© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|229 |
| Gene name | |
| Location | Contig_104:28598..30133 |
| Strand | - |
| Gene length (bp) | 1535 |
| Transcript length (bp) | 1458 |
| Coding sequence length (bp) | 1458 |
| Protein length (aa) | 486 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00022 | Actin | Actin | 3.7E-143 | 18 | 485 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q4IPI4|ARP4_GIBZE | Actin-related protein 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ARP4 PE=3 SV=1 | 1 | 485 | 0.0E+00 |
| sp|Q7SHR0|ARP4_NEUCR | Actin-related protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arp-4 PE=3 SV=2 | 3 | 485 | 0.0E+00 |
| sp|Q5AW89|ARP4_EMENI | Actin-related protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=arp4 PE=3 SV=1 | 6 | 485 | 7.0E-174 |
| sp|Q4WHA3|ARP4_ASPFU | Actin-related protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=arp4 PE=3 SV=1 | 19 | 485 | 7.0E-165 |
| sp|Q9P7X7|ARP4_SCHPO | Actin-related protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp5 PE=3 SV=1 | 15 | 485 | 1.0E-85 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q4IPI4|ARP4_GIBZE | Actin-related protein 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ARP4 PE=3 SV=1 | 1 | 485 | 0.0E+00 |
| sp|Q7SHR0|ARP4_NEUCR | Actin-related protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arp-4 PE=3 SV=2 | 3 | 485 | 0.0E+00 |
| sp|Q5AW89|ARP4_EMENI | Actin-related protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=arp4 PE=3 SV=1 | 6 | 485 | 7.0E-174 |
| sp|Q4WHA3|ARP4_ASPFU | Actin-related protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=arp4 PE=3 SV=1 | 19 | 485 | 7.0E-165 |
| sp|Q9P7X7|ARP4_SCHPO | Actin-related protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp5 PE=3 SV=1 | 15 | 485 | 1.0E-85 |
| sp|Q4P2E8|ARP4_USTMA | Actin-related protein 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ARP4 PE=3 SV=1 | 15 | 485 | 2.0E-84 |
| sp|P86173|ACL6B_RAT | Actin-like protein 6B OS=Rattus norvegicus GN=Actl6b PE=1 SV=2 | 15 | 484 | 8.0E-83 |
| sp|Q99MR0|ACL6B_MOUSE | Actin-like protein 6B OS=Mus musculus GN=Actl6b PE=1 SV=1 | 15 | 484 | 8.0E-83 |
| sp|A4FUX8|ACL6B_BOVIN | Actin-like protein 6B OS=Bos taurus GN=ACTL6B PE=2 SV=1 | 15 | 484 | 8.0E-83 |
| sp|Q4R333|ACL6A_MACFA | Actin-like protein 6A OS=Macaca fascicularis GN=ACTL6A PE=2 SV=1 | 15 | 484 | 6.0E-80 |
| sp|O94805|ACL6B_HUMAN | Actin-like protein 6B OS=Homo sapiens GN=ACTL6B PE=1 SV=1 | 15 | 484 | 7.0E-80 |
| sp|O96019|ACL6A_HUMAN | Actin-like protein 6A OS=Homo sapiens GN=ACTL6A PE=1 SV=1 | 15 | 484 | 1.0E-79 |
| sp|Q9Z2N8|ACL6A_MOUSE | Actin-like protein 6A OS=Mus musculus GN=Actl6a PE=1 SV=2 | 15 | 484 | 3.0E-79 |
| sp|Q6C061|ARP4_YARLI | Actin-related protein 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARP4 PE=3 SV=1 | 6 | 483 | 1.0E-76 |
| sp|Q5AC48|ARP4_CANAL | Actin-related protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARP4 PE=3 SV=2 | 9 | 476 | 2.0E-71 |
| sp|Q84M92|ARP4_ARATH | Actin-related protein 4 OS=Arabidopsis thaliana GN=ARP4 PE=1 SV=1 | 15 | 484 | 2.0E-68 |
| sp|Q6BXN0|ARP4_DEBHA | Actin-related protein 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ARP4 PE=3 SV=1 | 15 | 476 | 1.0E-66 |
| sp|Q09849|ARP42_SCHPO | SWI/SNF and RSC complexes subunit arp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp42 PE=1 SV=2 | 19 | 485 | 4.0E-62 |
| sp|Q6ZJW9|ARP4_ORYSJ | Actin-related protein 4 OS=Oryza sativa subsp. japonica GN=ARP4 PE=2 SV=1 | 15 | 484 | 2.0E-57 |
| sp|A2YR10|ARP4_ORYSI | Actin-related protein 4 OS=Oryza sativa subsp. indica GN=ARP4 PE=3 SV=2 | 15 | 484 | 2.0E-57 |
| sp|Q6FJV8|ARP4_CANGA | Actin-related protein 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARP4 PE=3 SV=1 | 15 | 476 | 1.0E-56 |
| sp|Q754G5|ARP4_ASHGO | Actin-related protein 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARP4 PE=3 SV=1 | 15 | 482 | 1.0E-54 |
| sp|P53455|ACT_AJECG | Actin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_08711 PE=2 SV=2 | 19 | 484 | 7.0E-51 |
| sp|P48465|ACT_CRYNH | Actin OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNAG_00483 PE=3 SV=2 | 19 | 484 | 2.0E-50 |
| sp|P53689|ACT_PHARH | Actin OS=Phaffia rhodozyma PE=3 SV=1 | 19 | 484 | 5.0E-50 |
| sp|P10365|ACT_THELA | Actin OS=Thermomyces lanuginosus PE=3 SV=1 | 19 | 484 | 1.0E-49 |
| sp|Q8X119|ACT_EXODE | Actin OS=Exophiala dermatitidis PE=3 SV=1 | 19 | 484 | 1.0E-49 |
| sp|P50138|ACT_PUCGR | Actin OS=Puccinia graminis PE=3 SV=1 | 19 | 484 | 1.0E-49 |
| sp|P02578|ACT1_ACACA | Actin-1 OS=Acanthamoeba castellanii PE=1 SV=1 | 18 | 484 | 2.0E-49 |
| sp|P20359|ACTG_EMENI | Actin, gamma OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acnA PE=3 SV=2 | 19 | 484 | 2.0E-49 |
| sp|P90689|ACT_BRUMA | Actin OS=Brugia malayi PE=1 SV=1 | 17 | 484 | 2.0E-49 |
| sp|P78711|ACT_NEUCR | Actin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=act PE=3 SV=2 | 19 | 484 | 2.0E-49 |
| sp|Q6TCF2|ACT_GAEGA | Actin OS=Gaeumannomyces graminis var. avenae GN=ACT PE=2 SV=1 | 19 | 484 | 2.0E-49 |
| sp|Q9UVW9|ACTG_ACRCH | Actin, gamma OS=Acremonium chrysogenum GN=ACT PE=3 SV=1 | 19 | 484 | 2.0E-49 |
| sp|Q9Y702|ACT1_SCHCO | Actin-1 OS=Schizophyllum commune GN=ACT1 PE=2 SV=1 | 19 | 484 | 3.0E-49 |
| sp|O13419|ACT_BOTFU | Actin OS=Botryotinia fuckeliana GN=actA PE=3 SV=1 | 19 | 484 | 4.0E-49 |
| sp|Q9UVF3|ACT_YARLI | Actin OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ACT1 PE=3 SV=2 | 19 | 484 | 5.0E-49 |
| sp|Q9P4D1|ACT_PICPG | Actin OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ACT1 PE=1 SV=1 | 18 | 484 | 5.0E-49 |
| sp|Q9URS0|ACTG_PENCH | Actin, gamma OS=Penicillium chrysogenum GN=ACT PE=3 SV=1 | 19 | 484 | 6.0E-49 |
| sp|Q54GX7|ACT10_DICDI | Actin-10 OS=Dictyostelium discoideum GN=act10 PE=1 SV=1 | 18 | 484 | 7.0E-49 |
| sp|P07830|ACT1_DICDI | Major actin OS=Dictyostelium discoideum GN=act1 PE=1 SV=2 | 18 | 484 | 8.0E-49 |
| sp|P91754|ACT_LUMRU | Actin (Fragment) OS=Lumbricus rubellus PE=2 SV=1 | 20 | 484 | 9.0E-49 |
| sp|Q9UVZ8|ACT_CANDC | Actin OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ACT1 PE=3 SV=1 | 18 | 484 | 2.0E-48 |
| sp|P14235|ACT_CANAX | Actin OS=Candida albicans GN=ACT1 PE=3 SV=1 | 18 | 484 | 2.0E-48 |
| sp|P17304|ACTM_APLCA | Actin, muscle OS=Aplysia californica PE=2 SV=1 | 19 | 484 | 2.0E-48 |
| sp|Q553U6|ACT22_DICDI | Putative actin-22 OS=Dictyostelium discoideum GN=act22 PE=3 SV=1 | 18 | 484 | 2.0E-48 |
| sp|Q9UVX4|ACT_COPC7 | Actin OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACT1 PE=3 SV=1 | 19 | 484 | 3.0E-48 |
| sp|Q964D9|ACTC_PLATR | Actin, cytoplasmic OS=Planorbella trivolvis PE=3 SV=1 | 19 | 484 | 3.0E-48 |
| sp|O17503|ACTC_BRALA | Actin, cytoplasmic OS=Branchiostoma lanceolatum PE=2 SV=1 | 19 | 484 | 3.0E-48 |
| sp|Q26065|ACT_PLAMG | Actin, adductor muscle OS=Placopecten magellanicus PE=2 SV=1 | 19 | 484 | 3.0E-48 |
| sp|P0DM42|ACT3_CAEEL | Actin-3 OS=Caenorhabditis elegans GN=act-3 PE=1 SV=1 | 19 | 484 | 3.0E-48 |
| sp|P0DM41|ACT1_CAEEL | Actin-1 OS=Caenorhabditis elegans GN=act-1 PE=1 SV=1 | 19 | 484 | 3.0E-48 |
| sp|P92176|ACT2_LUMTE | Actin-2 OS=Lumbricus terrestris GN=ACT2 PE=2 SV=1 | 19 | 484 | 4.0E-48 |
| sp|Q964E0|ACTC_BIOTE | Actin, cytoplasmic OS=Biomphalaria tenagophila PE=3 SV=1 | 19 | 484 | 4.0E-48 |
| sp|P53463|ACTM_HELER | Actin, cytoskeletal OS=Heliocidaris erythrogramma PE=3 SV=1 | 19 | 484 | 4.0E-48 |
| sp|P10989|ACT_SCHPO | Actin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=act1 PE=1 SV=1 | 19 | 484 | 4.0E-48 |
| sp|Q964E3|ACTC_BIOAL | Actin, cytoplasmic OS=Biomphalaria alexandrina PE=3 SV=1 | 19 | 484 | 5.0E-48 |
| sp|P07837|ACT2_BOMMO | Actin, muscle-type A2 OS=Bombyx mori PE=3 SV=1 | 19 | 484 | 5.0E-48 |
| sp|P45886|ACT3_BACDO | Actin-3, muscle-specific OS=Bactrocera dorsalis PE=2 SV=1 | 19 | 484 | 5.0E-48 |
| sp|P41340|ACT3_LIMPO | Actin-3 OS=Limulus polyphemus PE=1 SV=1 | 19 | 484 | 6.0E-48 |
| sp|P92182|ACT1_LUMTE | Actin-1 OS=Lumbricus terrestris GN=ACT1 PE=2 SV=1 | 19 | 484 | 7.0E-48 |
| sp|P45885|ACT2_BACDO | Actin-2, muscle-specific OS=Bactrocera dorsalis PE=2 SV=1 | 19 | 484 | 7.0E-48 |
| sp|Q9Y896|ACT2_SCHCO | Actin-2 OS=Schizophyllum commune GN=ACT2 PE=3 SV=1 | 19 | 484 | 8.0E-48 |
| sp|P53464|ACTM_HELTB | Actin, cytoskeletal OS=Heliocidaris tuberculata PE=3 SV=1 | 19 | 484 | 9.0E-48 |
| sp|Q8JJB8|ACTG_TRISC | Actin, cytoplasmic 2 OS=Triakis scyllium GN=actg1 PE=2 SV=1 | 19 | 484 | 9.0E-48 |
| sp|P68143|ACTB_OREMO | Actin, cytoplasmic 1 OS=Oreochromis mossambicus GN=actb PE=2 SV=1 | 19 | 484 | 9.0E-48 |
| sp|P68142|ACTB1_TAKRU | Actin, cytoplasmic 1 OS=Takifugu rubripes GN=actba PE=2 SV=1 | 19 | 484 | 9.0E-48 |
| sp|O17320|ACT_CRAGI | Actin OS=Crassostrea gigas PE=2 SV=1 | 17 | 484 | 1.0E-47 |
| sp|P10981|ACT5_DROME | Actin-87E OS=Drosophila melanogaster GN=Act87E PE=1 SV=1 | 19 | 484 | 1.0E-47 |
| sp|P10986|ACT4_CAEEL | Actin-4 OS=Caenorhabditis elegans GN=act-4 PE=3 SV=2 | 19 | 484 | 1.0E-47 |
| sp|P60010|ACT_YEAST | Actin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACT1 PE=1 SV=1 | 20 | 484 | 1.0E-47 |
| sp|P60011|ACT_SACBA | Actin OS=Saccharomyces bayanus GN=ACT1 PE=3 SV=1 | 20 | 484 | 1.0E-47 |
| sp|P60009|ACT_CANGA | Actin OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACT1 PE=3 SV=1 | 20 | 484 | 1.0E-47 |
| sp|Q2U7A3|ACT_ASPOR | Actin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=act1 PE=3 SV=1 | 19 | 484 | 1.0E-47 |
| sp|P02576|ACTA_PHYPO | Actin, plasmodial isoform OS=Physarum polycephalum GN=ARDA PE=1 SV=2 | 18 | 484 | 1.0E-47 |
| sp|P17128|ACT_KLULA | Actin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACT PE=3 SV=2 | 20 | 484 | 1.0E-47 |
| sp|Q25010|ACT3A_HELAM | Actin, cytoplasmic A3a OS=Helicoverpa armigera GN=actA3a PE=2 SV=1 | 19 | 484 | 1.0E-47 |
| sp|P84336|ACTB_CAMDR | Actin, cytoplasmic 1 OS=Camelus dromedarius GN=ACTB PE=1 SV=1 | 19 | 484 | 1.0E-47 |
| sp|O74258|ACT_OGAPD | Actin OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=ACT PE=3 SV=2 | 18 | 484 | 2.0E-47 |
| sp|O65314|ACT_SCHDU | Actin OS=Scherffelia dubia PE=2 SV=1 | 17 | 484 | 2.0E-47 |
| sp|Q93131|ACTC_BRAFL | Actin, cytoplasmic OS=Branchiostoma floridae PE=2 SV=1 | 19 | 484 | 2.0E-47 |
| sp|Q6NVA9|ACTB_XENTR | Actin, cytoplasmic 1 OS=Xenopus tropicalis GN=actb PE=2 SV=1 | 19 | 484 | 2.0E-47 |
| sp|O93400|ACTB_XENLA | Actin, cytoplasmic 1 OS=Xenopus laevis GN=actb PE=2 SV=1 | 19 | 484 | 2.0E-47 |
| sp|O18499|ACT1_SACKO | Actin-1 OS=Saccoglossus kowalevskii PE=2 SV=1 | 19 | 484 | 2.0E-47 |
| sp|O16808|ACT_MAYDE | Actin OS=Mayetiola destructor PE=2 SV=1 | 19 | 484 | 2.0E-47 |
| sp|Q964E1|ACTC_BIOOB | Actin, cytoplasmic OS=Biomphalaria obstructa PE=3 SV=1 | 19 | 484 | 2.0E-47 |
| sp|O42161|ACTB_SALSA | Actin, cytoplasmic 1 OS=Salmo salar GN=actb PE=2 SV=1 | 19 | 484 | 2.0E-47 |
| sp|P10984|ACT2_CAEEL | Actin-2 OS=Caenorhabditis elegans GN=act-2 PE=3 SV=3 | 19 | 484 | 2.0E-47 |
| sp|P26197|ACT2_ABSGL | Actin-2 OS=Absidia glauca GN=ACT2 PE=3 SV=1 | 19 | 484 | 2.0E-47 |
| sp|P18603|ACT4_ARTSX | Actin, clone 403 OS=Artemia sp. PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|Q93129|ACTC_BRABE | Actin, cytoplasmic OS=Branchiostoma belcheri PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|P60707|ACTB_TRIVU | Actin, cytoplasmic 1 OS=Trichosurus vulpecula GN=ACTB PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|Q4L0Y2|ACTB_SPECI | Actin, cytoplasmic 1 OS=Spermophilus citellus GN=ACTB PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|P60713|ACTB_SHEEP | Actin, cytoplasmic 1 OS=Ovis aries GN=ACTB PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|P60711|ACTB_RAT | Actin, cytoplasmic 1 OS=Rattus norvegicus GN=Actb PE=1 SV=1 | 19 | 484 | 3.0E-47 |
| sp|Q5R6G0|ACTB_PONAB | Actin, cytoplasmic 1 OS=Pongo abelii GN=ACTB PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|Q6QAQ1|ACTB_PIG | Actin, cytoplasmic 1 OS=Sus scrofa GN=ACTB PE=1 SV=2 | 19 | 484 | 3.0E-47 |
| sp|Q5R1X3|ACTB_PANTR | Actin, cytoplasmic 1 OS=Pan troglodytes GN=ACTB PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|P60710|ACTB_MOUSE | Actin, cytoplasmic 1 OS=Mus musculus GN=Actb PE=1 SV=1 | 19 | 484 | 3.0E-47 |
| sp|Q711N9|ACTB_MESAU | Actin, cytoplasmic 1 OS=Mesocricetus auratus GN=ACTB PE=1 SV=1 | 19 | 484 | 3.0E-47 |
| sp|Q4R561|ACTB_MACFA | Actin, cytoplasmic 1 OS=Macaca fascicularis GN=ACTB PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|P60709|ACTB_HUMAN | Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1 | 19 | 484 | 3.0E-47 |
| sp|P60708|ACTB_HORSE | Actin, cytoplasmic 1 OS=Equus caballus GN=ACTB PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|Q76N69|ACTB_CHLAE | Actin, cytoplasmic 1 OS=Chlorocebus aethiops GN=ACTB PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|P60706|ACTB_CHICK | Actin, cytoplasmic 1 OS=Gallus gallus GN=ACTB PE=1 SV=1 | 19 | 484 | 3.0E-47 |
| sp|Q71FK5|ACTB_CAVPO | Actin, cytoplasmic 1 OS=Cavia porcellus GN=ACTB PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|O18840|ACTB_CANLF | Actin, cytoplasmic 1 OS=Canis lupus familiaris GN=ACTB PE=2 SV=3 | 19 | 484 | 3.0E-47 |
| sp|P60712|ACTB_BOVIN | Actin, cytoplasmic 1 OS=Bos taurus GN=ACTB PE=1 SV=1 | 19 | 484 | 3.0E-47 |
| sp|Q9Y701|ACT1_SUIBO | Actin-1 OS=Suillus bovinus GN=ACT1 PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|P79818|ACTB_ORYLA | Actin, cytoplasmic 1 OS=Oryzias latipes GN=actb PE=2 SV=2 | 19 | 484 | 3.0E-47 |
| sp|P84185|ACT5C_ANOGA | Actin-5C OS=Anopheles gambiae GN=Act5C PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|P84183|ACT4_BOMMO | Actin, cytoplasmic A4 OS=Bombyx mori GN=A4 PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|P84184|ACT3B_HELAM | Actin-A3b, cytoplasmic OS=Helicoverpa armigera GN=actA3b PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|P10987|ACT1_DROME | Actin-5C OS=Drosophila melanogaster GN=Act5C PE=1 SV=4 | 19 | 484 | 3.0E-47 |
| sp|P02572|ACT2_DROME | Actin-42A OS=Drosophila melanogaster GN=Act42A PE=1 SV=3 | 19 | 484 | 3.0E-47 |
| sp|Q75D00|ACT_ASHGO | Actin OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACT1 PE=2 SV=1 | 20 | 484 | 3.0E-47 |
| sp|Q91ZK5|ACTB_SIGHI | Actin, cytoplasmic 1 OS=Sigmodon hispidus GN=ACTB PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|P53500|ACT_CYAME | Actin OS=Cyanidioschyzon merolae PE=3 SV=1 | 19 | 484 | 3.0E-47 |
| sp|P18600|ACT1_ARTSX | Actin, clone 205 OS=Artemia sp. PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|P83750|ACTB_CYPCA | Actin, cytoplasmic 1 OS=Cyprinus carpio GN=actb PE=3 SV=1 | 19 | 484 | 3.0E-47 |
| sp|P83751|ACTB_CTEID | Actin, cytoplasmic 1 OS=Ctenopharyngodon idella GN=actb PE=3 SV=1 | 19 | 484 | 3.0E-47 |
| sp|Q7ZVF9|ACTB2_DANRE | Actin, cytoplasmic 2 OS=Danio rerio GN=actbb PE=2 SV=2 | 19 | 484 | 3.0E-47 |
| sp|P53505|ACT5_XENLA | Actin, cytoplasmic type 5 OS=Xenopus laevis PE=3 SV=1 | 19 | 484 | 3.0E-47 |
| sp|P92179|ACTC_BIOGL | Actin, cytoplasmic OS=Biomphalaria glabrata PE=2 SV=2 | 19 | 484 | 3.0E-47 |
| sp|Q5JAK2|ACTG_PELLE | Actin, cytoplasmic 2 OS=Pelophylax lessonae GN=actg1 PE=2 SV=1 | 19 | 484 | 3.0E-47 |
| sp|A2BDB0|ACTG_XENLA | Actin, cytoplasmic 2 OS=Xenopus laevis GN=actg1 PE=2 SV=1 | 19 | 484 | 4.0E-47 |
| sp|P63257|ACTG_TRIVU | Actin, cytoplasmic 2 OS=Trichosurus vulpecula GN=ACTG1 PE=2 SV=1 | 19 | 484 | 4.0E-47 |
| sp|P63259|ACTG_RAT | Actin, cytoplasmic 2 OS=Rattus norvegicus GN=Actg1 PE=1 SV=1 | 19 | 484 | 4.0E-47 |
| sp|P63260|ACTG_MOUSE | Actin, cytoplasmic 2 OS=Mus musculus GN=Actg1 PE=1 SV=1 | 19 | 484 | 4.0E-47 |
| sp|P63261|ACTG_HUMAN | Actin, cytoplasmic 2 OS=Homo sapiens GN=ACTG1 PE=1 SV=1 | 19 | 484 | 4.0E-47 |
| sp|Q5ZMQ2|ACTG_CHICK | Actin, cytoplasmic 2 OS=Gallus gallus GN=ACTG1 PE=1 SV=1 | 19 | 484 | 4.0E-47 |
| sp|P63258|ACTG_BOVIN | Actin, cytoplasmic 2 OS=Bos taurus GN=ACTG1 PE=1 SV=1 | 19 | 484 | 4.0E-47 |
| sp|P53486|ACTB3_TAKRU | Actin, cytoplasmic 3 OS=Takifugu rubripes GN=actbc PE=2 SV=1 | 19 | 484 | 4.0E-47 |
| sp|P53506|ACT8_XENLA | Actin, cytoplasmic type 8 OS=Xenopus laevis PE=3 SV=1 | 19 | 484 | 4.0E-47 |
| sp|P53501|ACT3_DROME | Actin-57B OS=Drosophila melanogaster GN=Act57B PE=1 SV=1 | 19 | 484 | 4.0E-47 |
| sp|Q964E2|ACTC_BIOPF | Actin, cytoplasmic OS=Biomphalaria pfeifferi PE=3 SV=1 | 19 | 484 | 4.0E-47 |
| sp|Q6P378|ACTG_XENTR | Actin, cytoplasmic 2 OS=Xenopus tropicalis GN=actg1 PE=2 SV=1 | 19 | 484 | 5.0E-47 |
| sp|P29751|ACTB_RABIT | Actin, cytoplasmic 1 OS=Oryctolagus cuniculus GN=ACTB PE=2 SV=1 | 19 | 484 | 5.0E-47 |
| sp|P53485|ACTB2_TAKRU | Actin, cytoplasmic 2 OS=Takifugu rubripes GN=actbb PE=3 SV=1 | 19 | 484 | 5.0E-47 |
| sp|O65315|ACT_COLSC | Actin OS=Coleochaete scutata PE=2 SV=1 | 18 | 484 | 5.0E-47 |
| sp|P53478|ACT5_CHICK | Actin, cytoplasmic type 5 OS=Gallus gallus PE=3 SV=1 | 19 | 484 | 6.0E-47 |
| sp|P53472|ACTA_STRPU | Actin, cytoskeletal 1A OS=Strongylocentrotus purpuratus GN=CYIA PE=3 SV=1 | 19 | 484 | 6.0E-47 |
| sp|P68555|ACT_TAESO | Actin OS=Taenia solium GN=ACT1 PE=3 SV=1 | 17 | 484 | 6.0E-47 |
| sp|P18601|ACT2_ARTSX | Actin, clone 211 OS=Artemia sp. PE=2 SV=1 | 19 | 484 | 6.0E-47 |
| sp|P68556|ACT1_DIPDE | Actin-1/4 OS=Diphyllobothrium dendriticum GN=ACT1 PE=2 SV=1 | 17 | 484 | 6.0E-47 |
| sp|P04829|ACT3_BOMMO | Actin, cytoplasmic A3 OS=Bombyx mori PE=3 SV=3 | 19 | 484 | 8.0E-47 |
| sp|P30162|ACT1_ONCVO | Actin-1 OS=Onchocerca volvulus GN=act-1a PE=3 SV=1 | 19 | 484 | 8.0E-47 |
| sp|P69003|ACT1_HELTB | Actin CyI, cytoplasmic OS=Heliocidaris tuberculata PE=3 SV=1 | 19 | 484 | 8.0E-47 |
| sp|P69002|ACT1_HELER | Actin CyI, cytoplasmic OS=Heliocidaris erythrogramma PE=3 SV=1 | 19 | 484 | 8.0E-47 |
| sp|P53471|ACT2_SCHMA | Actin-2 OS=Schistosoma mansoni PE=2 SV=1 | 19 | 484 | 8.0E-47 |
| sp|P49871|ACT_MANSE | Actin, muscle OS=Manduca sexta PE=2 SV=1 | 19 | 484 | 9.0E-47 |
| sp|P48975|ACTB_CRIGR | Actin, cytoplasmic 1 OS=Cricetulus griseus GN=ACTB PE=3 SV=1 | 19 | 484 | 1.0E-46 |
| sp|P69005|ACTD_STRPU | Actin, cytoskeletal 2B OS=Strongylocentrotus purpuratus GN=CYIIB PE=2 SV=1 | 19 | 484 | 1.0E-46 |
| sp|P69004|ACT2_STRFN | Actin-15B OS=Strongylocentrotus franciscanus PE=2 SV=1 | 19 | 484 | 1.0E-46 |
| sp|P53466|ACT2_LYTPI | Actin, cytoskeletal 2 OS=Lytechinus pictus PE=2 SV=1 | 19 | 484 | 1.0E-46 |
| sp|Q9Y707|ACT2_SUIBO | Actin-2 OS=Suillus bovinus GN=ACT2 PE=2 SV=1 | 19 | 484 | 1.0E-46 |
| sp|P20904|ACT_VOLCA | Actin OS=Volvox carteri PE=3 SV=1 | 20 | 484 | 1.0E-46 |
| sp|P17126|ACT_HYDVU | Actin, non-muscle 6.2 OS=Hydra vulgaris PE=3 SV=1 | 19 | 484 | 1.0E-46 |
| sp|P10990|ACT1_STRFN | Actin-15A OS=Strongylocentrotus franciscanus PE=3 SV=1 | 19 | 484 | 1.0E-46 |
| sp|Q7ZVI7|ACTB1_DANRE | Actin, cytoplasmic 1 OS=Danio rerio GN=actba PE=2 SV=2 | 19 | 484 | 2.0E-46 |
| sp|P53456|ACT2_DIPDE | Actin-2 OS=Diphyllobothrium dendriticum GN=ACT2 PE=2 SV=1 | 17 | 484 | 2.0E-46 |
| sp|P15475|ACTB_XENBO | Actin, cytoplasmic 1 OS=Xenopus borealis GN=actb PE=3 SV=1 | 19 | 484 | 2.0E-46 |
| sp|Q0PGG4|ACTB_BOSMU | Actin, cytoplasmic 1 OS=Bos mutus grunniens GN=ACTB PE=2 SV=1 | 19 | 484 | 2.0E-46 |
| sp|P30163|ACT2_ONCVO | Actin-2 OS=Onchocerca volvulus GN=act-2b PE=3 SV=1 | 19 | 484 | 2.0E-46 |
| sp|P07829|ACT3_DICDI | Actin-3 OS=Dictyostelium discoideum GN=act3 PE=3 SV=3 | 19 | 484 | 3.0E-46 |
| sp|Q7RME1|ACT1_PLAYO | Actin-1 OS=Plasmodium yoelii yoelii GN=PY02240 PE=3 SV=1 | 17 | 484 | 3.0E-46 |
| sp|P53498|ACT_CHLRE | Actin OS=Chlamydomonas reinhardtii PE=2 SV=1 | 20 | 484 | 3.0E-46 |
| sp|P45887|ACT5_BACDO | Actin-5, muscle-specific OS=Bactrocera dorsalis PE=2 SV=1 | 19 | 484 | 3.0E-46 |
| sp|P07836|ACT1_BOMMO | Actin, muscle-type A1 OS=Bombyx mori PE=3 SV=1 | 19 | 484 | 3.0E-46 |
| sp|Q03341|ACT2_ECHGR | Actin-2 OS=Echinococcus granulosus GN=ACTII PE=3 SV=1 | 19 | 484 | 3.0E-46 |
| sp|P0C540|ACT7_ORYSJ | Actin-7 OS=Oryza sativa subsp. japonica GN=ACT7 PE=3 SV=1 | 19 | 484 | 3.0E-46 |
| sp|P0C542|ACT7_ORYSI | Actin-7 OS=Oryza sativa subsp. indica GN=ACT7 PE=3 SV=1 | 19 | 484 | 3.0E-46 |
| sp|P41113|ACT3_PODCA | Actin-3 OS=Podocoryna carnea GN=ACT3 PE=3 SV=1 | 19 | 484 | 4.0E-46 |
| sp|P53470|ACT1_SCHMA | Actin-1 OS=Schistosoma mansoni PE=2 SV=1 | 19 | 484 | 4.0E-46 |
| sp|P83968|ACT6_DROSI | Actin, indirect flight muscle OS=Drosophila simulans GN=Act88F PE=3 SV=1 | 19 | 484 | 5.0E-46 |
| sp|P83967|ACT6_DROME | Actin, indirect flight muscle OS=Drosophila melanogaster GN=Act88F PE=1 SV=1 | 19 | 484 | 5.0E-46 |
| sp|P83969|ACT1_BACDO | Actin, indirect flight muscle OS=Bactrocera dorsalis PE=3 SV=1 | 19 | 484 | 5.0E-46 |
| sp|P41112|ACT1_PODCA | Actin-1/2 OS=Podocoryna carnea GN=ACTIA PE=2 SV=1 | 19 | 484 | 6.0E-46 |
| sp|Q4Z1L3|ACT1_PLABA | Actin-1 OS=Plasmodium berghei (strain Anka) GN=PB000323.01.0 PE=1 SV=1 | 17 | 484 | 6.0E-46 |
| sp|P41339|ACTA_LIMPO | Actin, acrosomal process isoform OS=Limulus polyphemus PE=2 SV=1 | 19 | 484 | 6.0E-46 |
| sp|P18499|ACTF_STRPU | Actin, cytoskeletal 3B OS=Strongylocentrotus purpuratus GN=CYIIIB PE=2 SV=1 | 19 | 484 | 6.0E-46 |
| sp|P53458|ACT5_DIPDE | Actin-5 (Fragment) OS=Diphyllobothrium dendriticum GN=ACT5 PE=2 SV=1 | 21 | 484 | 6.0E-46 |
| sp|P41341|ACTY_LIMPO | Actin-11 OS=Limulus polyphemus PE=2 SV=1 | 19 | 484 | 6.0E-46 |
| sp|Q6P8G3|ACT3_XENTR | Actin, alpha sarcomeric/skeletal OS=Xenopus tropicalis GN=act3 PE=2 SV=1 | 19 | 484 | 7.0E-46 |
| sp|P12716|ACTC_PISOC | Actin, cytoplasmic OS=Pisaster ochraceus PE=3 SV=1 | 19 | 484 | 8.0E-46 |
| sp|P26182|ACT_ACHBI | Actin OS=Achlya bisexualis PE=3 SV=1 | 19 | 484 | 9.0E-46 |
| sp|P24263|ACTD_PHYPO | Actin, spherule isoform OS=Physarum polycephalum GN=ARDD PE=2 SV=2 | 20 | 484 | 9.0E-46 |
| sp|P53461|ACTC_HALRO | Actin, nonmuscle OS=Halocynthia roretzi GN=CA1 PE=3 SV=1 | 19 | 484 | 9.0E-46 |
| sp|O18500|ACT2_SACKO | Actin-2 OS=Saccoglossus kowalevskii PE=2 SV=1 | 19 | 484 | 1.0E-45 |
| sp|A3C6D7|ACT2_ORYSJ | Actin-2 OS=Oryza sativa subsp. japonica GN=ACT2 PE=2 SV=1 | 18 | 484 | 1.0E-45 |
| sp|P0C539|ACT2_ORYSI | Actin-2 OS=Oryza sativa subsp. indica GN=ACT2 PE=3 SV=1 | 18 | 484 | 1.0E-45 |
| sp|P30171|ACT11_SOLTU | Actin-97 OS=Solanum tuberosum GN=AC97 PE=3 SV=1 | 18 | 484 | 1.0E-45 |
| sp|Q8SWN8|ACT_ENCCU | Actin OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0460 PE=1 SV=2 | 21 | 484 | 1.0E-45 |
| sp|P53476|ACT_TOXGO | Actin OS=Toxoplasma gondii GN=ACT1 PE=3 SV=1 | 19 | 484 | 1.0E-45 |
| sp|P86287|ACT1_PLAFX | Actin-1 OS=Plasmodium falciparum (isolate HB3) PE=1 SV=1 | 17 | 484 | 1.0E-45 |
| sp|Q8I4X0|ACT1_PLAF7 | Actin-1 OS=Plasmodium falciparum (isolate 3D7) GN=PFL2215w PE=3 SV=1 | 17 | 484 | 1.0E-45 |
| sp|P04752|ACT3_XENLA | Actin, alpha skeletal muscle 3 OS=Xenopus laevis GN=act3 PE=2 SV=2 | 19 | 484 | 1.0E-45 |
| sp|P53473|ACTB_STRPU | Actin, cytoskeletal 1B OS=Strongylocentrotus purpuratus GN=CYIB PE=3 SV=1 | 19 | 484 | 1.0E-45 |
| sp|Q10AZ4|ACT3_ORYSJ | Actin-3 OS=Oryza sativa subsp. japonica GN=ACT3 PE=2 SV=1 | 18 | 484 | 1.0E-45 |
| sp|A2XNS1|ACT3_ORYSI | Actin-3 OS=Oryza sativa subsp. indica GN=ACT3 PE=3 SV=2 | 18 | 484 | 1.0E-45 |
| sp|P53459|ACT6_DIPDE | Actin-6 (Fragment) OS=Diphyllobothrium dendriticum GN=ACT6 PE=2 SV=1 | 19 | 484 | 2.0E-45 |
| sp|P53497|ACT12_ARATH | Actin-12 OS=Arabidopsis thaliana GN=ACT12 PE=1 SV=1 | 18 | 484 | 2.0E-45 |
| sp|O81221|ACT_GOSHI | Actin OS=Gossypium hirsutum PE=3 SV=1 | 18 | 484 | 2.0E-45 |
| sp|P53457|ACT3_DIPDE | Actin-3 OS=Diphyllobothrium dendriticum GN=ACT3 PE=2 SV=1 | 19 | 484 | 2.0E-45 |
| sp|P63256|ACTG_ANSAN | Actin, cytoplasmic 2 OS=Anser anser anser GN=ACTG1 PE=2 SV=1 | 19 | 484 | 2.0E-45 |
| sp|P02574|ACT4_DROME | Actin, larval muscle OS=Drosophila melanogaster GN=Act79B PE=1 SV=2 | 19 | 484 | 2.0E-45 |
| sp|P26183|ACT_CRYPV | Actin OS=Cryptosporidium parvum PE=3 SV=1 | 19 | 484 | 3.0E-45 |
| sp|Q00215|ACTC_STYPL | Actin, cytoplasmic OS=Styela plicata PE=3 SV=1 | 19 | 484 | 3.0E-45 |
| sp|P12717|ACTM_PISOC | Actin, muscle OS=Pisaster ochraceus PE=3 SV=1 | 19 | 484 | 4.0E-45 |
| sp|P11426|ACT_ENTHI | Actin OS=Entamoeba histolytica PE=2 SV=1 | 17 | 484 | 4.0E-45 |
| sp|P04751|ACTC_XENLA | Actin, alpha cardiac muscle 1 OS=Xenopus laevis GN=actc1 PE=2 SV=1 | 19 | 484 | 4.0E-45 |
| sp|P0CJ47|ACT3_ARATH | Actin-3 OS=Arabidopsis thaliana GN=ACT3 PE=1 SV=1 | 18 | 484 | 4.0E-45 |
| sp|P0CJ46|ACT1_ARATH | Actin-1 OS=Arabidopsis thaliana GN=ACT1 PE=1 SV=1 | 18 | 484 | 4.0E-45 |
| sp|P53474|ACTE_STRPU | Actin, cytoskeletal 3A OS=Strongylocentrotus purpuratus GN=CYIIIA PE=3 SV=1 | 19 | 484 | 4.0E-45 |
| sp|P22131|ACT1_PHYIN | Actin-1 OS=Phytophthora infestans GN=ACTA PE=2 SV=1 | 19 | 484 | 4.0E-45 |
| sp|Q562R1|ACTBL_HUMAN | Beta-actin-like protein 2 OS=Homo sapiens GN=ACTBL2 PE=1 SV=2 | 19 | 484 | 4.0E-45 |
| sp|P53496|ACT11_ARATH | Actin-11 OS=Arabidopsis thaliana GN=ACT11 PE=1 SV=1 | 18 | 484 | 5.0E-45 |
| sp|Q99023|ACT_HYPJE | Actin OS=Hypocrea jecorina GN=act PE=3 SV=1 | 19 | 484 | 5.0E-45 |
| sp|Q96293|ACT8_ARATH | Actin-8 OS=Arabidopsis thaliana GN=ACT8 PE=1 SV=2 | 18 | 484 | 5.0E-45 |
| sp|P53494|ACT4_ARATH | Actin-4 OS=Arabidopsis thaliana GN=ACT4 PE=1 SV=1 | 18 | 484 | 5.0E-45 |
| sp|Q96292|ACT2_ARATH | Actin-2 OS=Arabidopsis thaliana GN=ACT2 PE=1 SV=1 | 18 | 484 | 5.0E-45 |
| sp|P68264|ACTS_OREMO | Actin, alpha skeletal muscle OS=Oreochromis mossambicus GN=acta1 PE=2 SV=1 | 19 | 484 | 7.0E-45 |
| sp|P68140|ACTSA_TAKRU | Actin, alpha skeletal muscle A OS=Takifugu rubripes GN=acta1a PE=2 SV=1 | 19 | 484 | 7.0E-45 |
| sp|P53480|ACTC_TAKRU | Actin, alpha cardiac OS=Takifugu rubripes PE=2 SV=1 | 19 | 484 | 7.0E-45 |
| sp|P30167|ACT3_SOLTU | Actin-58 OS=Solanum tuberosum GN=AC58 PE=3 SV=1 | 18 | 484 | 8.0E-45 |
| sp|Q7RPB4|ACT2_PLAYO | Actin-2 OS=Plasmodium yoelii yoelii GN=PY01545 PE=3 SV=1 | 19 | 484 | 8.0E-45 |
| sp|P53482|ACTSB_TAKRU | Actin, alpha skeletal muscle B OS=Takifugu rubripes GN=acta1b PE=2 SV=1 | 19 | 484 | 9.0E-45 |
| sp|P10988|ACT1_PLAFO | Actin-1 OS=Plasmodium falciparum (isolate NF54) PE=2 SV=1 | 17 | 484 | 1.0E-44 |
| sp|P10995|ACT2_XENLA | Actin, alpha skeletal muscle 2 OS=Xenopus laevis GN=act2 PE=2 SV=1 | 19 | 484 | 1.0E-44 |
| sp|P68136|ACTS_RAT | Actin, alpha skeletal muscle OS=Rattus norvegicus GN=Acta1 PE=1 SV=1 | 19 | 484 | 1.0E-44 |
| sp|P68135|ACTS_RABIT | Actin, alpha skeletal muscle OS=Oryctolagus cuniculus GN=ACTA1 PE=1 SV=1 | 19 | 484 | 1.0E-44 |
| sp|Q5R9Q5|ACTS_PONAB | Actin, alpha skeletal muscle OS=Pongo abelii GN=ACTA1 PE=2 SV=1 | 19 | 484 | 1.0E-44 |
| sp|P68137|ACTS_PIG | Actin, alpha skeletal muscle OS=Sus scrofa GN=ACTA1 PE=3 SV=1 | 19 | 484 | 1.0E-44 |
| sp|P68134|ACTS_MOUSE | Actin, alpha skeletal muscle OS=Mus musculus GN=Acta1 PE=1 SV=1 | 19 | 484 | 1.0E-44 |
| sp|P68133|ACTS_HUMAN | Actin, alpha skeletal muscle OS=Homo sapiens GN=ACTA1 PE=1 SV=1 | 19 | 484 | 1.0E-44 |
| sp|P68139|ACTS_CHICK | Actin, alpha skeletal muscle OS=Gallus gallus GN=ACTA1 PE=1 SV=1 | 19 | 484 | 1.0E-44 |
| sp|P68138|ACTS_BOVIN | Actin, alpha skeletal muscle OS=Bos taurus GN=ACTA1 PE=1 SV=1 | 19 | 484 | 1.0E-44 |
| sp|Q4YU79|ACT2_PLABA | Actin-2 OS=Plasmodium berghei (strain Anka) GN=PB001050.02.0 PE=1 SV=1 | 19 | 484 | 2.0E-44 |
| sp|Q07903|ACTC_STRPU | Actin, cytoskeletal 2A OS=Strongylocentrotus purpuratus GN=CYIIA PE=2 SV=1 | 19 | 484 | 2.0E-44 |
| sp|P53479|ACTS_CYPCA | Actin, alpha skeletal muscle OS=Cyprinus carpio GN=acta1 PE=2 SV=1 | 19 | 484 | 2.0E-44 |
| sp|P53465|ACT1_LYTPI | Actin, cytoskeletal 1 OS=Lytechinus pictus PE=2 SV=1 | 19 | 484 | 2.0E-44 |
| sp|Q39758|ACT_FUCVE | Actin OS=Fucus vesiculosus PE=2 SV=1 | 19 | 484 | 2.0E-44 |
| sp|P49128|ACT1_AEDAE | Actin-1 OS=Aedes aegypti GN=ACT-1 PE=2 SV=2 | 19 | 484 | 2.0E-44 |
| sp|O65316|ACT_MESVI | Actin OS=Mesostigma viride PE=3 SV=1 | 20 | 484 | 2.0E-44 |
| sp|P53492|ACT7_ARATH | Actin-7 OS=Arabidopsis thaliana GN=ACT7 PE=1 SV=1 | 18 | 484 | 2.0E-44 |
| sp|P49055|ACTS_CARAU | Actin, alpha skeletal muscle OS=Carassius auratus GN=acta1 PE=2 SV=1 | 19 | 484 | 2.0E-44 |
| sp|P86288|ACT2_PLAFX | Actin-2 OS=Plasmodium falciparum (isolate HB3) PE=3 SV=1 | 19 | 484 | 2.0E-44 |
| sp|Q8ILW9|ACT2_PLAF7 | Actin-2 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0124 PE=3 SV=1 | 19 | 484 | 2.0E-44 |
| sp|Q6P640|ACTC_XENTR | Actin, alpha cardiac muscle 1 OS=Xenopus tropicalis GN=actc1 PE=2 SV=1 | 19 | 484 | 3.0E-44 |
| sp|P68035|ACTC_RAT | Actin, alpha cardiac muscle 1 OS=Rattus norvegicus GN=Actc1 PE=2 SV=1 | 19 | 484 | 3.0E-44 |
| sp|P68033|ACTC_MOUSE | Actin, alpha cardiac muscle 1 OS=Mus musculus GN=Actc1 PE=1 SV=1 | 19 | 484 | 3.0E-44 |
| sp|P68032|ACTC_HUMAN | Actin, alpha cardiac muscle 1 OS=Homo sapiens GN=ACTC1 PE=1 SV=1 | 19 | 484 | 3.0E-44 |
| sp|P68034|ACTC_CHICK | Actin, alpha cardiac muscle 1 OS=Gallus gallus GN=ACTC1 PE=3 SV=1 | 19 | 484 | 3.0E-44 |
| sp|Q3ZC07|ACTC_BOVIN | Actin, alpha cardiac muscle 1 OS=Bos taurus GN=ACTC1 PE=2 SV=1 | 19 | 484 | 3.0E-44 |
| sp|Q8BFZ3|ACTBL_MOUSE | Beta-actin-like protein 2 OS=Mus musculus GN=Actbl2 PE=1 SV=1 | 19 | 484 | 3.0E-44 |
| sp|P27131|ACT1_NAEFO | Actin-1 OS=Naegleria fowleri PE=2 SV=2 | 19 | 483 | 3.0E-44 |
| sp|Q25472|ACT2_MOLOC | Actin, muscle-type OS=Molgula oculata PE=3 SV=1 | 19 | 484 | 3.0E-44 |
| sp|Q10DV7|ACT1_ORYSJ | Actin-1 OS=Oryza sativa subsp. japonica GN=ACT1 PE=2 SV=1 | 18 | 484 | 3.0E-44 |
| sp|A2XLF2|ACT1_ORYSI | Actin-1 OS=Oryza sativa subsp. indica GN=ACT1 PE=2 SV=1 | 18 | 484 | 3.0E-44 |
| sp|Q98972|ACTS_ORYLA | Actin, alpha skeletal muscle OS=Oryzias latipes GN=acta1 PE=2 SV=1 | 19 | 484 | 3.0E-44 |
| sp|P14883|ACT2_PLAFO | Actin-2 OS=Plasmodium falciparum (isolate NF54) PE=2 SV=1 | 19 | 484 | 5.0E-44 |
| sp|P30173|ACT13_SOLTU | Actin-101 OS=Solanum tuberosum GN=AC101 PE=3 SV=1 | 18 | 484 | 5.0E-44 |
| sp|P20399|ACT2_XENTR | Actin, alpha cardiac muscle 2 OS=Xenopus tropicalis PE=2 SV=1 | 19 | 484 | 7.0E-44 |
| sp|Q05214|ACT1_TOBAC | Actin OS=Nicotiana tabacum PE=3 SV=1 | 18 | 484 | 8.0E-44 |
| sp|P35432|ACT1_ECHGR | Actin-1 OS=Echinococcus granulosus GN=ACTI PE=3 SV=1 | 18 | 484 | 9.0E-44 |
| sp|Q8RYC2|ACT5_ARATH | Putative actin-5 OS=Arabidopsis thaliana GN=ACT5 PE=5 SV=1 | 18 | 484 | 9.0E-44 |
| sp|P08023|ACTA_CHICK | Actin, aortic smooth muscle OS=Gallus gallus GN=ACTA2 PE=1 SV=2 | 19 | 484 | 1.0E-43 |
| sp|Q90X97|ACTS_ATRMM | Actin, alpha skeletal muscle OS=Atractaspis microlepidota microlepidota GN=ACTA1 PE=2 SV=1 | 19 | 484 | 1.0E-43 |
| sp|P63269|ACTH_RAT | Actin, gamma-enteric smooth muscle OS=Rattus norvegicus GN=Actg2 PE=2 SV=1 | 19 | 484 | 1.0E-43 |
| sp|P63268|ACTH_MOUSE | Actin, gamma-enteric smooth muscle OS=Mus musculus GN=Actg2 PE=1 SV=1 | 19 | 484 | 1.0E-43 |
| sp|P63267|ACTH_HUMAN | Actin, gamma-enteric smooth muscle OS=Homo sapiens GN=ACTG2 PE=1 SV=1 | 19 | 484 | 1.0E-43 |
| sp|P63270|ACTH_CHICK | Actin, gamma-enteric smooth muscle OS=Gallus gallus GN=ACTG2 PE=1 SV=1 | 19 | 484 | 1.0E-43 |
| sp|Q5E9B5|ACTH_BOVIN | Actin, gamma-enteric smooth muscle OS=Bos taurus GN=ACTG2 PE=2 SV=1 | 19 | 484 | 1.0E-43 |
| sp|P62738|ACTA_RAT | Actin, aortic smooth muscle OS=Rattus norvegicus GN=Acta2 PE=2 SV=1 | 19 | 484 | 2.0E-43 |
| sp|P62740|ACTA_RABIT | Actin, aortic smooth muscle OS=Oryctolagus cuniculus GN=ACTA2 PE=2 SV=1 | 19 | 484 | 2.0E-43 |
| sp|P62737|ACTA_MOUSE | Actin, aortic smooth muscle OS=Mus musculus GN=Acta2 PE=1 SV=1 | 19 | 484 | 2.0E-43 |
| sp|P62736|ACTA_HUMAN | Actin, aortic smooth muscle OS=Homo sapiens GN=ACTA2 PE=1 SV=1 | 19 | 484 | 2.0E-43 |
| sp|P62739|ACTA_BOVIN | Actin, aortic smooth muscle OS=Bos taurus GN=ACTA2 PE=1 SV=1 | 19 | 484 | 2.0E-43 |
| sp|P46258|ACT3_PEA | Actin-3 OS=Pisum sativum PE=2 SV=1 | 18 | 484 | 3.0E-43 |
| sp|P27130|ACT2_HALRO | Actin, muscle 2/4/4A OS=Halocynthia roretzi GN=MA2 PE=2 SV=1 | 17 | 484 | 4.0E-43 |
| sp|P51775|ACT_GIAIN | Actin OS=Giardia intestinalis PE=3 SV=1 | 19 | 484 | 4.0E-43 |
| sp|P53475|ACTN_STYCL | Actin, muscle OS=Styela clava GN=TB12 PE=2 SV=1 | 17 | 484 | 5.0E-43 |
| sp|Q554S6|ACT17_DICDI | Actin-17 OS=Dictyostelium discoideum GN=act17 PE=3 SV=1 | 20 | 484 | 6.0E-43 |
| sp|P13363|ACT_PHYME | Actin OS=Phytophthora megasperma PE=3 SV=1 | 19 | 484 | 8.0E-43 |
| sp|P26198|ACTM_STYCL | Actin, muscle OS=Styela clava PE=2 SV=1 | 17 | 484 | 8.0E-43 |
| sp|P02581|ACT1_SOYBN | Actin-1 OS=Glycine max GN=SAC1 PE=3 SV=2 | 19 | 484 | 8.0E-43 |
| sp|P22132|ACT2_PHYIN | Actin-2 OS=Phytophthora infestans GN=ACTB PE=2 SV=1 | 19 | 484 | 1.0E-42 |
| sp|A5DQP9|ACT_PICGU | Actin OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ACT1 PE=3 SV=1 | 33 | 484 | 2.0E-42 |
| sp|O15998|ACTM_CIOSA | Actin, muscle OS=Ciona savignyi PE=2 SV=1 | 22 | 484 | 3.0E-42 |
| sp|P30164|ACT1_PEA | Actin-1 OS=Pisum sativum PE=2 SV=1 | 18 | 484 | 7.0E-42 |
| sp|O17502|ACTM_BRALA | Actin, muscle OS=Branchiostoma lanceolatum PE=2 SV=1 | 19 | 484 | 8.0E-42 |
| sp|P53467|ACTM_MOLOC | Actin, larval muscle-type OS=Molgula oculata PE=3 SV=1 | 22 | 484 | 8.0E-42 |
| sp|P84856|ACTB_CHLPG | Actin, cytoplasmic 1 OS=Chlorocebus pygerythrus GN=ACTB PE=1 SV=1 | 33 | 484 | 8.0E-42 |
| sp|P30172|ACT12_SOLTU | Actin-100 (Fragment) OS=Solanum tuberosum GN=AC100 PE=3 SV=1 | 35 | 484 | 1.0E-41 |
| sp|P42025|ACTY_HUMAN | Beta-centractin OS=Homo sapiens GN=ACTR1B PE=1 SV=1 | 24 | 484 | 1.0E-41 |
| sp|P30165|ACT2_PEA | Actin-2 OS=Pisum sativum PE=2 SV=1 | 18 | 484 | 1.0E-41 |
| sp|Q93132|ACTM_BRAFL | Actin, muscle OS=Branchiostoma floridae PE=2 SV=1 | 19 | 484 | 1.0E-41 |
| sp|P30168|ACT6_SOLTU | Actin-71 OS=Solanum tuberosum GN=AC71 PE=3 SV=2 | 19 | 484 | 2.0E-41 |
| sp|P53460|ACT1_HALRO | Actin, muscle 1A OS=Halocynthia roretzi GN=MA1A PE=3 SV=1 | 17 | 484 | 2.0E-41 |
| sp|P23343|ACT1_DAUCA | Actin-1 OS=Daucus carota PE=2 SV=1 | 18 | 484 | 3.0E-41 |
| sp|Q93130|ACTM_BRABE | Actin, muscle OS=Branchiostoma belcheri PE=2 SV=1 | 19 | 484 | 4.0E-41 |
| sp|P53491|ACT_ACEPE | Actin (Fragment) OS=Acetabularia peniculus PE=3 SV=1 | 35 | 484 | 4.0E-41 |
| sp|P53504|ACT1_SORBI | Actin-1 OS=Sorghum bicolor GN=AC1 PE=2 SV=1 | 18 | 484 | 6.0E-41 |
| sp|P53502|ACT_FUCDI | Actin OS=Fucus distichus PE=2 SV=1 | 19 | 484 | 6.0E-41 |
| sp|P53468|ACT1_OXYTR | Actin, cytoplasmic OS=Oxytricha trifallax PE=3 SV=1 | 25 | 484 | 6.0E-41 |
| sp|P27132|ACT2_NAEFO | Actin-2 (Fragment) OS=Naegleria fowleri PE=2 SV=1 | 21 | 482 | 6.0E-41 |
| sp|Q8R5C5|ACTY_MOUSE | Beta-centractin OS=Mus musculus GN=Actr1b PE=1 SV=1 | 24 | 484 | 9.0E-41 |
| sp|A4IFE3|ACTY_BOVIN | Beta-centractin OS=Bos taurus GN=ACTR1B PE=2 SV=1 | 24 | 484 | 1.0E-40 |
| sp|Q55EU6|ACT23_DICDI | Putative actin-23 OS=Dictyostelium discoideum GN=act23 PE=1 SV=1 | 34 | 484 | 1.0E-40 |
| sp|P12431|ACTM_STRPU | Actin, muscle OS=Strongylocentrotus purpuratus PE=3 SV=1 | 19 | 484 | 2.0E-40 |
| sp|P12433|ACT2_TRYBB | Actin B OS=Trypanosoma brucei brucei PE=3 SV=1 | 19 | 484 | 2.0E-40 |
| sp|Q9BYX7|ACTBM_HUMAN | Putative beta-actin-like protein 3 OS=Homo sapiens GN=POTEKP PE=5 SV=1 | 19 | 484 | 4.0E-40 |
| sp|P07828|ACT18_DICDI | Actin-18 OS=Dictyostelium discoideum GN=act18 PE=3 SV=3 | 19 | 484 | 6.0E-40 |
| sp|P02582|ACT1_MAIZE | Actin-1 OS=Zea mays GN=ACT1 PE=3 SV=1 | 19 | 484 | 6.0E-40 |
| sp|P42023|ACTZ_PNECA | Actin-2 OS=Pneumocystis carinii PE=2 SV=1 | 24 | 484 | 6.0E-40 |
| sp|Q03342|ACT3_ECHGR | Actin-3 (Fragment) OS=Echinococcus granulosus GN=ACTIII PE=2 SV=1 | 160 | 484 | 7.0E-40 |
| sp|P12432|ACT1_TRYBB | Actin A OS=Trypanosoma brucei brucei PE=3 SV=1 | 19 | 484 | 9.0E-40 |
| sp|P85515|ACTZ_RAT | Alpha-centractin OS=Rattus norvegicus GN=Actr1a PE=1 SV=1 | 24 | 484 | 1.0E-39 |
| sp|P61164|ACTZ_MOUSE | Alpha-centractin OS=Mus musculus GN=Actr1a PE=1 SV=1 | 24 | 484 | 1.0E-39 |
| sp|Q4R6J9|ACTZ_MACFA | Alpha-centractin OS=Macaca fascicularis GN=ACTR1A PE=2 SV=1 | 24 | 484 | 1.0E-39 |
| sp|P61163|ACTZ_HUMAN | Alpha-centractin OS=Homo sapiens GN=ACTR1A PE=1 SV=1 | 24 | 484 | 1.0E-39 |
| sp|P61162|ACTZ_CANLF | Alpha-centractin OS=Canis lupus familiaris GN=ACTR1A PE=2 SV=1 | 24 | 484 | 1.0E-39 |
| sp|P53477|ACT_TRYCR | Actin OS=Trypanosoma cruzi PE=3 SV=1 | 19 | 484 | 1.0E-39 |
| sp|P55805|ACT2_STENO | Actin, cytoplasmic OS=Sterkiella nova GN=MIC-ACT-1 PE=3 SV=1 | 24 | 484 | 2.0E-39 |
| sp|P45521|ACT_PROCL | Actin (Fragment) OS=Procambarus clarkii PE=1 SV=1 | 160 | 484 | 2.0E-39 |
| sp|P12715|ACT1_STENO | Actin, cytoplasmic OS=Sterkiella nova PE=3 SV=1 | 24 | 484 | 5.0E-39 |
| sp|P53469|ACT2_OXYTR | Actin, cytoplasmic OS=Oxytricha trifallax PE=3 SV=1 | 25 | 484 | 5.0E-39 |
| sp|O00937|ACT_STECV | Actin OS=Sterkiella cavicola PE=3 SV=2 | 20 | 484 | 6.0E-39 |
| sp|P10993|ACT2_TETPY | Actin, cytoplasmic OS=Tetrahymena pyriformis PE=3 SV=2 | 160 | 484 | 7.0E-39 |
| sp|Q00214|ACTM_STYPL | Actin, muscle OS=Styela plicata PE=3 SV=1 | 19 | 484 | 8.0E-39 |
| sp|P02580|ACT3_SOYBN | Actin-3 OS=Glycine max GN=SAC3 PE=3 SV=2 | 18 | 484 | 1.0E-38 |
| sp|Q54HF1|ACT24_DICDI | Putative actin-24 OS=Dictyostelium discoideum GN=act24 PE=3 SV=1 | 24 | 484 | 1.0E-38 |
| sp|P45520|ACT_LEIMA | Actin OS=Leishmania major PE=3 SV=1 | 19 | 484 | 2.0E-38 |
| sp|P10992|ACT1_TETTH | Actin, macronuclear OS=Tetrahymena thermophila PE=1 SV=3 | 160 | 484 | 4.0E-38 |
| sp|P45889|ACTZ_DROME | Actin-related protein 1 OS=Drosophila melanogaster GN=Arp1 PE=2 SV=2 | 24 | 483 | 4.0E-38 |
| sp|P18602|ACT3_ARTSX | Actin, clone 302 (Fragment) OS=Artemia sp. PE=2 SV=1 | 160 | 484 | 1.0E-37 |
| sp|P30161|ACT_COSCS | Actin (Fragment) OS=Costaria costata PE=3 SV=2 | 160 | 484 | 7.0E-37 |
| sp|P0CG39|POTEJ_HUMAN | POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 | 6 | 484 | 2.0E-36 |
| sp|Q54HF0|ACT25_DICDI | Putative actin-25 OS=Dictyostelium discoideum GN=act25 PE=3 SV=1 | 19 | 484 | 2.0E-36 |
| sp|A5A3E0|POTEF_HUMAN | POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 | 6 | 484 | 2.0E-36 |
| sp|P0CG38|POTEI_HUMAN | POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 | 6 | 484 | 3.0E-36 |
| sp|P23344|ACT2_DAUCA | Actin-2 OS=Daucus carota PE=2 SV=1 | 17 | 484 | 3.0E-36 |
| sp|Q6S8J3|POTEE_HUMAN | POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 | 6 | 484 | 4.0E-36 |
| sp|P38673|ACTZ_NEUCR | Actin-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-4 PE=3 SV=1 | 24 | 483 | 6.0E-36 |
| sp|P53499|ACT_CHOCR | Actin OS=Chondrus crispus GN=AC PE=2 SV=1 | 23 | 484 | 9.0E-36 |
| sp|P53483|ACTX_TAKRU | Actin, alpha anomalous OS=Takifugu rubripes PE=2 SV=1 | 160 | 484 | 9.0E-36 |
| sp|Q54I79|ACTY_DICDI | Centractin OS=Dictyostelium discoideum GN=arpA PE=1 SV=1 | 24 | 484 | 3.0E-35 |
| sp|P93738|ACT9_ARATH | Putative actin-9 OS=Arabidopsis thaliana GN=ACT9 PE=5 SV=1 | 160 | 484 | 3.0E-35 |
| sp|P45891|ACTY_DROME | Actin-like protein 53D OS=Drosophila melanogaster GN=Arp53D PE=2 SV=2 | 22 | 484 | 9.0E-35 |
| sp|P30169|ACT7_SOLTU | Actin-75 OS=Solanum tuberosum GN=AC75 PE=3 SV=1 | 19 | 484 | 1.0E-34 |
| sp|P02583|ACT2_OXYFA | Actin, cytoplasmic OS=Oxytricha fallax PE=3 SV=1 | 25 | 484 | 3.0E-34 |
| sp|Q9NJV4|ACT1_NAEGR | Actin-1 OS=Naegleria gruberi GN=ACT1 PE=3 SV=1 | 160 | 484 | 2.0E-33 |
| sp|Q55CU2|ACT26_DICDI | Putative actin-26 OS=Dictyostelium discoideum GN=act26 PE=3 SV=1 | 19 | 483 | 2.0E-33 |
| sp|P93584|ACT9_SOLTU | Actin-82 (Fragment) OS=Solanum tuberosum PE=3 SV=1 | 35 | 464 | 2.0E-33 |
| sp|Q6CSB9|ARP4_KLULA | Actin-related protein 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARP4 PE=3 SV=1 | 15 | 361 | 3.0E-33 |
| sp|P93587|ACT1_SOLTU | Actin-42 (Fragment) OS=Solanum tuberosum PE=3 SV=1 | 35 | 464 | 3.0E-33 |
| sp|Q6AY16|ACTL9_RAT | Actin-like protein 9 OS=Rattus norvegicus GN=Actl9 PE=2 SV=1 | 8 | 484 | 7.0E-33 |
| sp|P53503|ACT1_OXYFA | Actin, macronuclear OS=Oxytricha fallax PE=3 SV=1 | 25 | 484 | 2.0E-32 |
| sp|P38696|ARP1_YEAST | Centractin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP1 PE=1 SV=1 | 24 | 479 | 2.0E-32 |
| sp|P20360|ACT_EUPCR | Actin, cytoplasmic OS=Euplotes crassus PE=3 SV=1 | 23 | 484 | 3.0E-32 |
| sp|P93376|ACT6_TOBAC | Actin-103 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 | 35 | 464 | 4.0E-32 |
| sp|Q96482|ACT1_SOLLC | Actin-41 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 | 35 | 464 | 5.0E-32 |
| sp|P81228|ACT5_SOLTU | Actin-66 (Fragment) OS=Solanum tuberosum PE=3 SV=1 | 35 | 464 | 9.0E-32 |
| sp|Q2T9W4|ACTL9_BOVIN | Actin-like protein 9 OS=Bos taurus GN=ACTL9 PE=2 SV=1 | 20 | 484 | 1.0E-31 |
| sp|P93371|ACT5_TOBAC | Actin-93 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 | 35 | 464 | 1.0E-31 |
| sp|P80428|ARP4_YEAST | Actin-related protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP4 PE=1 SV=1 | 15 | 315 | 1.0E-31 |
| sp|P81229|ACT8_SOLTU | Actin-79 (Fragment) OS=Solanum tuberosum PE=3 SV=1 | 35 | 464 | 2.0E-31 |
| sp|P93374|ACT2_TOBAC | Actin-53 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 | 35 | 464 | 3.0E-31 |
| sp|Q96484|ACT3_SOLLC | Actin-52 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 | 35 | 464 | 5.0E-31 |
| sp|P93372|ACT4_TOBAC | Actin-66 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 | 35 | 464 | 5.0E-31 |
| sp|P93375|ACT7_TOBAC | Actin-104 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 | 35 | 464 | 1.0E-30 |
| sp|Q4R317|ACTT2_MACFA | Actin-related protein T2 OS=Macaca fascicularis GN=ACTRT2 PE=2 SV=1 | 23 | 484 | 2.0E-30 |
| sp|Q8TDG2|ACTT1_HUMAN | Actin-related protein T1 OS=Homo sapiens GN=ACTRT1 PE=2 SV=2 | 20 | 484 | 2.0E-30 |
| sp|Q8TDY3|ACTT2_HUMAN | Actin-related protein T2 OS=Homo sapiens GN=ACTRT2 PE=2 SV=2 | 23 | 484 | 2.0E-30 |
| sp|Q96481|ACT4_SOLLC | Actin-105 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 | 35 | 464 | 2.0E-30 |
| sp|P93586|ACT2_SOLTU | Actin-46 (Fragment) OS=Solanum tuberosum PE=3 SV=1 | 35 | 464 | 5.0E-30 |
| sp|Q96483|ACT2_SOLLC | Actin-51 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 | 35 | 464 | 7.0E-30 |
| sp|Q8BXF8|ACTT3_MOUSE | Actin-related protein T3 OS=Mus musculus GN=Actrt3 PE=1 SV=1 | 161 | 484 | 7.0E-30 |
| sp|Q5XIK1|ACTT1_RAT | Actin-related protein T1 OS=Rattus norvegicus GN=Actrt1 PE=2 SV=1 | 23 | 484 | 1.0E-29 |
| sp|Q9BYD9|ACTT3_HUMAN | Actin-related protein T3 OS=Homo sapiens GN=ACTRT3 PE=2 SV=1 | 161 | 484 | 4.0E-29 |
| sp|Q2TA43|ACTT2_BOVIN | Actin-related protein T2 OS=Bos taurus GN=ACTRT2 PE=2 SV=1 | 150 | 484 | 7.0E-29 |
| sp|O94630|ARP1_SCHPO | Centractin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp1 PE=3 SV=1 | 24 | 483 | 7.0E-29 |
| sp|Q92192|ACT_CALFI | Actin (Fragment) OS=Calanus finmarchicus PE=2 SV=1 | 160 | 466 | 7.0E-29 |
| sp|Q8TC94|ACTL9_HUMAN | Actin-like protein 9 OS=Homo sapiens GN=ACTL9 PE=1 SV=3 | 20 | 484 | 7.0E-29 |
| sp|Q54L54|ACT29_DICDI | Putative actin-29 OS=Dictyostelium discoideum GN=act29 PE=3 SV=1 | 22 | 484 | 4.0E-28 |
| sp|Q32KZ2|ACL7A_BOVIN | Actin-like protein 7A OS=Bos taurus GN=ACTL7A PE=2 SV=1 | 23 | 484 | 2.0E-27 |
| sp|Q9D9L5|ACTT2_MOUSE | Actin-related protein T2 OS=Mus musculus GN=Actrt2 PE=2 SV=1 | 161 | 484 | 2.0E-27 |
| sp|Q95JK8|ACL7B_MACFA | Actin-like protein 7B OS=Macaca fascicularis GN=ACTL7B PE=2 SV=1 | 20 | 484 | 2.0E-27 |
| sp|Q9QY83|ACL7B_MOUSE | Actin-like protein 7B OS=Mus musculus GN=Actl7b PE=1 SV=2 | 20 | 484 | 3.0E-27 |
| sp|Q4QR76|ACL7B_RAT | Actin-like protein 7B OS=Rattus norvegicus GN=Actl7b PE=1 SV=1 | 20 | 484 | 3.0E-27 |
| sp|Q9D9J3|ACTT1_MOUSE | Actin-related protein T1 OS=Mus musculus GN=Actrt1 PE=2 SV=1 | 160 | 484 | 5.0E-27 |
| sp|P93373|ACT3_TOBAC | Actin-54 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 | 35 | 465 | 5.0E-27 |
| sp|Q9Y614|ACL7B_HUMAN | Actin-like protein 7B OS=Homo sapiens GN=ACTL7B PE=2 SV=1 | 154 | 484 | 5.0E-27 |
| sp|P93585|ACT4_SOLTU | Actin-65 (Fragment) OS=Solanum tuberosum PE=3 SV=1 | 160 | 462 | 7.0E-27 |
| sp|Q25381|ACTM_LYTPI | Actin, muscle (Fragment) OS=Lytechinus pictus PE=3 SV=1 | 337 | 484 | 7.0E-27 |
| sp|Q32L91|ACL7B_BOVIN | Actin-like protein 7B OS=Bos taurus GN=ACTL7B PE=2 SV=1 | 20 | 484 | 1.0E-26 |
| sp|Q8CG27|ACTL9_MOUSE | Actin-like protein 9 OS=Mus musculus GN=Actl9 PE=1 SV=1 | 20 | 484 | 2.0E-26 |
| sp|P24902|ACT_PINCO | Actin (Fragment) OS=Pinus contorta PE=3 SV=1 | 339 | 484 | 3.0E-26 |
| sp|Q4R821|ACTT1_MACFA | Actin-related protein T1 OS=Macaca fascicularis GN=ACTRT1 PE=2 SV=1 | 157 | 484 | 3.0E-26 |
| sp|Q92193|ACT_CRAVI | Actin (Fragment) OS=Crassostrea virginica PE=2 SV=1 | 160 | 459 | 3.0E-26 |
| sp|Q25379|ACT3_LYTPI | Actin, cytoskeletal 3 (Fragment) OS=Lytechinus pictus PE=3 SV=1 | 337 | 484 | 4.0E-26 |
| sp|Q9QY84|ACL7A_MOUSE | Actin-like protein 7A OS=Mus musculus GN=Actl7a PE=1 SV=1 | 23 | 484 | 1.0E-25 |
| sp|P43239|ACT1_PNECA | Actin-1 OS=Pneumocystis carinii PE=2 SV=1 | 337 | 484 | 2.0E-25 |
| sp|Q641W9|ACL7A_RAT | Actin-like protein 7A OS=Rattus norvegicus GN=Actl7a PE=1 SV=1 | 23 | 484 | 4.0E-25 |
| sp|Q4R6Q3|ACL7A_MACFA | Actin-like protein 7A OS=Macaca fascicularis GN=ACTL7A PE=2 SV=1 | 23 | 484 | 8.0E-25 |
| sp|Q9Y615|ACL7A_HUMAN | Actin-like protein 7A OS=Homo sapiens GN=ACTL7A PE=1 SV=1 | 23 | 484 | 2.0E-24 |
| sp|Q6CSB9|ARP4_KLULA | Actin-related protein 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARP4 PE=3 SV=1 | 382 | 477 | 7.0E-24 |
| sp|P80428|ARP4_YEAST | Actin-related protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP4 PE=1 SV=1 | 382 | 476 | 7.0E-24 |
| sp|Q54HE9|ACT27_DICDI | Putative actin-27 OS=Dictyostelium discoideum GN=act27 PE=3 SV=2 | 21 | 480 | 7.0E-24 |
| sp|Q25380|ACT4_LYTPI | Actin, cytoskeletal 4 (Fragment) OS=Lytechinus pictus PE=3 SV=1 | 337 | 477 | 2.0E-23 |
| sp|P10994|ACTS_PLEWA | Actin, alpha skeletal muscle (Fragment) OS=Pleurodeles waltl PE=2 SV=1 | 382 | 484 | 8.0E-23 |
| sp|Q9N4I0|ARP3_CAEEL | Actin-related protein 3 OS=Caenorhabditis elegans GN=arx-1 PE=3 SV=1 | 20 | 480 | 5.0E-22 |
| sp|Q9LSD6|ARP2_ARATH | Actin-related protein 2 OS=Arabidopsis thaliana GN=ARP2 PE=1 SV=1 | 19 | 482 | 9.0E-21 |
| sp|P53489|ARP2_CAEEL | Actin-related protein 2 OS=Caenorhabditis elegans GN=arx-2 PE=3 SV=1 | 22 | 476 | 2.0E-20 |
| sp|P43239|ACT1_PNECA | Actin-1 OS=Pneumocystis carinii PE=2 SV=1 | 19 | 253 | 7.0E-20 |
| sp|O96621|ARP2_DICDI | Actin-related protein 2 OS=Dictyostelium discoideum GN=arpB PE=1 SV=1 | 19 | 485 | 1.0E-19 |
| sp|Q6Z256|ARP2_ORYSJ | Actin-related protein 2 OS=Oryza sativa subsp. japonica GN=ARP2 PE=3 SV=1 | 19 | 482 | 3.0E-19 |
| sp|A2YUL5|ARP2_ORYSI | Actin-related protein 2 OS=Oryza sativa subsp. indica GN=ARP2 PE=3 SV=2 | 19 | 482 | 3.0E-19 |
| sp|Q7ZXV3|ARP2B_XENLA | Actin-related protein 2-B OS=Xenopus laevis GN=actr2-b PE=2 SV=1 | 22 | 482 | 1.0E-18 |
| sp|Q7SXW6|ARP2A_DANRE | Actin-related protein 2-A OS=Danio rerio GN=actr2a PE=2 SV=1 | 22 | 482 | 1.0E-18 |
| sp|Q56A35|ARP2B_DANRE | Actin-related protein 2-B OS=Danio rerio GN=actr2b PE=2 SV=1 | 22 | 482 | 1.0E-18 |
| sp|Q7ZTP2|ARP2A_XENLA | Actin-related protein 2-A OS=Xenopus laevis GN=actr2-a PE=2 SV=1 | 22 | 482 | 2.0E-18 |
| sp|P53488|ARP2_CHICK | Actin-related protein 2 OS=Gallus gallus GN=ACTR2 PE=2 SV=1 | 22 | 482 | 2.0E-18 |
| sp|P61161|ARP2_MOUSE | Actin-related protein 2 OS=Mus musculus GN=Actr2 PE=1 SV=1 | 22 | 482 | 3.0E-18 |
| sp|P61160|ARP2_HUMAN | Actin-related protein 2 OS=Homo sapiens GN=ACTR2 PE=1 SV=1 | 22 | 482 | 3.0E-18 |
| sp|A7MB62|ARP2_BOVIN | Actin-related protein 2 OS=Bos taurus GN=ACTR2 PE=1 SV=1 | 22 | 482 | 3.0E-18 |
| sp|Q5BL41|ARP2_XENTR | Actin-related protein 2 OS=Xenopus tropicalis GN=actr2 PE=2 SV=1 | 22 | 482 | 4.0E-18 |
| sp|Q5M7U6|ARP2_RAT | Actin-related protein 2 OS=Rattus norvegicus GN=Actr2 PE=2 SV=1 | 22 | 482 | 4.0E-18 |
| sp|Q9UUJ1|ARP2_SCHPO | Actin-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp2 PE=1 SV=1 | 20 | 482 | 6.0E-18 |
| sp|P32381|ARP2_YEAST | Actin-related protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP2 PE=1 SV=1 | 24 | 482 | 8.0E-18 |
| sp|P53487|ARP2_ACACA | Actin-related protein 2 OS=Acanthamoeba castellanii GN=arp2 PE=2 SV=1 | 19 | 482 | 1.0E-17 |
| sp|Q5R4K0|ARP2_PONAB | Actin-related protein 2 OS=Pongo abelii GN=ACTR2 PE=2 SV=1 | 22 | 482 | 2.0E-17 |
| sp|P42528|ARP3_DICDI | Actin-related protein 3 OS=Dictyostelium discoideum GN=arpC PE=1 SV=1 | 23 | 480 | 7.0E-17 |
| sp|A2AKE7|ACL10_MOUSE | Actin-like protein 10 OS=Mus musculus GN=Actl10 PE=3 SV=1 | 163 | 481 | 2.0E-16 |
| sp|Q641P0|ARP3B_MOUSE | Actin-related protein 3B OS=Mus musculus GN=Actr3b PE=1 SV=1 | 25 | 480 | 5.0E-16 |
| sp|P45888|ARP2_DROME | Actin-related protein 2 OS=Drosophila melanogaster GN=Arp2 PE=2 SV=3 | 22 | 485 | 6.0E-16 |
| sp|Q90WD0|ARP3_CHICK | Actin-related protein 3 OS=Gallus gallus GN=ACTR3 PE=2 SV=1 | 23 | 480 | 8.0E-16 |
| sp|Q9P1U1|ARP3B_HUMAN | Actin-related protein 3B OS=Homo sapiens GN=ACTR3B PE=2 SV=1 | 25 | 480 | 1.0E-15 |
| sp|Q4V7C7|ARP3_RAT | Actin-related protein 3 OS=Rattus norvegicus GN=Actr3 PE=1 SV=1 | 23 | 480 | 2.0E-15 |
| sp|Q99JY9|ARP3_MOUSE | Actin-related protein 3 OS=Mus musculus GN=Actr3 PE=1 SV=3 | 23 | 480 | 2.0E-15 |
| sp|Q5R8R1|ARP3_PONAB | Actin-related protein 3 OS=Pongo abelii GN=ACTR3 PE=2 SV=3 | 23 | 480 | 2.0E-15 |
| sp|P61158|ARP3_HUMAN | Actin-related protein 3 OS=Homo sapiens GN=ACTR3 PE=1 SV=3 | 23 | 480 | 2.0E-15 |
| sp|P61157|ARP3_BOVIN | Actin-related protein 3 OS=Bos taurus GN=ACTR3 PE=1 SV=3 | 23 | 480 | 2.0E-15 |
| sp|P30170|ACT10_SOLTU | Actin-85C (Fragment) OS=Solanum tuberosum GN=AC85C PE=3 SV=1 | 35 | 253 | 3.0E-15 |
| sp|Q6K908|ARP3_ORYSJ | Actin-related protein 3 OS=Oryza sativa subsp. japonica GN=ARP3 PE=2 SV=1 | 23 | 480 | 5.0E-15 |
| sp|A2X6S3|ARP3_ORYSI | Actin-related protein 3 OS=Oryza sativa subsp. indica GN=ARP3 PE=3 SV=2 | 23 | 480 | 5.0E-15 |
| sp|O73723|ARP3_TAKRU | Actin-related protein 3 OS=Takifugu rubripes GN=actr3 PE=3 SV=1 | 23 | 480 | 7.0E-15 |
| sp|A3ANB5|ARP7_ORYSJ | Actin-related protein 7 OS=Oryza sativa subsp. japonica GN=ARP7 PE=2 SV=2 | 161 | 484 | 1.0E-14 |
| sp|A2XMK6|ARP7_ORYSI | Actin-related protein 7 OS=Oryza sativa subsp. indica GN=ARP7 PE=2 SV=2 | 161 | 484 | 1.0E-14 |
| sp|Q11212|ACT_SPOLI | Actin (Fragment) OS=Spodoptera littoralis PE=2 SV=1 | 26 | 232 | 2.0E-14 |
| sp|Q4W9M3|ARP6_ASPFU | Actin-like protein arp6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=arp6 PE=3 SV=1 | 155 | 476 | 3.0E-12 |
| sp|Q8L4Y5|ARP7_ARATH | Actin-related protein 7 OS=Arabidopsis thaliana GN=ARP7 PE=1 SV=1 | 161 | 484 | 3.0E-12 |
| sp|P10982|ACT1_ABSGL | Actin-1 (Fragment) OS=Absidia glauca GN=ACT1 PE=3 SV=1 | 19 | 196 | 6.0E-12 |
| sp|Q5NBI2|ARP6_ORYSJ | Actin-related protein 6 OS=Oryza sativa subsp. japonica GN=ARP6 PE=2 SV=1 | 159 | 483 | 2.0E-10 |
| sp|A2WNB0|ARP6_ORYSI | Actin-related protein 6 OS=Oryza sativa subsp. indica GN=ARP6 PE=3 SV=1 | 159 | 483 | 2.0E-10 |
| sp|Q5JWF8|ACL10_HUMAN | Actin-like protein 10 OS=Homo sapiens GN=ACTL10 PE=2 SV=1 | 195 | 480 | 4.0E-10 |
| sp|Q39596|ACT_OXYRB | Actin (Fragment) OS=Oxybasis rubra PE=3 SV=1 | 160 | 229 | 8.0E-10 |
| sp|Q12406|ARP7_YEAST | Actin-related protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP7 PE=1 SV=1 | 23 | 251 | 3.0E-09 |
| sp|Q9GZN1|ARP6_HUMAN | Actin-related protein 6 OS=Homo sapiens GN=ACTR6 PE=1 SV=1 | 153 | 483 | 6.0E-09 |
| sp|Q9C9B2|ARP4A_ARATH | Actin-related protein 4A OS=Arabidopsis thaliana GN=ARP4A PE=2 SV=1 | 15 | 100 | 8.0E-09 |
| sp|Q54HE7|ACT28_DICDI | Putative actin-28 OS=Dictyostelium discoideum GN=act28 PE=3 SV=1 | 337 | 476 | 8.0E-09 |
| sp|A2XQX0|ARP9_ORYSI | Actin-related protein 9 OS=Oryza sativa subsp. indica GN=ARP9 PE=3 SV=2 | 178 | 483 | 1.0E-08 |
| sp|Q9D864|ARP6_MOUSE | Actin-related protein 6 OS=Mus musculus GN=Actr6 PE=1 SV=2 | 153 | 483 | 2.0E-08 |
| sp|Q0JF03|ARP9_ORYSJ | Actin-related protein 9 OS=Oryza sativa subsp. japonica GN=ARP9 PE=2 SV=1 | 178 | 483 | 3.0E-08 |
| sp|P00544|FGR_FSVGR | Tyrosine-protein kinase transforming protein Fgr OS=Feline sarcoma virus (strain Gardner-Rasheed) GN=V-FGR PE=3 SV=1 | 19 | 196 | 4.0E-08 |
| sp|Q54HE7|ACT28_DICDI | Putative actin-28 OS=Dictyostelium discoideum GN=act28 PE=3 SV=1 | 160 | 253 | 6.0E-08 |
| sp|Q9DEE9|ARP6_CHICK | Actin-related protein 6 OS=Gallus gallus GN=ACTR6 PE=1 SV=1 | 153 | 483 | 6.0E-08 |
| sp|Q9UTQ7|ARP9_SCHPO | SWI/SNF and RSC complexes subunit arp9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp9 PE=1 SV=1 | 177 | 261 | 7.0E-08 |
| sp|Q24733|ACT_DICVI | Actin (Fragment) OS=Dictyocaulus viviparus PE=2 SV=1 | 454 | 484 | 7.0E-08 |
| sp|Q9H568|ACTL8_HUMAN | Actin-like protein 8 OS=Homo sapiens GN=ACTL8 PE=1 SV=1 | 381 | 475 | 1.0E-07 |
| sp|O94241|ARP6_SCHPO | Actin-like protein arp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp6 PE=3 SV=1 | 146 | 483 | 3.0E-07 |
| sp|Q12406|ARP7_YEAST | Actin-related protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP7 PE=1 SV=1 | 401 | 473 | 7.0E-07 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 69 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|229 MAQQPLPPTAQPTDIYGGDEVSALVLDPGYCNTRAGFAGEDVPKSILPSFYGHVTSDPPRNVFGDECLIPRADFE VRNYMNRDSVVEDWDVAAKIWEHMLIKRLQPERPTSPSKNGLNDDLKEQEQQQEQAPPPPPPPPPQDGEGDIAME DAEAMEKPLQENPLLMTEAPWNTSKSREKAIEIIMENWGCPAFWLSRTPVLSAFAAGKATALVIDVGGANTSVTA IHDGMVLKRSIQRSPVGGLWLSSQIRSLWETSEPKVNLVPTFMVENKTPVDAGMPAQARLRNWPFPISDSFRAYE DERVLTEFKESVVEVWRGPGRYSVPGNEDYIKSQPGRVFEMPDGYNQMWREQRFKVTEGMWDETAGFPTAAEPER LTKAQTIPELIRTALGAVDVDLRGNLLANVVVTGSTSLINGFNDRLNNELTAMYPGLKVKIHAAGLTSERRFGAW IGGSILASLGTFHQMWISRKEYEENGPNVVEKRCK* |
| Coding | >Hirsu2|229 ATGGCTCAGCAGCCTCTGCCACCGACGGCGCAGCCGACCGACATCTACGGCGGAGACGAGGTCTCTGCCCTTGTC CTAGATCCGGGCTACTGCAACACGCGCGCGGGCTTCGCCGGCGAAGACGTCCCCAAGTCGATCCTCCCCTCCTTC TACGGCCACGTCACCAGCGATCCGCCGCGCAATGTCTTTGGCGACGAGTGCCTCATTCCGCGGGCCGACTTCGAG GTCCGCAACTACATGAACCGCGACAGCGTCGTCGAGGACTGGGATGTGGCCGCCAAGATCTGGGAGCACATGCTC ATCAAGCGCCTGCAGCCCGAGCGGCCGACGTCGCCGTCCAAGAACGGCCTCAACGACGACCTGAAGGAGCAGGAA CAACAACAGGAGCAAGCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCAGGACGGCGAGGGAGACATCGCCATGGAG GATGCCGAGGCGATGGAAAAGCCGCTGCAGGAGAACCCGCTGCTGATGACGGAGGCGCCGTGGAACACGTCCAAG TCGCGGGAGAAGGCCATCGAGATCATCATGGAGAACTGGGGGTGCCCCGCGTTCTGGCTGAGCCGCACGCCCGTG CTGTCGGCCTTCGCGGCCGGCAAGGCCACGGCCCTGGTCATCGACGTCGGCGGCGCCAACACGTCCGTCACGGCC ATCCACGACGGCATGGTGCTTAAGAGGTCGATCCAGCGGTCGCCCGTCGGCGGCCTGTGGCTGTCGTCCCAGATC CGCAGCCTGTGGGAGACGTCGGAGCCCAAGGTGAACTTGGTGCCGACCTTCATGGTGGAGAACAAGACGCCGGTC GACGCCGGCATGCCGGCCCAGGCGCGTCTGCGCAACTGGCCCTTCCCGATCAGCGACTCGTTCCGGGCGTACGAG GACGAGCGCGTCCTGACCGAGTTCAAGGAGTCGGTCGTCGAGGTCTGGCGCGGCCCGGGCCGGTACAGCGTGCCG GGCAACGAGGACTACATCAAGTCGCAGCCCGGGCGCGTCTTCGAGATGCCCGACGGCTACAACCAGATGTGGCGC GAGCAGCGGTTCAAGGTGACGGAGGGCATGTGGGACGAGACGGCCGGCTTCCCCACGGCGGCCGAGCCGGAGCGC CTGACCAAGGCCCAGACGATCCCGGAGCTGATCCGCACTGCCCTGGGTGCCGTCGATGTCGACCTGCGCGGTAAT CTGCTGGCCAACGTCGTCGTCACCGGCAGCACCAGCCTCATCAACGGCTTCAACGACCGGCTCAACAACGAGCTG ACGGCCATGTACCCGGGCCTCAAGGTCAAGATCCACGCCGCCGGCCTGACGAGCGAGCGCCGCTTCGGCGCCTGG ATCGGCGGCAGCATCCTCGCCAGCCTCGGCACCTTCCACCAGATGTGGATCTCGCGTAAGGAGTACGAGGAGAAC GGGCCCAACGTGGTCGAGAAGCGGTGCAAGTGA |
| Transcript | >Hirsu2|229 ATGGCTCAGCAGCCTCTGCCACCGACGGCGCAGCCGACCGACATCTACGGCGGAGACGAGGTCTCTGCCCTTGTC CTAGATCCGGGCTACTGCAACACGCGCGCGGGCTTCGCCGGCGAAGACGTCCCCAAGTCGATCCTCCCCTCCTTC TACGGCCACGTCACCAGCGATCCGCCGCGCAATGTCTTTGGCGACGAGTGCCTCATTCCGCGGGCCGACTTCGAG GTCCGCAACTACATGAACCGCGACAGCGTCGTCGAGGACTGGGATGTGGCCGCCAAGATCTGGGAGCACATGCTC ATCAAGCGCCTGCAGCCCGAGCGGCCGACGTCGCCGTCCAAGAACGGCCTCAACGACGACCTGAAGGAGCAGGAA CAACAACAGGAGCAAGCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCAGGACGGCGAGGGAGACATCGCCATGGAG GATGCCGAGGCGATGGAAAAGCCGCTGCAGGAGAACCCGCTGCTGATGACGGAGGCGCCGTGGAACACGTCCAAG TCGCGGGAGAAGGCCATCGAGATCATCATGGAGAACTGGGGGTGCCCCGCGTTCTGGCTGAGCCGCACGCCCGTG CTGTCGGCCTTCGCGGCCGGCAAGGCCACGGCCCTGGTCATCGACGTCGGCGGCGCCAACACGTCCGTCACGGCC ATCCACGACGGCATGGTGCTTAAGAGGTCGATCCAGCGGTCGCCCGTCGGCGGCCTGTGGCTGTCGTCCCAGATC CGCAGCCTGTGGGAGACGTCGGAGCCCAAGGTGAACTTGGTGCCGACCTTCATGGTGGAGAACAAGACGCCGGTC GACGCCGGCATGCCGGCCCAGGCGCGTCTGCGCAACTGGCCCTTCCCGATCAGCGACTCGTTCCGGGCGTACGAG GACGAGCGCGTCCTGACCGAGTTCAAGGAGTCGGTCGTCGAGGTCTGGCGCGGCCCGGGCCGGTACAGCGTGCCG GGCAACGAGGACTACATCAAGTCGCAGCCCGGGCGCGTCTTCGAGATGCCCGACGGCTACAACCAGATGTGGCGC GAGCAGCGGTTCAAGGTGACGGAGGGCATGTGGGACGAGACGGCCGGCTTCCCCACGGCGGCCGAGCCGGAGCGC CTGACCAAGGCCCAGACGATCCCGGAGCTGATCCGCACTGCCCTGGGTGCCGTCGATGTCGACCTGCGCGGTAAT CTGCTGGCCAACGTCGTCGTCACCGGCAGCACCAGCCTCATCAACGGCTTCAACGACCGGCTCAACAACGAGCTG ACGGCCATGTACCCGGGCCTCAAGGTCAAGATCCACGCCGCCGGCCTGACGAGCGAGCGCCGCTTCGGCGCCTGG ATCGGCGGCAGCATCCTCGCCAGCCTCGGCACCTTCCACCAGATGTGGATCTCGCGTAAGGAGTACGAGGAGAAC GGGCCCAACGTGGTCGAGAAGCGGTGCAAGTGA |
| Gene | >Hirsu2|229 ATGGCTCAGCAGCCTCTGCCACCGACGGCGCAGCCGACCGACATCTACGGCGGAGGTGCGCCGCACTTCCTCTCC CCTCGCCGCACCTGTAGCTGACCTCTTTTTTTTTTCTTCTTCCCTCCCGCTCCGCAGACGAGGTCTCTGCCCTTG TCCTAGATCCGGGCTACTGCAACACGCGCGCGGGCTTCGCCGGCGAAGACGTCCCCAAGTCGATCCTCCCCTCCT TCTACGGCCACGTCACCAGCGATCCGCCGCGCAATGTCTTTGGCGACGAGTGCCTCATTCCGCGGGCCGACTTCG AGGTCCGCAACTACATGAACCGCGACAGCGTCGTCGAGGACTGGGATGTGGCCGCCAAGATCTGGGAGCACATGC TCATCAAGCGCCTGCAGCCCGAGCGGCCGACGTCGCCGTCCAAGAACGGCCTCAACGACGACCTGAAGGAGCAGG AACAACAACAGGAGCAAGCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCAGGACGGCGAGGGAGACATCGCCATGG AGGATGCCGAGGCGATGGAAAAGCCGCTGCAGGAGAACCCGCTGCTGATGACGGAGGCGCCGTGGAACACGTCCA AGTCGCGGGAGAAGGCCATCGAGATCATCATGGAGAACTGGGGGTGCCCCGCGTTCTGGCTGAGCCGCACGCCCG TGCTGTCGGCCTTCGCGGCCGGCAAGGCCACGGCCCTGGTCATCGACGTCGGCGGCGCCAACACGTCCGTCACGG CCATCCACGACGGCATGGTGCTTAAGAGGTCGATCCAGCGGTCGCCCGTCGGCGGCCTGTGGCTGTCGTCCCAGA TCCGCAGCCTGTGGGAGACGTCGGAGCCCAAGGTGAACTTGGTGCCGACCTTCATGGTGGAGAACAAGACGCCGG TCGACGCCGGCATGCCGGCCCAGGCGCGTCTGCGCAACTGGCCCTTCCCGATCAGCGACTCGTTCCGGGCGTACG AGGACGAGCGCGTCCTGACCGAGTTCAAGGAGTCGGTCGTCGAGGTCTGGCGCGGCCCGGGCCGGTACAGCGTGC CGGGCAACGAGGACTACATCAAGTCGCAGCCCGGGCGCGTCTTCGAGATGCCCGACGGCTACAACCAGATGTGGC GCGAGCAGCGGTTCAAGGTGACGGAGGGCATGTGGGACGAGACGGCCGGCTTCCCCACGGCGGCCGAGCCGGAGC GCCTGACCAAGGCCCAGACGATCCCGGAGCTGATCCGCACTGCCCTGGGTGCCGTCGATGTCGACCTGCGCGGTA ATCTGCTGGCCAACGTCGTCGTCACCGGCAGCACCAGCCTCATCAACGGCTTCAACGACCGGCTCAACAACGAGC TGACGGCCATGTACCCGGGCCTCAAGGTCAAGATCCACGCCGCCGGCCTGACGAGCGAGCGCCGCTTCGGCGCCT GGATCGGCGGCAGCATCCTCGCCAGCCTCGGCACCTTCCACCAGATGTGGATCTCGCGTAAGGAGTACGAGGAGA ACGGGCCCAACGTGGTCGAGAAGCGGTGCAAGTGA |