTGCATGAGCCAGAAAACGGTCGACTACGAATATGCCAACACCCGAGTCACGACC
ACTTTCGACATCGTCACCGACCTCTCGATTGTTGGCCTGTCAGCCAACATTGTCTGGCGAGCGGGCATCCCGCTG
AGGAAGAAGCTGATGCTGGCCTGCATCTGCTCCCTCACCGTCTTCATGGTCGTCGTCGCCATCGTCAGGATCACC
GTCGGGGCGCCGGGCAAGGCCCCCGACCTTTCGTGGCTGCTGCTATGGAACTCGGTCGAGATGACGCTCGCCATC
TTCGTGGCCTGCATCGCCTCCTTCCGGAGCCTCTACTGCCAGACGAGGAGGCCTCACCGGGCAAGCGACGGCACG
CCGCCTCATCCCAGGAAGAAGACGTCGGCACGCACCGCCTTCCTCTCCACCCTCAACACCGGCACCTTGTTCGAG
GAAGAAACGACGCAGTGGTTCCGCCAAGGGCTGACGGAAGCCGGAGAGCCTCGCTTTGGCCCCGACACGAGCGGC
GTCAAGATCATTGCGCTGTCCGATGTCTCTGACAGCAACCACGTGTGA
Transcript >Hirsu2|2308
ATGGATGCCTCCTCCTCGCAGAAAGCCCCGGCCGCGAACCCCAATCCCTCCCAACTGTCGCCCTCCGTCTCCCAG
ACGGCTCTTCTCGCAGTCTTATGGACCGGCACCACCATCTCCCTGCTCACCGTCGCCGCACGGCTGGCCATCCGC
TGGAGGCTGCTGGCCAAGTTCAAGACGGACGACTACCTGGTCATGTTTGCCATGGTGACGTACGCGACGTCGACC
ATCACCCTGACGGCCGCGCGTGAAAACCTCGTGCCGTACCTCAGAATCAACATCATCGACGTGACCAAGCTGCCG
GACGTGCTGGCCGCGGCCGCCGTCGGCCTGCACGCCAACCTGGCCAGCTACATCTGCTCGTGGACCTGCCTGTGG
GCCATCAAGCTGTCCTTCATGGCCTTCTTCCACGCGCTCGGCCGCCAGATCCGGTTCCAGAGAATCATCTGGTGG
TCCATCCTTTTCCTCATCCTGGCAACCTACATCGTCTGCATCTCCATCCTCGACTACGGCTGCTTGACCGGCACC
GCCGACATCATCATGGAGAAGTGCATGAGCCAGAAAACGGTCGACTACGAATATGCCAACACCCGAGTCACGACC
ACTTTCGACATCGTCACCGACCTCTCGATTGTTGGCCTGTCAGCCAACATTGTCTGGCGAGCGGGCATCCCGCTG
AGGAAGAAGCTGATGCTGGCCTGCATCTGCTCCCTCACCGTCTTCATGGTCGTCGTCGCCATCGTCAGGATCACC
GTCGGGGCGCCGGGCAAGGCCCCCGACCTTTCGTGGCTGCTGCTATGGAACTCGGTCGAGATGACGCTCGCCATC
TTCGTGGCCTGCATCGCCTCCTTCCGGAGCCTCTACTGCCAGACGAGGAGGCCTCACCGGGCAAGCGACGGCACG
CCGCCTCATCCCAGGAAGAAGACGTCGGCACGCACCGCCTTCCTCTCCACCCTCAACACCGGCACCTTGTTCGAG
GAAGAAACGACGCAGTGGTTCCGCCAAGGGCTGACGGAAGCCGGAGAGCCTCGCTTTGGCCCCGACACGAGCGGC
GTCAAGATCATTGCGCTGTCCGATGTCTCTGACAGCAACCACGTGTGA
Gene >Hirsu2|2308
ATGGATGCCTCCTCCTCGCAGAAAGCCCCGGCCGCGAACCCCAATCCCTCCCAACTGTCGCCCTCCGTCTCCCAG
ACGGCTCTTCTCGTGAGAACTTCCCCTTGCCACTGGCCGCGCTCGAAGGCTGACAGCGGGAGAGGGGGCGTCTCC
AAGGCAGTCTTATGGACCGGCACCACCATCTCCCTGCTCACCGTCGCCGCACGGCTGGCCATCCGCTGGAGGCTG
CTGGCCAAGTTCAAGACGGACGACTACCTGGTCATGTTTGCCATGGTGACGTACGCGACGTCGACCATCACCCTG
ACGGCCGCGCGTGAAAACCTCGTGCCGTACCTCAGAATCAACATCATCGACGTGACCAAGCTGCCGGACGTGCTG
GCCGCGGCCGCCGTCGGCCTGCACGCCAACCTGGCCAGCTACATCTGCTCGTGGACCTGCCTGTGGGCCATCAAG
CTGTCCTTCATGGCCTTCTTCCACGCGCTCGGCCGCCAGATCCGGTTCCAGAGAATCATCTGGTGGTCCATCCTT
TTCCTCATCCTGGCAACCTACATCGTCTGCATCTCCATCCTCGACTACGGCTGCTTGACCGGCACCGCCGACATC
ATCATGGGTATGTGGGCTATGCCGCCTCCGCAGACAGCTGCCATTGATACTGCCGCCGCTCGAGCACGGTCCGTT
GGCTGATGGGCGCCGCAGAGAAGTGCATGAGCCAGAAAACGGTCGACTACGAATATGCCAACACCCGAGTCACGA
CCACTTTCGACATCGTCACCGACCTCTCGAGTGAGACCGTCCCACGGCTTTACCCCCTGAAGCACACTCTGACCT
GACGATGCAGTTGTTGGCCTGTCAGCCAACATTGTCTGGCGAGCGGGCATCCCGCTGAGGAAGAAGCTGATGCTG
GCCTGCATCTGCTCCCTCACCGTCTTCATGGTCGTCGTCGCCATCGTCAGGATCACCGTCGGGGCGCCGGGCAAG
GCCCCCGACCTTTCGTGGCTGCTGCTATGGAACTCGGTCGAGATGACGCTCGGTACCTGGCCCCCGTGCTCTCCC
TCCTCCCTCCGACAAGGTGACCGCTGACGGAGAGGCCGCTGTGGTTACGAAAGCCATCTTCGTGGCCTGCATCGC
CTCCTTCCGGAGCCTCTACTGCCAGACGAGGAGGCCTCACCGGGCAAGCGACGGCACGCCGCCTCATCCCAGGAA
GAAGACGTCGGCACGCACCGCCTTCCTCTCCACCCTCAACACCGGCACCTTGTTCGAGGAAGAAACGACGCAGTG
GTTCCGCCAAGGGCTGACGGAAGCCGGAGAGCCTCGCTTTGGCCCCGACACGAGCGGCGTCAAGATCATTGCGCT
GTCCGATGTCTCTGACAGCAACCACGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail