Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2304
Gene name
LocationContig_1542:1259..2112
Strand+
Gene length (bp)853
Transcript length (bp)624
Coding sequence length (bp)624
Protein length (aa) 208

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 2.1E-18 109 202
PF02798 GST_N Glutathione S-transferase, N-terminal domain 2.6E-04 7 84

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46088|GST_NOTSL Glutathione S-transferase OS=Nototodarus sloanii PE=1 SV=1 8 200 2.0E-15
sp|Q9N4X8|GSTPA_CAEEL Glutathione S-transferase P 10 OS=Caenorhabditis elegans GN=gst-10 PE=1 SV=3 6 203 3.0E-15
sp|P27011|SCRY3_ENTDO S-crystallin 3 OS=Enteroctopus dofleini PE=2 SV=1 7 205 1.0E-14
sp|P27012|SCRY4_ENTDO S-crystallin 4 OS=Enteroctopus dofleini PE=2 SV=1 7 205 2.0E-13
sp|Q21743|GST9_CAEEL Probable glutathione S-transferase 9 OS=Caenorhabditis elegans GN=gst-9 PE=3 SV=1 15 171 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46088|GST_NOTSL Glutathione S-transferase OS=Nototodarus sloanii PE=1 SV=1 8 200 2.0E-15
sp|Q9N4X8|GSTPA_CAEEL Glutathione S-transferase P 10 OS=Caenorhabditis elegans GN=gst-10 PE=1 SV=3 6 203 3.0E-15
sp|P27011|SCRY3_ENTDO S-crystallin 3 OS=Enteroctopus dofleini PE=2 SV=1 7 205 1.0E-14
sp|P27012|SCRY4_ENTDO S-crystallin 4 OS=Enteroctopus dofleini PE=2 SV=1 7 205 2.0E-13
sp|Q21743|GST9_CAEEL Probable glutathione S-transferase 9 OS=Caenorhabditis elegans GN=gst-9 PE=3 SV=1 15 171 3.0E-13
sp|P18425|SCR20_NOTSL S-crystallin SL20-1 OS=Nototodarus sloanii PE=2 SV=1 17 206 3.0E-13
sp|P18426|SCR11_NOTSL S-crystallin SL11 OS=Nototodarus sloanii PE=2 SV=1 17 206 4.0E-13
sp|P26624|GST28_SCHJA Glutathione S-transferase class-mu 28 kDa isozyme (Fragment) OS=Schistosoma japonicum PE=2 SV=1 17 206 6.0E-12
sp|Q09596|GST5_CAEEL Probable glutathione S-transferase 5 OS=Caenorhabditis elegans GN=gst-5 PE=1 SV=1 17 201 2.0E-11
sp|Q0ZS46|GST_PLAVI Glutathione S-transferase OS=Plasmodium vivax GN=GST PE=2 SV=1 7 206 3.0E-11
sp|O73888|HPGDS_CHICK Hematopoietic prostaglandin D synthase OS=Gallus gallus GN=HPGDS PE=1 SV=3 17 206 3.0E-11
sp|P91253|GST7_CAEEL Probable glutathione S-transferase 7 OS=Caenorhabditis elegans GN=gst-7 PE=3 SV=1 17 163 7.0E-11
sp|P46426|GSTP_DIRIM Glutathione S-transferase OS=Dirofilaria immitis PE=2 SV=1 17 198 8.0E-11
sp|P91254|GST8_CAEEL Probable glutathione S-transferase 8 OS=Caenorhabditis elegans GN=gst-8 PE=3 SV=1 17 163 9.0E-11
sp|Q08392|GSTA1_CHICK Glutathione S-transferase OS=Gallus gallus PE=2 SV=1 3 204 1.0E-10
sp|P46427|GSTP_ONCVO Glutathione S-transferase 2 OS=Onchocerca volvulus GN=GST2 PE=1 SV=1 17 201 1.0E-10
sp|P10299|GSTP1_CAEEL Glutathione S-transferase P OS=Caenorhabditis elegans GN=gst-1 PE=1 SV=1 8 201 3.0E-10
sp|P27010|SCRY2_ENTDO S-crystallin 2 OS=Enteroctopus dofleini PE=2 SV=1 17 205 4.0E-10
sp|P09792|GST28_SCHMA Glutathione S-transferase class-mu 28 kDa isozyme OS=Schistosoma mansoni GN=GST28 PE=1 SV=1 17 201 5.0E-10
sp|P46436|GST1_ASCSU Glutathione S-transferase 1 OS=Ascaris suum GN=GST1 PE=1 SV=3 8 205 6.0E-10
sp|P30115|GSTA3_MOUSE Glutathione S-transferase A3 OS=Mus musculus GN=Gsta3 PE=1 SV=2 3 204 1.0E-09
sp|P46409|GSTMU_RABIT Glutathione S-transferase Mu 1 OS=Oryctolagus cuniculus PE=1 SV=2 8 203 1.0E-09
sp|O16115|GST2_CAEEL Glutathione S-transferase 2 OS=Caenorhabditis elegans GN=gst-2 PE=2 SV=1 17 187 2.0E-09
sp|P13745|GSTA1_MOUSE Glutathione S-transferase A1 OS=Mus musculus GN=Gsta1 PE=1 SV=2 3 204 4.0E-09
sp|P81706|GSTA1_CAVPO Glutathione S-transferase A OS=Cavia porcellus PE=1 SV=1 3 204 4.0E-09
sp|P46418|GSTA5_RAT Glutathione S-transferase alpha-5 OS=Rattus norvegicus GN=Gsta5 PE=1 SV=2 5 204 5.0E-09
sp|P20136|GSTM2_CHICK Glutathione S-transferase 2 OS=Gallus gallus GN=GSTM2 PE=1 SV=4 7 203 6.0E-09
sp|P04904|GSTA3_RAT Glutathione S-transferase alpha-3 OS=Rattus norvegicus GN=Gsta3 PE=1 SV=3 5 204 1.0E-08
sp|P30114|GST28_SCHHA Glutathione S-transferase class-mu 28 kDa isozyme OS=Schistosoma haematobium PE=1 SV=1 17 206 1.0E-08
sp|Q08862|GSTA_RABIT Glutathione S-transferase Yc OS=Oryctolagus cuniculus PE=2 SV=2 3 200 1.0E-08
sp|P47954|GSTP1_CRIMI Glutathione S-transferase P OS=Cricetulus migratorius GN=GSTP1 PE=2 SV=2 17 201 2.0E-08
sp|Q60550|GSTP1_MESAU Glutathione S-transferase P OS=Mesocricetus auratus GN=GSTP1 PE=2 SV=3 17 201 2.0E-08
sp|P14942|GSTA4_RAT Glutathione S-transferase alpha-4 OS=Rattus norvegicus GN=Gsta4 PE=1 SV=2 5 204 3.0E-08
sp|Q9Z1B2|GSTM5_RAT Glutathione S-transferase Mu 5 OS=Rattus norvegicus GN=Gstm5 PE=1 SV=3 1 203 3.0E-08
sp|Q8JFZ2|GSTP1_XENLA Glutathione S-transferase P 1 OS=Xenopus laevis GN=gstp1 PE=1 SV=1 17 205 3.0E-08
sp|P46424|GSTP1_CRILO Glutathione S-transferase P OS=Cricetulus longicaudatus GN=GSTP1 PE=2 SV=2 17 201 4.0E-08
sp|P19157|GSTP1_MOUSE Glutathione S-transferase P 1 OS=Mus musculus GN=Gstp1 PE=1 SV=2 17 201 4.0E-08
sp|O60760|HPGDS_HUMAN Hematopoietic prostaglandin D synthase OS=Homo sapiens GN=HPGDS PE=1 SV=3 17 205 5.0E-08
sp|P46419|GSTM1_DERPT Glutathione S-transferase OS=Dermatophagoides pteronyssinus PE=1 SV=1 4 203 6.0E-08
sp|Q7REH6|GST_PLAYO Glutathione S-transferase OS=Plasmodium yoelii yoelii GN=GST PE=3 SV=1 15 206 6.0E-08
sp|P24472|GSTA4_MOUSE Glutathione S-transferase A4 OS=Mus musculus GN=Gsta4 PE=1 SV=3 3 204 1.0E-07
sp|P81942|GSTP1_BUFBU Glutathione S-transferase P 1 OS=Bufo bufo PE=1 SV=1 17 202 1.0E-07
sp|P46425|GSTP2_MOUSE Glutathione S-transferase P 2 OS=Mus musculus GN=Gstp2 PE=1 SV=2 15 201 2.0E-07
sp|Q28035|GSTA1_BOVIN Glutathione S-transferase A1 OS=Bos taurus GN=GSTA1 PE=2 SV=3 3 207 4.0E-07
sp|Q21355|GST4_CAEEL Glutathione S-transferase 4 OS=Caenorhabditis elegans GN=gst-4 PE=2 SV=1 8 206 4.0E-07
sp|P30113|GST28_SCHBO Glutathione S-transferase class-mu 28 kDa isozyme OS=Schistosoma bovis PE=1 SV=2 17 206 4.0E-07
sp|P04903|GSTA2_RAT Glutathione S-transferase alpha-2 OS=Rattus norvegicus GN=Gsta2 PE=2 SV=2 3 206 4.0E-07
sp|O16116|GST3_CAEEL Glutathione S-transferase 3 OS=Caenorhabditis elegans GN=gst-3 PE=2 SV=1 17 161 8.0E-07
sp|P83325|GSTP2_BUFBU Glutathione S-transferase P 2 OS=Bufo bufo PE=1 SV=1 17 202 1.0E-06
sp|P00502|GSTA1_RAT Glutathione S-transferase alpha-1 OS=Rattus norvegicus GN=Gsta1 PE=1 SV=3 3 204 1.0E-06
sp|P09210|GSTA2_HUMAN Glutathione S-transferase A2 OS=Homo sapiens GN=GSTA2 PE=1 SV=4 3 200 1.0E-06
sp|P10648|GSTA2_MOUSE Glutathione S-transferase A2 OS=Mus musculus GN=Gsta2 PE=1 SV=3 3 204 1.0E-06
sp|P46429|GST2_MANSE Glutathione S-transferase 2 OS=Manduca sexta GN=GST2 PE=2 SV=1 5 201 3.0E-06
sp|P51781|GSTA1_PIG Glutathione S-transferase alpha M14 OS=Sus scrofa PE=2 SV=2 3 204 3.0E-06
sp|O18598|GST1_BLAGE Glutathione S-transferase OS=Blattella germanica PE=1 SV=3 8 199 4.0E-06
sp|Q08863|GSTA1_RABIT Glutathione S-transferase alpha I OS=Oryctolagus cuniculus PE=1 SV=1 3 204 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0006749 glutathione metabolic process Yes
GO:0006575 cellular modified amino acid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0043603 cellular amide metabolic process No
GO:0003674 molecular_function No
GO:0006790 sulfur compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6915 0.3575 0.066 0.1569 0.4577 0.0515 0.1011 0.0799 0.0699 0.1422

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6974
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2671
Ophiocordyceps australis map64 (Brazil) OphauB2|4011
Ophiocordyceps subramaniannii Hirsu2|2304 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2304
MASSKPVLHYLDIGSLGRGEVVRLFLVDAGIEFQDKRYPFDGTWSSTSADLKSQGISRTGLVPVLEYKGTCLSQH
MPTLRYLARELGSYDGESSSEKYTVDTVADLYIDWRAEWVRNLNTVTDEYKNKVAPEYYNLVAHYYKDGSGPFLL
GDKITYADFAIYQSIDNDAKIGTLPKQLPGPLLALKKAMEARPKIAAYLQSDRKTSS*
Coding >Hirsu2|2304
ATGGCCTCATCTAAGCCCGTCCTGCACTACCTCGACATCGGCAGCCTCGGCCGCGGCGAAGTCGTGCGCCTCTTC
CTGGTAGATGCGGGTATCGAGTTCCAGGATAAGCGTTACCCCTTTGACGGCACATGGAGCTCGACCAGCGCCGAT
CTGAAAAGCCAGGGGATTTCGCGAACCGGCCTGGTGCCTGTGCTCGAGTACAAGGGCACTTGTCTGTCCCAGCAT
ATGCCCACTCTCCGTTATCTTGCCCGCGAACTAGGTAGCTACGACGGCGAGTCAAGCTCTGAAAAGTACACGGTC
GATACCGTCGCAGACTTGTATATCGATTGGCGGGCCGAATGGGTTCGAAACCTGAACACGGTCACCGACGAGTAC
AAGAACAAGGTCGCCCCCGAGTATTACAACCTTGTTGCGCACTATTACAAGGACGGGAGCGGTCCCTTCCTCCTC
GGCGACAAGATCACCTATGCCGACTTCGCTATCTATCAGTCTATTGACAATGATGCGAAAATCGGCACTCTTCCG
AAACAACTGCCCGGGCCCTTGCTGGCCTTAAAGAAGGCGATGGAGGCTCGGCCTAAGATTGCCGCCTACCTGCAA
TCGGACCGCAAAACTTCGTCGTAG
Transcript >Hirsu2|2304
ATGGCCTCATCTAAGCCCGTCCTGCACTACCTCGACATCGGCAGCCTCGGCCGCGGCGAAGTCGTGCGCCTCTTC
CTGGTAGATGCGGGTATCGAGTTCCAGGATAAGCGTTACCCCTTTGACGGCACATGGAGCTCGACCAGCGCCGAT
CTGAAAAGCCAGGGGATTTCGCGAACCGGCCTGGTGCCTGTGCTCGAGTACAAGGGCACTTGTCTGTCCCAGCAT
ATGCCCACTCTCCGTTATCTTGCCCGCGAACTAGGTAGCTACGACGGCGAGTCAAGCTCTGAAAAGTACACGGTC
GATACCGTCGCAGACTTGTATATCGATTGGCGGGCCGAATGGGTTCGAAACCTGAACACGGTCACCGACGAGTAC
AAGAACAAGGTCGCCCCCGAGTATTACAACCTTGTTGCGCACTATTACAAGGACGGGAGCGGTCCCTTCCTCCTC
GGCGACAAGATCACCTATGCCGACTTCGCTATCTATCAGTCTATTGACAATGATGCGAAAATCGGCACTCTTCCG
AAACAACTGCCCGGGCCCTTGCTGGCCTTAAAGAAGGCGATGGAGGCTCGGCCTAAGATTGCCGCCTACCTGCAA
TCGGACCGCAAAACTTCGTCGTAG
Gene >Hirsu2|2304
ATGGCCTCATCTAAGCCCGTCCTGCACTACCTCGACATCGGCAGCCTCGGCCGCGGCGAAGTCGTGCGGTTTGCC
AGCCCCTCCCGCCAAGCTTTGAAACTCTTAGACGTGGGTAGCTAACGATGAACCAGCCTCTTCCTGGTAGATGCG
GGTATCGAGTTCCAGGATAAGCGTTACCCCTTTGACGGCACATGGAGCTCGACCAGCGCCGATCTGAAAAGCCAG
GGGATTTCGCGAACCGGCCTGGTGCCTGTGCTCGAGTACAAGGGCACTTGTCTGTCCCAGGTCTGCGTGCCCCTC
TTCGCGGCGATGAATTATGGAACAGGCGGCTCACTGTCAACTCCAGCATATGCCCACTCTCCGTTATCTTGCCCG
CGAACTAGGTAGCTACGACGGCGAGTCAAGCTCTGAAAAGTACACGGTCGATACCGTCGCAGACTTGTATATCGA
TTGGCGGGTAAGGCATGTCACGCACGCCTTGTTTGTAAGACAGGAATTGAGCGCCATATACAGGCCGAATGGGTT
CGAAACCTGAACACGGTCACCGACGAGTACAAGAACAAGGTCGCCCCCGAGTATTACAACCTTGTTGCGCACTAT
TACAAGGACGGGAGCGGTCCCTTCCTCCTCGGCGACAAGATCACCTATGCCGACTTCGCTATCTATCAGTCTATT
GACAATGATGCGAAAATCGGCACTCTTCCGGTACGCTTGCAGCGTCTTAGCCACTGCTCATGCTAACATAGGCGT
CCAGAAACAACTGCCCGGGCCCTTGCTGGCCTTAAAGAAGGCGATGGAGGCTCGGCCTAAGATTGCCGCCTACCT
GCAATCGGACCGCAAAACTTCGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail