Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2297
Gene name
LocationContig_154:26072..26723
Strand+
Gene length (bp)651
Transcript length (bp)342
Coding sequence length (bp)342
Protein length (aa) 114

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03911 Sec61_beta Sec61beta family 9.0E-19 65 105

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HFC7|SC61B_YARLI Protein transport protein Sec61 subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SBH1 PE=3 SV=1 24 111 5.0E-32
sp|Q8J2P4|SC61B_KLULA Protein transport protein Sec61 subunit beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SBH1 PE=3 SV=1 30 108 3.0E-28
sp|P52871|SC6B2_YEAST Protein transport protein SBH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SBH2 PE=1 SV=1 29 109 1.0E-26
sp|O43002|SC61B_SCHPO Protein transport protein sec61 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sbh1 PE=3 SV=1 1 113 2.0E-21
sp|P52870|SC6B1_YEAST Protein transport protein SBH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SBH1 PE=1 SV=1 25 107 7.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HFC7|SC61B_YARLI Protein transport protein Sec61 subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SBH1 PE=3 SV=1 24 111 5.0E-32
sp|Q8J2P4|SC61B_KLULA Protein transport protein Sec61 subunit beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SBH1 PE=3 SV=1 30 108 3.0E-28
sp|P52871|SC6B2_YEAST Protein transport protein SBH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SBH2 PE=1 SV=1 29 109 1.0E-26
sp|O43002|SC61B_SCHPO Protein transport protein sec61 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sbh1 PE=3 SV=1 1 113 2.0E-21
sp|P52870|SC6B1_YEAST Protein transport protein SBH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SBH1 PE=1 SV=1 25 107 7.0E-19
sp|Q5RB31|SC61B_PONAB Protein transport protein Sec61 subunit beta OS=Pongo abelii GN=SEC61B PE=3 SV=3 36 109 3.0E-13
sp|P60468|SC61B_HUMAN Protein transport protein Sec61 subunit beta OS=Homo sapiens GN=SEC61B PE=1 SV=2 36 109 3.0E-13
sp|P60467|SC61B_CANLF Protein transport protein Sec61 subunit beta OS=Canis lupus familiaris GN=SEC61B PE=1 SV=2 36 109 3.0E-13
sp|Q9CQS8|SC61B_MOUSE Protein transport protein Sec61 subunit beta OS=Mus musculus GN=Sec61b PE=1 SV=3 36 109 9.0E-13
sp|Q54YR4|SC61B_DICDI Protein transport protein Sec61 subunit beta OS=Dictyostelium discoideum GN=sec61b PE=3 SV=1 53 109 8.0E-09
sp|P38389|SC61B_ARATH Protein transport protein Sec61 subunit beta OS=Arabidopsis thaliana GN=At2g45070 PE=1 SV=1 69 107 2.0E-07
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide|Transmembrane domain 0.0932 0.0966 0.0414 0.4496 0.0987 0.0256 0.8157 0.3755 0.4083 0.0431

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 82 104 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4990
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4675
Ophiocordyceps australis map64 (Brazil) OphauB2|4501
Ophiocordyceps camponoti-floridani Ophcf2|03304
Ophiocordyceps camponoti-rufipedis Ophun1|4492
Ophiocordyceps kimflemingae Ophio5|3533
Ophiocordyceps subramaniannii Hirsu2|2297 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2297
MSSPRSSSPVNSQAAASGVSAGRASSPTPPGGARTAIRRRAAADQKEKIANARPTSTRAAGAGGSSSTMLRLYTD
ESPGLKVDPVIVLVLSLVFIFSVVALHIIAKITRRFSS*
Coding >Hirsu2|2297
ATGTCTTCTCCCCGGTCTTCATCCCCCGTCAACTCGCAGGCGGCGGCCAGCGGCGTCAGCGCTGGCCGCGCCTCG
TCCCCGACACCTCCAGGAGGCGCCAGGACGGCAATCCGACGACGCGCTGCGGCCGATCAGAAGGAGAAGATCGCC
AATGCCCGGCCCACCAGCACGAGGGCTGCCGGTGCCGGCGGCTCCAGCAGCACCATGCTGAGACTCTATACGGAC
GAATCGCCCGGCCTGAAGGTCGATCCTGTCATCGTACTCGTTCTTTCTCTCGTGTTCATCTTCAGTGTTGTGGCC
CTGCACATTATCGCCAAGATCACGCGACGATTTTCGAGCTAG
Transcript >Hirsu2|2297
ATGTCTTCTCCCCGGTCTTCATCCCCCGTCAACTCGCAGGCGGCGGCCAGCGGCGTCAGCGCTGGCCGCGCCTCG
TCCCCGACACCTCCAGGAGGCGCCAGGACGGCAATCCGACGACGCGCTGCGGCCGATCAGAAGGAGAAGATCGCC
AATGCCCGGCCCACCAGCACGAGGGCTGCCGGTGCCGGCGGCTCCAGCAGCACCATGCTGAGACTCTATACGGAC
GAATCGCCCGGCCTGAAGGTCGATCCTGTCATCGTACTCGTTCTTTCTCTCGTGTTCATCTTCAGTGTTGTGGCC
CTGCACATTATCGCCAAGATCACGCGACGATTTTCGAGCTAG
Gene >Hirsu2|2297
ATGGTATGCGCCCCTCTCCGACTCCAATTCCCTCACCGCGAATGCAACCTGCCAGCTTTCCCAGGGTGCACCAGA
ATCGCTGCCGGAAGCGAGAGCCATTTCGCCGCTGATACTCGTTCGCCGTATGCTAACACGAGGCTCTCCACAGTC
TTCTCCCCGGTCTTCATCCCCCGTCAACTCGCAGGCGGCGGCCAGCGGCGTCAGCGCTGGCCGCGCCTCGTCCCC
GACACCTCCAGGAGGCGCCAGGACGGCAATCCGACGACGCGCTGCGGCCGATCAGAAGGAGAAGATCGCCAATGC
CCGGCCCACCAGCACGAGGGCTGCCGGTGCCGGCGGCTCCAGCAGCACCATGCTGAGTACGTGTCTCCCCCGTGC
TCGGGCTCACCCTTGCAGCTGCCGGCTCCTCGTGCATTGATTGGGAATCCGAATTAACGCTTCTTTTCCGTCGCA
GGACTCTATACGGACGAATCGCCCGGCCTGAAGGTCGATCCTGTCATCGTACTCGTTCTTTCTCTCGTGTTCATC
TTCAGTGTTGTGGCCCTGCACAGTGAGTGTTTCTCAATCGGGCCTATCCCTATCTAAAGTCTGGTAAATACTGAC
GGACCGCGTCCTGCAGTTATCGCCAAGATCACGCGACGATTTTCGAGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail