Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|229
Gene name
LocationContig_104:28598..30133
Strand-
Gene length (bp)1535
Transcript length (bp)1458
Coding sequence length (bp)1458
Protein length (aa) 486

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00022 Actin Actin 3.7E-143 18 485

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IPI4|ARP4_GIBZE Actin-related protein 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ARP4 PE=3 SV=1 1 485 0.0E+00
sp|Q7SHR0|ARP4_NEUCR Actin-related protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arp-4 PE=3 SV=2 3 485 0.0E+00
sp|Q5AW89|ARP4_EMENI Actin-related protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=arp4 PE=3 SV=1 6 485 7.0E-174
sp|Q4WHA3|ARP4_ASPFU Actin-related protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=arp4 PE=3 SV=1 19 485 7.0E-165
sp|Q9P7X7|ARP4_SCHPO Actin-related protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp5 PE=3 SV=1 15 485 1.0E-85
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IPI4|ARP4_GIBZE Actin-related protein 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ARP4 PE=3 SV=1 1 485 0.0E+00
sp|Q7SHR0|ARP4_NEUCR Actin-related protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arp-4 PE=3 SV=2 3 485 0.0E+00
sp|Q5AW89|ARP4_EMENI Actin-related protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=arp4 PE=3 SV=1 6 485 7.0E-174
sp|Q4WHA3|ARP4_ASPFU Actin-related protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=arp4 PE=3 SV=1 19 485 7.0E-165
sp|Q9P7X7|ARP4_SCHPO Actin-related protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp5 PE=3 SV=1 15 485 1.0E-85
sp|Q4P2E8|ARP4_USTMA Actin-related protein 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ARP4 PE=3 SV=1 15 485 2.0E-84
sp|P86173|ACL6B_RAT Actin-like protein 6B OS=Rattus norvegicus GN=Actl6b PE=1 SV=2 15 484 8.0E-83
sp|Q99MR0|ACL6B_MOUSE Actin-like protein 6B OS=Mus musculus GN=Actl6b PE=1 SV=1 15 484 8.0E-83
sp|A4FUX8|ACL6B_BOVIN Actin-like protein 6B OS=Bos taurus GN=ACTL6B PE=2 SV=1 15 484 8.0E-83
sp|Q4R333|ACL6A_MACFA Actin-like protein 6A OS=Macaca fascicularis GN=ACTL6A PE=2 SV=1 15 484 6.0E-80
sp|O94805|ACL6B_HUMAN Actin-like protein 6B OS=Homo sapiens GN=ACTL6B PE=1 SV=1 15 484 7.0E-80
sp|O96019|ACL6A_HUMAN Actin-like protein 6A OS=Homo sapiens GN=ACTL6A PE=1 SV=1 15 484 1.0E-79
sp|Q9Z2N8|ACL6A_MOUSE Actin-like protein 6A OS=Mus musculus GN=Actl6a PE=1 SV=2 15 484 3.0E-79
sp|Q6C061|ARP4_YARLI Actin-related protein 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARP4 PE=3 SV=1 6 483 1.0E-76
sp|Q5AC48|ARP4_CANAL Actin-related protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARP4 PE=3 SV=2 9 476 2.0E-71
sp|Q84M92|ARP4_ARATH Actin-related protein 4 OS=Arabidopsis thaliana GN=ARP4 PE=1 SV=1 15 484 2.0E-68
sp|Q6BXN0|ARP4_DEBHA Actin-related protein 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ARP4 PE=3 SV=1 15 476 1.0E-66
sp|Q09849|ARP42_SCHPO SWI/SNF and RSC complexes subunit arp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp42 PE=1 SV=2 19 485 4.0E-62
sp|Q6ZJW9|ARP4_ORYSJ Actin-related protein 4 OS=Oryza sativa subsp. japonica GN=ARP4 PE=2 SV=1 15 484 2.0E-57
sp|A2YR10|ARP4_ORYSI Actin-related protein 4 OS=Oryza sativa subsp. indica GN=ARP4 PE=3 SV=2 15 484 2.0E-57
sp|Q6FJV8|ARP4_CANGA Actin-related protein 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARP4 PE=3 SV=1 15 476 1.0E-56
sp|Q754G5|ARP4_ASHGO Actin-related protein 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARP4 PE=3 SV=1 15 482 1.0E-54
sp|P53455|ACT_AJECG Actin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_08711 PE=2 SV=2 19 484 7.0E-51
sp|P48465|ACT_CRYNH Actin OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNAG_00483 PE=3 SV=2 19 484 2.0E-50
sp|P53689|ACT_PHARH Actin OS=Phaffia rhodozyma PE=3 SV=1 19 484 5.0E-50
sp|P10365|ACT_THELA Actin OS=Thermomyces lanuginosus PE=3 SV=1 19 484 1.0E-49
sp|Q8X119|ACT_EXODE Actin OS=Exophiala dermatitidis PE=3 SV=1 19 484 1.0E-49
sp|P50138|ACT_PUCGR Actin OS=Puccinia graminis PE=3 SV=1 19 484 1.0E-49
sp|P02578|ACT1_ACACA Actin-1 OS=Acanthamoeba castellanii PE=1 SV=1 18 484 2.0E-49
sp|P20359|ACTG_EMENI Actin, gamma OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acnA PE=3 SV=2 19 484 2.0E-49
sp|P90689|ACT_BRUMA Actin OS=Brugia malayi PE=1 SV=1 17 484 2.0E-49
sp|P78711|ACT_NEUCR Actin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=act PE=3 SV=2 19 484 2.0E-49
sp|Q6TCF2|ACT_GAEGA Actin OS=Gaeumannomyces graminis var. avenae GN=ACT PE=2 SV=1 19 484 2.0E-49
sp|Q9UVW9|ACTG_ACRCH Actin, gamma OS=Acremonium chrysogenum GN=ACT PE=3 SV=1 19 484 2.0E-49
sp|Q9Y702|ACT1_SCHCO Actin-1 OS=Schizophyllum commune GN=ACT1 PE=2 SV=1 19 484 3.0E-49
sp|O13419|ACT_BOTFU Actin OS=Botryotinia fuckeliana GN=actA PE=3 SV=1 19 484 4.0E-49
sp|Q9UVF3|ACT_YARLI Actin OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ACT1 PE=3 SV=2 19 484 5.0E-49
sp|Q9P4D1|ACT_PICPG Actin OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ACT1 PE=1 SV=1 18 484 5.0E-49
sp|Q9URS0|ACTG_PENCH Actin, gamma OS=Penicillium chrysogenum GN=ACT PE=3 SV=1 19 484 6.0E-49
sp|Q54GX7|ACT10_DICDI Actin-10 OS=Dictyostelium discoideum GN=act10 PE=1 SV=1 18 484 7.0E-49
sp|P07830|ACT1_DICDI Major actin OS=Dictyostelium discoideum GN=act1 PE=1 SV=2 18 484 8.0E-49
sp|P91754|ACT_LUMRU Actin (Fragment) OS=Lumbricus rubellus PE=2 SV=1 20 484 9.0E-49
sp|Q9UVZ8|ACT_CANDC Actin OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ACT1 PE=3 SV=1 18 484 2.0E-48
sp|P14235|ACT_CANAX Actin OS=Candida albicans GN=ACT1 PE=3 SV=1 18 484 2.0E-48
sp|P17304|ACTM_APLCA Actin, muscle OS=Aplysia californica PE=2 SV=1 19 484 2.0E-48
sp|Q553U6|ACT22_DICDI Putative actin-22 OS=Dictyostelium discoideum GN=act22 PE=3 SV=1 18 484 2.0E-48
sp|Q9UVX4|ACT_COPC7 Actin OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACT1 PE=3 SV=1 19 484 3.0E-48
sp|Q964D9|ACTC_PLATR Actin, cytoplasmic OS=Planorbella trivolvis PE=3 SV=1 19 484 3.0E-48
sp|O17503|ACTC_BRALA Actin, cytoplasmic OS=Branchiostoma lanceolatum PE=2 SV=1 19 484 3.0E-48
sp|Q26065|ACT_PLAMG Actin, adductor muscle OS=Placopecten magellanicus PE=2 SV=1 19 484 3.0E-48
sp|P0DM42|ACT3_CAEEL Actin-3 OS=Caenorhabditis elegans GN=act-3 PE=1 SV=1 19 484 3.0E-48
sp|P0DM41|ACT1_CAEEL Actin-1 OS=Caenorhabditis elegans GN=act-1 PE=1 SV=1 19 484 3.0E-48
sp|P92176|ACT2_LUMTE Actin-2 OS=Lumbricus terrestris GN=ACT2 PE=2 SV=1 19 484 4.0E-48
sp|Q964E0|ACTC_BIOTE Actin, cytoplasmic OS=Biomphalaria tenagophila PE=3 SV=1 19 484 4.0E-48
sp|P53463|ACTM_HELER Actin, cytoskeletal OS=Heliocidaris erythrogramma PE=3 SV=1 19 484 4.0E-48
sp|P10989|ACT_SCHPO Actin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=act1 PE=1 SV=1 19 484 4.0E-48
sp|Q964E3|ACTC_BIOAL Actin, cytoplasmic OS=Biomphalaria alexandrina PE=3 SV=1 19 484 5.0E-48
sp|P07837|ACT2_BOMMO Actin, muscle-type A2 OS=Bombyx mori PE=3 SV=1 19 484 5.0E-48
sp|P45886|ACT3_BACDO Actin-3, muscle-specific OS=Bactrocera dorsalis PE=2 SV=1 19 484 5.0E-48
sp|P41340|ACT3_LIMPO Actin-3 OS=Limulus polyphemus PE=1 SV=1 19 484 6.0E-48
sp|P92182|ACT1_LUMTE Actin-1 OS=Lumbricus terrestris GN=ACT1 PE=2 SV=1 19 484 7.0E-48
sp|P45885|ACT2_BACDO Actin-2, muscle-specific OS=Bactrocera dorsalis PE=2 SV=1 19 484 7.0E-48
sp|Q9Y896|ACT2_SCHCO Actin-2 OS=Schizophyllum commune GN=ACT2 PE=3 SV=1 19 484 8.0E-48
sp|P53464|ACTM_HELTB Actin, cytoskeletal OS=Heliocidaris tuberculata PE=3 SV=1 19 484 9.0E-48
sp|Q8JJB8|ACTG_TRISC Actin, cytoplasmic 2 OS=Triakis scyllium GN=actg1 PE=2 SV=1 19 484 9.0E-48
sp|P68143|ACTB_OREMO Actin, cytoplasmic 1 OS=Oreochromis mossambicus GN=actb PE=2 SV=1 19 484 9.0E-48
sp|P68142|ACTB1_TAKRU Actin, cytoplasmic 1 OS=Takifugu rubripes GN=actba PE=2 SV=1 19 484 9.0E-48
sp|O17320|ACT_CRAGI Actin OS=Crassostrea gigas PE=2 SV=1 17 484 1.0E-47
sp|P10981|ACT5_DROME Actin-87E OS=Drosophila melanogaster GN=Act87E PE=1 SV=1 19 484 1.0E-47
sp|P10986|ACT4_CAEEL Actin-4 OS=Caenorhabditis elegans GN=act-4 PE=3 SV=2 19 484 1.0E-47
sp|P60010|ACT_YEAST Actin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACT1 PE=1 SV=1 20 484 1.0E-47
sp|P60011|ACT_SACBA Actin OS=Saccharomyces bayanus GN=ACT1 PE=3 SV=1 20 484 1.0E-47
sp|P60009|ACT_CANGA Actin OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACT1 PE=3 SV=1 20 484 1.0E-47
sp|Q2U7A3|ACT_ASPOR Actin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=act1 PE=3 SV=1 19 484 1.0E-47
sp|P02576|ACTA_PHYPO Actin, plasmodial isoform OS=Physarum polycephalum GN=ARDA PE=1 SV=2 18 484 1.0E-47
sp|P17128|ACT_KLULA Actin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACT PE=3 SV=2 20 484 1.0E-47
sp|Q25010|ACT3A_HELAM Actin, cytoplasmic A3a OS=Helicoverpa armigera GN=actA3a PE=2 SV=1 19 484 1.0E-47
sp|P84336|ACTB_CAMDR Actin, cytoplasmic 1 OS=Camelus dromedarius GN=ACTB PE=1 SV=1 19 484 1.0E-47
sp|O74258|ACT_OGAPD Actin OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=ACT PE=3 SV=2 18 484 2.0E-47
sp|O65314|ACT_SCHDU Actin OS=Scherffelia dubia PE=2 SV=1 17 484 2.0E-47
sp|Q93131|ACTC_BRAFL Actin, cytoplasmic OS=Branchiostoma floridae PE=2 SV=1 19 484 2.0E-47
sp|Q6NVA9|ACTB_XENTR Actin, cytoplasmic 1 OS=Xenopus tropicalis GN=actb PE=2 SV=1 19 484 2.0E-47
sp|O93400|ACTB_XENLA Actin, cytoplasmic 1 OS=Xenopus laevis GN=actb PE=2 SV=1 19 484 2.0E-47
sp|O18499|ACT1_SACKO Actin-1 OS=Saccoglossus kowalevskii PE=2 SV=1 19 484 2.0E-47
sp|O16808|ACT_MAYDE Actin OS=Mayetiola destructor PE=2 SV=1 19 484 2.0E-47
sp|Q964E1|ACTC_BIOOB Actin, cytoplasmic OS=Biomphalaria obstructa PE=3 SV=1 19 484 2.0E-47
sp|O42161|ACTB_SALSA Actin, cytoplasmic 1 OS=Salmo salar GN=actb PE=2 SV=1 19 484 2.0E-47
sp|P10984|ACT2_CAEEL Actin-2 OS=Caenorhabditis elegans GN=act-2 PE=3 SV=3 19 484 2.0E-47
sp|P26197|ACT2_ABSGL Actin-2 OS=Absidia glauca GN=ACT2 PE=3 SV=1 19 484 2.0E-47
sp|P18603|ACT4_ARTSX Actin, clone 403 OS=Artemia sp. PE=2 SV=1 19 484 3.0E-47
sp|Q93129|ACTC_BRABE Actin, cytoplasmic OS=Branchiostoma belcheri PE=2 SV=1 19 484 3.0E-47
sp|P60707|ACTB_TRIVU Actin, cytoplasmic 1 OS=Trichosurus vulpecula GN=ACTB PE=2 SV=1 19 484 3.0E-47
sp|Q4L0Y2|ACTB_SPECI Actin, cytoplasmic 1 OS=Spermophilus citellus GN=ACTB PE=2 SV=1 19 484 3.0E-47
sp|P60713|ACTB_SHEEP Actin, cytoplasmic 1 OS=Ovis aries GN=ACTB PE=2 SV=1 19 484 3.0E-47
sp|P60711|ACTB_RAT Actin, cytoplasmic 1 OS=Rattus norvegicus GN=Actb PE=1 SV=1 19 484 3.0E-47
sp|Q5R6G0|ACTB_PONAB Actin, cytoplasmic 1 OS=Pongo abelii GN=ACTB PE=2 SV=1 19 484 3.0E-47
sp|Q6QAQ1|ACTB_PIG Actin, cytoplasmic 1 OS=Sus scrofa GN=ACTB PE=1 SV=2 19 484 3.0E-47
sp|Q5R1X3|ACTB_PANTR Actin, cytoplasmic 1 OS=Pan troglodytes GN=ACTB PE=2 SV=1 19 484 3.0E-47
sp|P60710|ACTB_MOUSE Actin, cytoplasmic 1 OS=Mus musculus GN=Actb PE=1 SV=1 19 484 3.0E-47
sp|Q711N9|ACTB_MESAU Actin, cytoplasmic 1 OS=Mesocricetus auratus GN=ACTB PE=1 SV=1 19 484 3.0E-47
sp|Q4R561|ACTB_MACFA Actin, cytoplasmic 1 OS=Macaca fascicularis GN=ACTB PE=2 SV=1 19 484 3.0E-47
sp|P60709|ACTB_HUMAN Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1 19 484 3.0E-47
sp|P60708|ACTB_HORSE Actin, cytoplasmic 1 OS=Equus caballus GN=ACTB PE=2 SV=1 19 484 3.0E-47
sp|Q76N69|ACTB_CHLAE Actin, cytoplasmic 1 OS=Chlorocebus aethiops GN=ACTB PE=2 SV=1 19 484 3.0E-47
sp|P60706|ACTB_CHICK Actin, cytoplasmic 1 OS=Gallus gallus GN=ACTB PE=1 SV=1 19 484 3.0E-47
sp|Q71FK5|ACTB_CAVPO Actin, cytoplasmic 1 OS=Cavia porcellus GN=ACTB PE=2 SV=1 19 484 3.0E-47
sp|O18840|ACTB_CANLF Actin, cytoplasmic 1 OS=Canis lupus familiaris GN=ACTB PE=2 SV=3 19 484 3.0E-47
sp|P60712|ACTB_BOVIN Actin, cytoplasmic 1 OS=Bos taurus GN=ACTB PE=1 SV=1 19 484 3.0E-47
sp|Q9Y701|ACT1_SUIBO Actin-1 OS=Suillus bovinus GN=ACT1 PE=2 SV=1 19 484 3.0E-47
sp|P79818|ACTB_ORYLA Actin, cytoplasmic 1 OS=Oryzias latipes GN=actb PE=2 SV=2 19 484 3.0E-47
sp|P84185|ACT5C_ANOGA Actin-5C OS=Anopheles gambiae GN=Act5C PE=2 SV=1 19 484 3.0E-47
sp|P84183|ACT4_BOMMO Actin, cytoplasmic A4 OS=Bombyx mori GN=A4 PE=2 SV=1 19 484 3.0E-47
sp|P84184|ACT3B_HELAM Actin-A3b, cytoplasmic OS=Helicoverpa armigera GN=actA3b PE=2 SV=1 19 484 3.0E-47
sp|P10987|ACT1_DROME Actin-5C OS=Drosophila melanogaster GN=Act5C PE=1 SV=4 19 484 3.0E-47
sp|P02572|ACT2_DROME Actin-42A OS=Drosophila melanogaster GN=Act42A PE=1 SV=3 19 484 3.0E-47
sp|Q75D00|ACT_ASHGO Actin OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACT1 PE=2 SV=1 20 484 3.0E-47
sp|Q91ZK5|ACTB_SIGHI Actin, cytoplasmic 1 OS=Sigmodon hispidus GN=ACTB PE=2 SV=1 19 484 3.0E-47
sp|P53500|ACT_CYAME Actin OS=Cyanidioschyzon merolae PE=3 SV=1 19 484 3.0E-47
sp|P18600|ACT1_ARTSX Actin, clone 205 OS=Artemia sp. PE=2 SV=1 19 484 3.0E-47
sp|P83750|ACTB_CYPCA Actin, cytoplasmic 1 OS=Cyprinus carpio GN=actb PE=3 SV=1 19 484 3.0E-47
sp|P83751|ACTB_CTEID Actin, cytoplasmic 1 OS=Ctenopharyngodon idella GN=actb PE=3 SV=1 19 484 3.0E-47
sp|Q7ZVF9|ACTB2_DANRE Actin, cytoplasmic 2 OS=Danio rerio GN=actbb PE=2 SV=2 19 484 3.0E-47
sp|P53505|ACT5_XENLA Actin, cytoplasmic type 5 OS=Xenopus laevis PE=3 SV=1 19 484 3.0E-47
sp|P92179|ACTC_BIOGL Actin, cytoplasmic OS=Biomphalaria glabrata PE=2 SV=2 19 484 3.0E-47
sp|Q5JAK2|ACTG_PELLE Actin, cytoplasmic 2 OS=Pelophylax lessonae GN=actg1 PE=2 SV=1 19 484 3.0E-47
sp|A2BDB0|ACTG_XENLA Actin, cytoplasmic 2 OS=Xenopus laevis GN=actg1 PE=2 SV=1 19 484 4.0E-47
sp|P63257|ACTG_TRIVU Actin, cytoplasmic 2 OS=Trichosurus vulpecula GN=ACTG1 PE=2 SV=1 19 484 4.0E-47
sp|P63259|ACTG_RAT Actin, cytoplasmic 2 OS=Rattus norvegicus GN=Actg1 PE=1 SV=1 19 484 4.0E-47
sp|P63260|ACTG_MOUSE Actin, cytoplasmic 2 OS=Mus musculus GN=Actg1 PE=1 SV=1 19 484 4.0E-47
sp|P63261|ACTG_HUMAN Actin, cytoplasmic 2 OS=Homo sapiens GN=ACTG1 PE=1 SV=1 19 484 4.0E-47
sp|Q5ZMQ2|ACTG_CHICK Actin, cytoplasmic 2 OS=Gallus gallus GN=ACTG1 PE=1 SV=1 19 484 4.0E-47
sp|P63258|ACTG_BOVIN Actin, cytoplasmic 2 OS=Bos taurus GN=ACTG1 PE=1 SV=1 19 484 4.0E-47
sp|P53486|ACTB3_TAKRU Actin, cytoplasmic 3 OS=Takifugu rubripes GN=actbc PE=2 SV=1 19 484 4.0E-47
sp|P53506|ACT8_XENLA Actin, cytoplasmic type 8 OS=Xenopus laevis PE=3 SV=1 19 484 4.0E-47
sp|P53501|ACT3_DROME Actin-57B OS=Drosophila melanogaster GN=Act57B PE=1 SV=1 19 484 4.0E-47
sp|Q964E2|ACTC_BIOPF Actin, cytoplasmic OS=Biomphalaria pfeifferi PE=3 SV=1 19 484 4.0E-47
sp|Q6P378|ACTG_XENTR Actin, cytoplasmic 2 OS=Xenopus tropicalis GN=actg1 PE=2 SV=1 19 484 5.0E-47
sp|P29751|ACTB_RABIT Actin, cytoplasmic 1 OS=Oryctolagus cuniculus GN=ACTB PE=2 SV=1 19 484 5.0E-47
sp|P53485|ACTB2_TAKRU Actin, cytoplasmic 2 OS=Takifugu rubripes GN=actbb PE=3 SV=1 19 484 5.0E-47
sp|O65315|ACT_COLSC Actin OS=Coleochaete scutata PE=2 SV=1 18 484 5.0E-47
sp|P53478|ACT5_CHICK Actin, cytoplasmic type 5 OS=Gallus gallus PE=3 SV=1 19 484 6.0E-47
sp|P53472|ACTA_STRPU Actin, cytoskeletal 1A OS=Strongylocentrotus purpuratus GN=CYIA PE=3 SV=1 19 484 6.0E-47
sp|P68555|ACT_TAESO Actin OS=Taenia solium GN=ACT1 PE=3 SV=1 17 484 6.0E-47
sp|P18601|ACT2_ARTSX Actin, clone 211 OS=Artemia sp. PE=2 SV=1 19 484 6.0E-47
sp|P68556|ACT1_DIPDE Actin-1/4 OS=Diphyllobothrium dendriticum GN=ACT1 PE=2 SV=1 17 484 6.0E-47
sp|P04829|ACT3_BOMMO Actin, cytoplasmic A3 OS=Bombyx mori PE=3 SV=3 19 484 8.0E-47
sp|P30162|ACT1_ONCVO Actin-1 OS=Onchocerca volvulus GN=act-1a PE=3 SV=1 19 484 8.0E-47
sp|P69003|ACT1_HELTB Actin CyI, cytoplasmic OS=Heliocidaris tuberculata PE=3 SV=1 19 484 8.0E-47
sp|P69002|ACT1_HELER Actin CyI, cytoplasmic OS=Heliocidaris erythrogramma PE=3 SV=1 19 484 8.0E-47
sp|P53471|ACT2_SCHMA Actin-2 OS=Schistosoma mansoni PE=2 SV=1 19 484 8.0E-47
sp|P49871|ACT_MANSE Actin, muscle OS=Manduca sexta PE=2 SV=1 19 484 9.0E-47
sp|P48975|ACTB_CRIGR Actin, cytoplasmic 1 OS=Cricetulus griseus GN=ACTB PE=3 SV=1 19 484 1.0E-46
sp|P69005|ACTD_STRPU Actin, cytoskeletal 2B OS=Strongylocentrotus purpuratus GN=CYIIB PE=2 SV=1 19 484 1.0E-46
sp|P69004|ACT2_STRFN Actin-15B OS=Strongylocentrotus franciscanus PE=2 SV=1 19 484 1.0E-46
sp|P53466|ACT2_LYTPI Actin, cytoskeletal 2 OS=Lytechinus pictus PE=2 SV=1 19 484 1.0E-46
sp|Q9Y707|ACT2_SUIBO Actin-2 OS=Suillus bovinus GN=ACT2 PE=2 SV=1 19 484 1.0E-46
sp|P20904|ACT_VOLCA Actin OS=Volvox carteri PE=3 SV=1 20 484 1.0E-46
sp|P17126|ACT_HYDVU Actin, non-muscle 6.2 OS=Hydra vulgaris PE=3 SV=1 19 484 1.0E-46
sp|P10990|ACT1_STRFN Actin-15A OS=Strongylocentrotus franciscanus PE=3 SV=1 19 484 1.0E-46
sp|Q7ZVI7|ACTB1_DANRE Actin, cytoplasmic 1 OS=Danio rerio GN=actba PE=2 SV=2 19 484 2.0E-46
sp|P53456|ACT2_DIPDE Actin-2 OS=Diphyllobothrium dendriticum GN=ACT2 PE=2 SV=1 17 484 2.0E-46
sp|P15475|ACTB_XENBO Actin, cytoplasmic 1 OS=Xenopus borealis GN=actb PE=3 SV=1 19 484 2.0E-46
sp|Q0PGG4|ACTB_BOSMU Actin, cytoplasmic 1 OS=Bos mutus grunniens GN=ACTB PE=2 SV=1 19 484 2.0E-46
sp|P30163|ACT2_ONCVO Actin-2 OS=Onchocerca volvulus GN=act-2b PE=3 SV=1 19 484 2.0E-46
sp|P07829|ACT3_DICDI Actin-3 OS=Dictyostelium discoideum GN=act3 PE=3 SV=3 19 484 3.0E-46
sp|Q7RME1|ACT1_PLAYO Actin-1 OS=Plasmodium yoelii yoelii GN=PY02240 PE=3 SV=1 17 484 3.0E-46
sp|P53498|ACT_CHLRE Actin OS=Chlamydomonas reinhardtii PE=2 SV=1 20 484 3.0E-46
sp|P45887|ACT5_BACDO Actin-5, muscle-specific OS=Bactrocera dorsalis PE=2 SV=1 19 484 3.0E-46
sp|P07836|ACT1_BOMMO Actin, muscle-type A1 OS=Bombyx mori PE=3 SV=1 19 484 3.0E-46
sp|Q03341|ACT2_ECHGR Actin-2 OS=Echinococcus granulosus GN=ACTII PE=3 SV=1 19 484 3.0E-46
sp|P0C540|ACT7_ORYSJ Actin-7 OS=Oryza sativa subsp. japonica GN=ACT7 PE=3 SV=1 19 484 3.0E-46
sp|P0C542|ACT7_ORYSI Actin-7 OS=Oryza sativa subsp. indica GN=ACT7 PE=3 SV=1 19 484 3.0E-46
sp|P41113|ACT3_PODCA Actin-3 OS=Podocoryna carnea GN=ACT3 PE=3 SV=1 19 484 4.0E-46
sp|P53470|ACT1_SCHMA Actin-1 OS=Schistosoma mansoni PE=2 SV=1 19 484 4.0E-46
sp|P83968|ACT6_DROSI Actin, indirect flight muscle OS=Drosophila simulans GN=Act88F PE=3 SV=1 19 484 5.0E-46
sp|P83967|ACT6_DROME Actin, indirect flight muscle OS=Drosophila melanogaster GN=Act88F PE=1 SV=1 19 484 5.0E-46
sp|P83969|ACT1_BACDO Actin, indirect flight muscle OS=Bactrocera dorsalis PE=3 SV=1 19 484 5.0E-46
sp|P41112|ACT1_PODCA Actin-1/2 OS=Podocoryna carnea GN=ACTIA PE=2 SV=1 19 484 6.0E-46
sp|Q4Z1L3|ACT1_PLABA Actin-1 OS=Plasmodium berghei (strain Anka) GN=PB000323.01.0 PE=1 SV=1 17 484 6.0E-46
sp|P41339|ACTA_LIMPO Actin, acrosomal process isoform OS=Limulus polyphemus PE=2 SV=1 19 484 6.0E-46
sp|P18499|ACTF_STRPU Actin, cytoskeletal 3B OS=Strongylocentrotus purpuratus GN=CYIIIB PE=2 SV=1 19 484 6.0E-46
sp|P53458|ACT5_DIPDE Actin-5 (Fragment) OS=Diphyllobothrium dendriticum GN=ACT5 PE=2 SV=1 21 484 6.0E-46
sp|P41341|ACTY_LIMPO Actin-11 OS=Limulus polyphemus PE=2 SV=1 19 484 6.0E-46
sp|Q6P8G3|ACT3_XENTR Actin, alpha sarcomeric/skeletal OS=Xenopus tropicalis GN=act3 PE=2 SV=1 19 484 7.0E-46
sp|P12716|ACTC_PISOC Actin, cytoplasmic OS=Pisaster ochraceus PE=3 SV=1 19 484 8.0E-46
sp|P26182|ACT_ACHBI Actin OS=Achlya bisexualis PE=3 SV=1 19 484 9.0E-46
sp|P24263|ACTD_PHYPO Actin, spherule isoform OS=Physarum polycephalum GN=ARDD PE=2 SV=2 20 484 9.0E-46
sp|P53461|ACTC_HALRO Actin, nonmuscle OS=Halocynthia roretzi GN=CA1 PE=3 SV=1 19 484 9.0E-46
sp|O18500|ACT2_SACKO Actin-2 OS=Saccoglossus kowalevskii PE=2 SV=1 19 484 1.0E-45
sp|A3C6D7|ACT2_ORYSJ Actin-2 OS=Oryza sativa subsp. japonica GN=ACT2 PE=2 SV=1 18 484 1.0E-45
sp|P0C539|ACT2_ORYSI Actin-2 OS=Oryza sativa subsp. indica GN=ACT2 PE=3 SV=1 18 484 1.0E-45
sp|P30171|ACT11_SOLTU Actin-97 OS=Solanum tuberosum GN=AC97 PE=3 SV=1 18 484 1.0E-45
sp|Q8SWN8|ACT_ENCCU Actin OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0460 PE=1 SV=2 21 484 1.0E-45
sp|P53476|ACT_TOXGO Actin OS=Toxoplasma gondii GN=ACT1 PE=3 SV=1 19 484 1.0E-45
sp|P86287|ACT1_PLAFX Actin-1 OS=Plasmodium falciparum (isolate HB3) PE=1 SV=1 17 484 1.0E-45
sp|Q8I4X0|ACT1_PLAF7 Actin-1 OS=Plasmodium falciparum (isolate 3D7) GN=PFL2215w PE=3 SV=1 17 484 1.0E-45
sp|P04752|ACT3_XENLA Actin, alpha skeletal muscle 3 OS=Xenopus laevis GN=act3 PE=2 SV=2 19 484 1.0E-45
sp|P53473|ACTB_STRPU Actin, cytoskeletal 1B OS=Strongylocentrotus purpuratus GN=CYIB PE=3 SV=1 19 484 1.0E-45
sp|Q10AZ4|ACT3_ORYSJ Actin-3 OS=Oryza sativa subsp. japonica GN=ACT3 PE=2 SV=1 18 484 1.0E-45
sp|A2XNS1|ACT3_ORYSI Actin-3 OS=Oryza sativa subsp. indica GN=ACT3 PE=3 SV=2 18 484 1.0E-45
sp|P53459|ACT6_DIPDE Actin-6 (Fragment) OS=Diphyllobothrium dendriticum GN=ACT6 PE=2 SV=1 19 484 2.0E-45
sp|P53497|ACT12_ARATH Actin-12 OS=Arabidopsis thaliana GN=ACT12 PE=1 SV=1 18 484 2.0E-45
sp|O81221|ACT_GOSHI Actin OS=Gossypium hirsutum PE=3 SV=1 18 484 2.0E-45
sp|P53457|ACT3_DIPDE Actin-3 OS=Diphyllobothrium dendriticum GN=ACT3 PE=2 SV=1 19 484 2.0E-45
sp|P63256|ACTG_ANSAN Actin, cytoplasmic 2 OS=Anser anser anser GN=ACTG1 PE=2 SV=1 19 484 2.0E-45
sp|P02574|ACT4_DROME Actin, larval muscle OS=Drosophila melanogaster GN=Act79B PE=1 SV=2 19 484 2.0E-45
sp|P26183|ACT_CRYPV Actin OS=Cryptosporidium parvum PE=3 SV=1 19 484 3.0E-45
sp|Q00215|ACTC_STYPL Actin, cytoplasmic OS=Styela plicata PE=3 SV=1 19 484 3.0E-45
sp|P12717|ACTM_PISOC Actin, muscle OS=Pisaster ochraceus PE=3 SV=1 19 484 4.0E-45
sp|P11426|ACT_ENTHI Actin OS=Entamoeba histolytica PE=2 SV=1 17 484 4.0E-45
sp|P04751|ACTC_XENLA Actin, alpha cardiac muscle 1 OS=Xenopus laevis GN=actc1 PE=2 SV=1 19 484 4.0E-45
sp|P0CJ47|ACT3_ARATH Actin-3 OS=Arabidopsis thaliana GN=ACT3 PE=1 SV=1 18 484 4.0E-45
sp|P0CJ46|ACT1_ARATH Actin-1 OS=Arabidopsis thaliana GN=ACT1 PE=1 SV=1 18 484 4.0E-45
sp|P53474|ACTE_STRPU Actin, cytoskeletal 3A OS=Strongylocentrotus purpuratus GN=CYIIIA PE=3 SV=1 19 484 4.0E-45
sp|P22131|ACT1_PHYIN Actin-1 OS=Phytophthora infestans GN=ACTA PE=2 SV=1 19 484 4.0E-45
sp|Q562R1|ACTBL_HUMAN Beta-actin-like protein 2 OS=Homo sapiens GN=ACTBL2 PE=1 SV=2 19 484 4.0E-45
sp|P53496|ACT11_ARATH Actin-11 OS=Arabidopsis thaliana GN=ACT11 PE=1 SV=1 18 484 5.0E-45
sp|Q99023|ACT_HYPJE Actin OS=Hypocrea jecorina GN=act PE=3 SV=1 19 484 5.0E-45
sp|Q96293|ACT8_ARATH Actin-8 OS=Arabidopsis thaliana GN=ACT8 PE=1 SV=2 18 484 5.0E-45
sp|P53494|ACT4_ARATH Actin-4 OS=Arabidopsis thaliana GN=ACT4 PE=1 SV=1 18 484 5.0E-45
sp|Q96292|ACT2_ARATH Actin-2 OS=Arabidopsis thaliana GN=ACT2 PE=1 SV=1 18 484 5.0E-45
sp|P68264|ACTS_OREMO Actin, alpha skeletal muscle OS=Oreochromis mossambicus GN=acta1 PE=2 SV=1 19 484 7.0E-45
sp|P68140|ACTSA_TAKRU Actin, alpha skeletal muscle A OS=Takifugu rubripes GN=acta1a PE=2 SV=1 19 484 7.0E-45
sp|P53480|ACTC_TAKRU Actin, alpha cardiac OS=Takifugu rubripes PE=2 SV=1 19 484 7.0E-45
sp|P30167|ACT3_SOLTU Actin-58 OS=Solanum tuberosum GN=AC58 PE=3 SV=1 18 484 8.0E-45
sp|Q7RPB4|ACT2_PLAYO Actin-2 OS=Plasmodium yoelii yoelii GN=PY01545 PE=3 SV=1 19 484 8.0E-45
sp|P53482|ACTSB_TAKRU Actin, alpha skeletal muscle B OS=Takifugu rubripes GN=acta1b PE=2 SV=1 19 484 9.0E-45
sp|P10988|ACT1_PLAFO Actin-1 OS=Plasmodium falciparum (isolate NF54) PE=2 SV=1 17 484 1.0E-44
sp|P10995|ACT2_XENLA Actin, alpha skeletal muscle 2 OS=Xenopus laevis GN=act2 PE=2 SV=1 19 484 1.0E-44
sp|P68136|ACTS_RAT Actin, alpha skeletal muscle OS=Rattus norvegicus GN=Acta1 PE=1 SV=1 19 484 1.0E-44
sp|P68135|ACTS_RABIT Actin, alpha skeletal muscle OS=Oryctolagus cuniculus GN=ACTA1 PE=1 SV=1 19 484 1.0E-44
sp|Q5R9Q5|ACTS_PONAB Actin, alpha skeletal muscle OS=Pongo abelii GN=ACTA1 PE=2 SV=1 19 484 1.0E-44
sp|P68137|ACTS_PIG Actin, alpha skeletal muscle OS=Sus scrofa GN=ACTA1 PE=3 SV=1 19 484 1.0E-44
sp|P68134|ACTS_MOUSE Actin, alpha skeletal muscle OS=Mus musculus GN=Acta1 PE=1 SV=1 19 484 1.0E-44
sp|P68133|ACTS_HUMAN Actin, alpha skeletal muscle OS=Homo sapiens GN=ACTA1 PE=1 SV=1 19 484 1.0E-44
sp|P68139|ACTS_CHICK Actin, alpha skeletal muscle OS=Gallus gallus GN=ACTA1 PE=1 SV=1 19 484 1.0E-44
sp|P68138|ACTS_BOVIN Actin, alpha skeletal muscle OS=Bos taurus GN=ACTA1 PE=1 SV=1 19 484 1.0E-44
sp|Q4YU79|ACT2_PLABA Actin-2 OS=Plasmodium berghei (strain Anka) GN=PB001050.02.0 PE=1 SV=1 19 484 2.0E-44
sp|Q07903|ACTC_STRPU Actin, cytoskeletal 2A OS=Strongylocentrotus purpuratus GN=CYIIA PE=2 SV=1 19 484 2.0E-44
sp|P53479|ACTS_CYPCA Actin, alpha skeletal muscle OS=Cyprinus carpio GN=acta1 PE=2 SV=1 19 484 2.0E-44
sp|P53465|ACT1_LYTPI Actin, cytoskeletal 1 OS=Lytechinus pictus PE=2 SV=1 19 484 2.0E-44
sp|Q39758|ACT_FUCVE Actin OS=Fucus vesiculosus PE=2 SV=1 19 484 2.0E-44
sp|P49128|ACT1_AEDAE Actin-1 OS=Aedes aegypti GN=ACT-1 PE=2 SV=2 19 484 2.0E-44
sp|O65316|ACT_MESVI Actin OS=Mesostigma viride PE=3 SV=1 20 484 2.0E-44
sp|P53492|ACT7_ARATH Actin-7 OS=Arabidopsis thaliana GN=ACT7 PE=1 SV=1 18 484 2.0E-44
sp|P49055|ACTS_CARAU Actin, alpha skeletal muscle OS=Carassius auratus GN=acta1 PE=2 SV=1 19 484 2.0E-44
sp|P86288|ACT2_PLAFX Actin-2 OS=Plasmodium falciparum (isolate HB3) PE=3 SV=1 19 484 2.0E-44
sp|Q8ILW9|ACT2_PLAF7 Actin-2 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0124 PE=3 SV=1 19 484 2.0E-44
sp|Q6P640|ACTC_XENTR Actin, alpha cardiac muscle 1 OS=Xenopus tropicalis GN=actc1 PE=2 SV=1 19 484 3.0E-44
sp|P68035|ACTC_RAT Actin, alpha cardiac muscle 1 OS=Rattus norvegicus GN=Actc1 PE=2 SV=1 19 484 3.0E-44
sp|P68033|ACTC_MOUSE Actin, alpha cardiac muscle 1 OS=Mus musculus GN=Actc1 PE=1 SV=1 19 484 3.0E-44
sp|P68032|ACTC_HUMAN Actin, alpha cardiac muscle 1 OS=Homo sapiens GN=ACTC1 PE=1 SV=1 19 484 3.0E-44
sp|P68034|ACTC_CHICK Actin, alpha cardiac muscle 1 OS=Gallus gallus GN=ACTC1 PE=3 SV=1 19 484 3.0E-44
sp|Q3ZC07|ACTC_BOVIN Actin, alpha cardiac muscle 1 OS=Bos taurus GN=ACTC1 PE=2 SV=1 19 484 3.0E-44
sp|Q8BFZ3|ACTBL_MOUSE Beta-actin-like protein 2 OS=Mus musculus GN=Actbl2 PE=1 SV=1 19 484 3.0E-44
sp|P27131|ACT1_NAEFO Actin-1 OS=Naegleria fowleri PE=2 SV=2 19 483 3.0E-44
sp|Q25472|ACT2_MOLOC Actin, muscle-type OS=Molgula oculata PE=3 SV=1 19 484 3.0E-44
sp|Q10DV7|ACT1_ORYSJ Actin-1 OS=Oryza sativa subsp. japonica GN=ACT1 PE=2 SV=1 18 484 3.0E-44
sp|A2XLF2|ACT1_ORYSI Actin-1 OS=Oryza sativa subsp. indica GN=ACT1 PE=2 SV=1 18 484 3.0E-44
sp|Q98972|ACTS_ORYLA Actin, alpha skeletal muscle OS=Oryzias latipes GN=acta1 PE=2 SV=1 19 484 3.0E-44
sp|P14883|ACT2_PLAFO Actin-2 OS=Plasmodium falciparum (isolate NF54) PE=2 SV=1 19 484 5.0E-44
sp|P30173|ACT13_SOLTU Actin-101 OS=Solanum tuberosum GN=AC101 PE=3 SV=1 18 484 5.0E-44
sp|P20399|ACT2_XENTR Actin, alpha cardiac muscle 2 OS=Xenopus tropicalis PE=2 SV=1 19 484 7.0E-44
sp|Q05214|ACT1_TOBAC Actin OS=Nicotiana tabacum PE=3 SV=1 18 484 8.0E-44
sp|P35432|ACT1_ECHGR Actin-1 OS=Echinococcus granulosus GN=ACTI PE=3 SV=1 18 484 9.0E-44
sp|Q8RYC2|ACT5_ARATH Putative actin-5 OS=Arabidopsis thaliana GN=ACT5 PE=5 SV=1 18 484 9.0E-44
sp|P08023|ACTA_CHICK Actin, aortic smooth muscle OS=Gallus gallus GN=ACTA2 PE=1 SV=2 19 484 1.0E-43
sp|Q90X97|ACTS_ATRMM Actin, alpha skeletal muscle OS=Atractaspis microlepidota microlepidota GN=ACTA1 PE=2 SV=1 19 484 1.0E-43
sp|P63269|ACTH_RAT Actin, gamma-enteric smooth muscle OS=Rattus norvegicus GN=Actg2 PE=2 SV=1 19 484 1.0E-43
sp|P63268|ACTH_MOUSE Actin, gamma-enteric smooth muscle OS=Mus musculus GN=Actg2 PE=1 SV=1 19 484 1.0E-43
sp|P63267|ACTH_HUMAN Actin, gamma-enteric smooth muscle OS=Homo sapiens GN=ACTG2 PE=1 SV=1 19 484 1.0E-43
sp|P63270|ACTH_CHICK Actin, gamma-enteric smooth muscle OS=Gallus gallus GN=ACTG2 PE=1 SV=1 19 484 1.0E-43
sp|Q5E9B5|ACTH_BOVIN Actin, gamma-enteric smooth muscle OS=Bos taurus GN=ACTG2 PE=2 SV=1 19 484 1.0E-43
sp|P62738|ACTA_RAT Actin, aortic smooth muscle OS=Rattus norvegicus GN=Acta2 PE=2 SV=1 19 484 2.0E-43
sp|P62740|ACTA_RABIT Actin, aortic smooth muscle OS=Oryctolagus cuniculus GN=ACTA2 PE=2 SV=1 19 484 2.0E-43
sp|P62737|ACTA_MOUSE Actin, aortic smooth muscle OS=Mus musculus GN=Acta2 PE=1 SV=1 19 484 2.0E-43
sp|P62736|ACTA_HUMAN Actin, aortic smooth muscle OS=Homo sapiens GN=ACTA2 PE=1 SV=1 19 484 2.0E-43
sp|P62739|ACTA_BOVIN Actin, aortic smooth muscle OS=Bos taurus GN=ACTA2 PE=1 SV=1 19 484 2.0E-43
sp|P46258|ACT3_PEA Actin-3 OS=Pisum sativum PE=2 SV=1 18 484 3.0E-43
sp|P27130|ACT2_HALRO Actin, muscle 2/4/4A OS=Halocynthia roretzi GN=MA2 PE=2 SV=1 17 484 4.0E-43
sp|P51775|ACT_GIAIN Actin OS=Giardia intestinalis PE=3 SV=1 19 484 4.0E-43
sp|P53475|ACTN_STYCL Actin, muscle OS=Styela clava GN=TB12 PE=2 SV=1 17 484 5.0E-43
sp|Q554S6|ACT17_DICDI Actin-17 OS=Dictyostelium discoideum GN=act17 PE=3 SV=1 20 484 6.0E-43
sp|P13363|ACT_PHYME Actin OS=Phytophthora megasperma PE=3 SV=1 19 484 8.0E-43
sp|P26198|ACTM_STYCL Actin, muscle OS=Styela clava PE=2 SV=1 17 484 8.0E-43
sp|P02581|ACT1_SOYBN Actin-1 OS=Glycine max GN=SAC1 PE=3 SV=2 19 484 8.0E-43
sp|P22132|ACT2_PHYIN Actin-2 OS=Phytophthora infestans GN=ACTB PE=2 SV=1 19 484 1.0E-42
sp|A5DQP9|ACT_PICGU Actin OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ACT1 PE=3 SV=1 33 484 2.0E-42
sp|O15998|ACTM_CIOSA Actin, muscle OS=Ciona savignyi PE=2 SV=1 22 484 3.0E-42
sp|P30164|ACT1_PEA Actin-1 OS=Pisum sativum PE=2 SV=1 18 484 7.0E-42
sp|O17502|ACTM_BRALA Actin, muscle OS=Branchiostoma lanceolatum PE=2 SV=1 19 484 8.0E-42
sp|P53467|ACTM_MOLOC Actin, larval muscle-type OS=Molgula oculata PE=3 SV=1 22 484 8.0E-42
sp|P84856|ACTB_CHLPG Actin, cytoplasmic 1 OS=Chlorocebus pygerythrus GN=ACTB PE=1 SV=1 33 484 8.0E-42
sp|P30172|ACT12_SOLTU Actin-100 (Fragment) OS=Solanum tuberosum GN=AC100 PE=3 SV=1 35 484 1.0E-41
sp|P42025|ACTY_HUMAN Beta-centractin OS=Homo sapiens GN=ACTR1B PE=1 SV=1 24 484 1.0E-41
sp|P30165|ACT2_PEA Actin-2 OS=Pisum sativum PE=2 SV=1 18 484 1.0E-41
sp|Q93132|ACTM_BRAFL Actin, muscle OS=Branchiostoma floridae PE=2 SV=1 19 484 1.0E-41
sp|P30168|ACT6_SOLTU Actin-71 OS=Solanum tuberosum GN=AC71 PE=3 SV=2 19 484 2.0E-41
sp|P53460|ACT1_HALRO Actin, muscle 1A OS=Halocynthia roretzi GN=MA1A PE=3 SV=1 17 484 2.0E-41
sp|P23343|ACT1_DAUCA Actin-1 OS=Daucus carota PE=2 SV=1 18 484 3.0E-41
sp|Q93130|ACTM_BRABE Actin, muscle OS=Branchiostoma belcheri PE=2 SV=1 19 484 4.0E-41
sp|P53491|ACT_ACEPE Actin (Fragment) OS=Acetabularia peniculus PE=3 SV=1 35 484 4.0E-41
sp|P53504|ACT1_SORBI Actin-1 OS=Sorghum bicolor GN=AC1 PE=2 SV=1 18 484 6.0E-41
sp|P53502|ACT_FUCDI Actin OS=Fucus distichus PE=2 SV=1 19 484 6.0E-41
sp|P53468|ACT1_OXYTR Actin, cytoplasmic OS=Oxytricha trifallax PE=3 SV=1 25 484 6.0E-41
sp|P27132|ACT2_NAEFO Actin-2 (Fragment) OS=Naegleria fowleri PE=2 SV=1 21 482 6.0E-41
sp|Q8R5C5|ACTY_MOUSE Beta-centractin OS=Mus musculus GN=Actr1b PE=1 SV=1 24 484 9.0E-41
sp|A4IFE3|ACTY_BOVIN Beta-centractin OS=Bos taurus GN=ACTR1B PE=2 SV=1 24 484 1.0E-40
sp|Q55EU6|ACT23_DICDI Putative actin-23 OS=Dictyostelium discoideum GN=act23 PE=1 SV=1 34 484 1.0E-40
sp|P12431|ACTM_STRPU Actin, muscle OS=Strongylocentrotus purpuratus PE=3 SV=1 19 484 2.0E-40
sp|P12433|ACT2_TRYBB Actin B OS=Trypanosoma brucei brucei PE=3 SV=1 19 484 2.0E-40
sp|Q9BYX7|ACTBM_HUMAN Putative beta-actin-like protein 3 OS=Homo sapiens GN=POTEKP PE=5 SV=1 19 484 4.0E-40
sp|P07828|ACT18_DICDI Actin-18 OS=Dictyostelium discoideum GN=act18 PE=3 SV=3 19 484 6.0E-40
sp|P02582|ACT1_MAIZE Actin-1 OS=Zea mays GN=ACT1 PE=3 SV=1 19 484 6.0E-40
sp|P42023|ACTZ_PNECA Actin-2 OS=Pneumocystis carinii PE=2 SV=1 24 484 6.0E-40
sp|Q03342|ACT3_ECHGR Actin-3 (Fragment) OS=Echinococcus granulosus GN=ACTIII PE=2 SV=1 160 484 7.0E-40
sp|P12432|ACT1_TRYBB Actin A OS=Trypanosoma brucei brucei PE=3 SV=1 19 484 9.0E-40
sp|P85515|ACTZ_RAT Alpha-centractin OS=Rattus norvegicus GN=Actr1a PE=1 SV=1 24 484 1.0E-39
sp|P61164|ACTZ_MOUSE Alpha-centractin OS=Mus musculus GN=Actr1a PE=1 SV=1 24 484 1.0E-39
sp|Q4R6J9|ACTZ_MACFA Alpha-centractin OS=Macaca fascicularis GN=ACTR1A PE=2 SV=1 24 484 1.0E-39
sp|P61163|ACTZ_HUMAN Alpha-centractin OS=Homo sapiens GN=ACTR1A PE=1 SV=1 24 484 1.0E-39
sp|P61162|ACTZ_CANLF Alpha-centractin OS=Canis lupus familiaris GN=ACTR1A PE=2 SV=1 24 484 1.0E-39
sp|P53477|ACT_TRYCR Actin OS=Trypanosoma cruzi PE=3 SV=1 19 484 1.0E-39
sp|P55805|ACT2_STENO Actin, cytoplasmic OS=Sterkiella nova GN=MIC-ACT-1 PE=3 SV=1 24 484 2.0E-39
sp|P45521|ACT_PROCL Actin (Fragment) OS=Procambarus clarkii PE=1 SV=1 160 484 2.0E-39
sp|P12715|ACT1_STENO Actin, cytoplasmic OS=Sterkiella nova PE=3 SV=1 24 484 5.0E-39
sp|P53469|ACT2_OXYTR Actin, cytoplasmic OS=Oxytricha trifallax PE=3 SV=1 25 484 5.0E-39
sp|O00937|ACT_STECV Actin OS=Sterkiella cavicola PE=3 SV=2 20 484 6.0E-39
sp|P10993|ACT2_TETPY Actin, cytoplasmic OS=Tetrahymena pyriformis PE=3 SV=2 160 484 7.0E-39
sp|Q00214|ACTM_STYPL Actin, muscle OS=Styela plicata PE=3 SV=1 19 484 8.0E-39
sp|P02580|ACT3_SOYBN Actin-3 OS=Glycine max GN=SAC3 PE=3 SV=2 18 484 1.0E-38
sp|Q54HF1|ACT24_DICDI Putative actin-24 OS=Dictyostelium discoideum GN=act24 PE=3 SV=1 24 484 1.0E-38
sp|P45520|ACT_LEIMA Actin OS=Leishmania major PE=3 SV=1 19 484 2.0E-38
sp|P10992|ACT1_TETTH Actin, macronuclear OS=Tetrahymena thermophila PE=1 SV=3 160 484 4.0E-38
sp|P45889|ACTZ_DROME Actin-related protein 1 OS=Drosophila melanogaster GN=Arp1 PE=2 SV=2 24 483 4.0E-38
sp|P18602|ACT3_ARTSX Actin, clone 302 (Fragment) OS=Artemia sp. PE=2 SV=1 160 484 1.0E-37
sp|P30161|ACT_COSCS Actin (Fragment) OS=Costaria costata PE=3 SV=2 160 484 7.0E-37
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 6 484 2.0E-36
sp|Q54HF0|ACT25_DICDI Putative actin-25 OS=Dictyostelium discoideum GN=act25 PE=3 SV=1 19 484 2.0E-36
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 6 484 2.0E-36
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 6 484 3.0E-36
sp|P23344|ACT2_DAUCA Actin-2 OS=Daucus carota PE=2 SV=1 17 484 3.0E-36
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 6 484 4.0E-36
sp|P38673|ACTZ_NEUCR Actin-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-4 PE=3 SV=1 24 483 6.0E-36
sp|P53499|ACT_CHOCR Actin OS=Chondrus crispus GN=AC PE=2 SV=1 23 484 9.0E-36
sp|P53483|ACTX_TAKRU Actin, alpha anomalous OS=Takifugu rubripes PE=2 SV=1 160 484 9.0E-36
sp|Q54I79|ACTY_DICDI Centractin OS=Dictyostelium discoideum GN=arpA PE=1 SV=1 24 484 3.0E-35
sp|P93738|ACT9_ARATH Putative actin-9 OS=Arabidopsis thaliana GN=ACT9 PE=5 SV=1 160 484 3.0E-35
sp|P45891|ACTY_DROME Actin-like protein 53D OS=Drosophila melanogaster GN=Arp53D PE=2 SV=2 22 484 9.0E-35
sp|P30169|ACT7_SOLTU Actin-75 OS=Solanum tuberosum GN=AC75 PE=3 SV=1 19 484 1.0E-34
sp|P02583|ACT2_OXYFA Actin, cytoplasmic OS=Oxytricha fallax PE=3 SV=1 25 484 3.0E-34
sp|Q9NJV4|ACT1_NAEGR Actin-1 OS=Naegleria gruberi GN=ACT1 PE=3 SV=1 160 484 2.0E-33
sp|Q55CU2|ACT26_DICDI Putative actin-26 OS=Dictyostelium discoideum GN=act26 PE=3 SV=1 19 483 2.0E-33
sp|P93584|ACT9_SOLTU Actin-82 (Fragment) OS=Solanum tuberosum PE=3 SV=1 35 464 2.0E-33
sp|Q6CSB9|ARP4_KLULA Actin-related protein 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARP4 PE=3 SV=1 15 361 3.0E-33
sp|P93587|ACT1_SOLTU Actin-42 (Fragment) OS=Solanum tuberosum PE=3 SV=1 35 464 3.0E-33
sp|Q6AY16|ACTL9_RAT Actin-like protein 9 OS=Rattus norvegicus GN=Actl9 PE=2 SV=1 8 484 7.0E-33
sp|P53503|ACT1_OXYFA Actin, macronuclear OS=Oxytricha fallax PE=3 SV=1 25 484 2.0E-32
sp|P38696|ARP1_YEAST Centractin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP1 PE=1 SV=1 24 479 2.0E-32
sp|P20360|ACT_EUPCR Actin, cytoplasmic OS=Euplotes crassus PE=3 SV=1 23 484 3.0E-32
sp|P93376|ACT6_TOBAC Actin-103 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 35 464 4.0E-32
sp|Q96482|ACT1_SOLLC Actin-41 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 35 464 5.0E-32
sp|P81228|ACT5_SOLTU Actin-66 (Fragment) OS=Solanum tuberosum PE=3 SV=1 35 464 9.0E-32
sp|Q2T9W4|ACTL9_BOVIN Actin-like protein 9 OS=Bos taurus GN=ACTL9 PE=2 SV=1 20 484 1.0E-31
sp|P93371|ACT5_TOBAC Actin-93 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 35 464 1.0E-31
sp|P80428|ARP4_YEAST Actin-related protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP4 PE=1 SV=1 15 315 1.0E-31
sp|P81229|ACT8_SOLTU Actin-79 (Fragment) OS=Solanum tuberosum PE=3 SV=1 35 464 2.0E-31
sp|P93374|ACT2_TOBAC Actin-53 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 35 464 3.0E-31
sp|Q96484|ACT3_SOLLC Actin-52 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 35 464 5.0E-31
sp|P93372|ACT4_TOBAC Actin-66 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 35 464 5.0E-31
sp|P93375|ACT7_TOBAC Actin-104 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 35 464 1.0E-30
sp|Q4R317|ACTT2_MACFA Actin-related protein T2 OS=Macaca fascicularis GN=ACTRT2 PE=2 SV=1 23 484 2.0E-30
sp|Q8TDG2|ACTT1_HUMAN Actin-related protein T1 OS=Homo sapiens GN=ACTRT1 PE=2 SV=2 20 484 2.0E-30
sp|Q8TDY3|ACTT2_HUMAN Actin-related protein T2 OS=Homo sapiens GN=ACTRT2 PE=2 SV=2 23 484 2.0E-30
sp|Q96481|ACT4_SOLLC Actin-105 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 35 464 2.0E-30
sp|P93586|ACT2_SOLTU Actin-46 (Fragment) OS=Solanum tuberosum PE=3 SV=1 35 464 5.0E-30
sp|Q96483|ACT2_SOLLC Actin-51 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 35 464 7.0E-30
sp|Q8BXF8|ACTT3_MOUSE Actin-related protein T3 OS=Mus musculus GN=Actrt3 PE=1 SV=1 161 484 7.0E-30
sp|Q5XIK1|ACTT1_RAT Actin-related protein T1 OS=Rattus norvegicus GN=Actrt1 PE=2 SV=1 23 484 1.0E-29
sp|Q9BYD9|ACTT3_HUMAN Actin-related protein T3 OS=Homo sapiens GN=ACTRT3 PE=2 SV=1 161 484 4.0E-29
sp|Q2TA43|ACTT2_BOVIN Actin-related protein T2 OS=Bos taurus GN=ACTRT2 PE=2 SV=1 150 484 7.0E-29
sp|O94630|ARP1_SCHPO Centractin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp1 PE=3 SV=1 24 483 7.0E-29
sp|Q92192|ACT_CALFI Actin (Fragment) OS=Calanus finmarchicus PE=2 SV=1 160 466 7.0E-29
sp|Q8TC94|ACTL9_HUMAN Actin-like protein 9 OS=Homo sapiens GN=ACTL9 PE=1 SV=3 20 484 7.0E-29
sp|Q54L54|ACT29_DICDI Putative actin-29 OS=Dictyostelium discoideum GN=act29 PE=3 SV=1 22 484 4.0E-28
sp|Q32KZ2|ACL7A_BOVIN Actin-like protein 7A OS=Bos taurus GN=ACTL7A PE=2 SV=1 23 484 2.0E-27
sp|Q9D9L5|ACTT2_MOUSE Actin-related protein T2 OS=Mus musculus GN=Actrt2 PE=2 SV=1 161 484 2.0E-27
sp|Q95JK8|ACL7B_MACFA Actin-like protein 7B OS=Macaca fascicularis GN=ACTL7B PE=2 SV=1 20 484 2.0E-27
sp|Q9QY83|ACL7B_MOUSE Actin-like protein 7B OS=Mus musculus GN=Actl7b PE=1 SV=2 20 484 3.0E-27
sp|Q4QR76|ACL7B_RAT Actin-like protein 7B OS=Rattus norvegicus GN=Actl7b PE=1 SV=1 20 484 3.0E-27
sp|Q9D9J3|ACTT1_MOUSE Actin-related protein T1 OS=Mus musculus GN=Actrt1 PE=2 SV=1 160 484 5.0E-27
sp|P93373|ACT3_TOBAC Actin-54 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 35 465 5.0E-27
sp|Q9Y614|ACL7B_HUMAN Actin-like protein 7B OS=Homo sapiens GN=ACTL7B PE=2 SV=1 154 484 5.0E-27
sp|P93585|ACT4_SOLTU Actin-65 (Fragment) OS=Solanum tuberosum PE=3 SV=1 160 462 7.0E-27
sp|Q25381|ACTM_LYTPI Actin, muscle (Fragment) OS=Lytechinus pictus PE=3 SV=1 337 484 7.0E-27
sp|Q32L91|ACL7B_BOVIN Actin-like protein 7B OS=Bos taurus GN=ACTL7B PE=2 SV=1 20 484 1.0E-26
sp|Q8CG27|ACTL9_MOUSE Actin-like protein 9 OS=Mus musculus GN=Actl9 PE=1 SV=1 20 484 2.0E-26
sp|P24902|ACT_PINCO Actin (Fragment) OS=Pinus contorta PE=3 SV=1 339 484 3.0E-26
sp|Q4R821|ACTT1_MACFA Actin-related protein T1 OS=Macaca fascicularis GN=ACTRT1 PE=2 SV=1 157 484 3.0E-26
sp|Q92193|ACT_CRAVI Actin (Fragment) OS=Crassostrea virginica PE=2 SV=1 160 459 3.0E-26
sp|Q25379|ACT3_LYTPI Actin, cytoskeletal 3 (Fragment) OS=Lytechinus pictus PE=3 SV=1 337 484 4.0E-26
sp|Q9QY84|ACL7A_MOUSE Actin-like protein 7A OS=Mus musculus GN=Actl7a PE=1 SV=1 23 484 1.0E-25
sp|P43239|ACT1_PNECA Actin-1 OS=Pneumocystis carinii PE=2 SV=1 337 484 2.0E-25
sp|Q641W9|ACL7A_RAT Actin-like protein 7A OS=Rattus norvegicus GN=Actl7a PE=1 SV=1 23 484 4.0E-25
sp|Q4R6Q3|ACL7A_MACFA Actin-like protein 7A OS=Macaca fascicularis GN=ACTL7A PE=2 SV=1 23 484 8.0E-25
sp|Q9Y615|ACL7A_HUMAN Actin-like protein 7A OS=Homo sapiens GN=ACTL7A PE=1 SV=1 23 484 2.0E-24
sp|Q6CSB9|ARP4_KLULA Actin-related protein 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARP4 PE=3 SV=1 382 477 7.0E-24
sp|P80428|ARP4_YEAST Actin-related protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP4 PE=1 SV=1 382 476 7.0E-24
sp|Q54HE9|ACT27_DICDI Putative actin-27 OS=Dictyostelium discoideum GN=act27 PE=3 SV=2 21 480 7.0E-24
sp|Q25380|ACT4_LYTPI Actin, cytoskeletal 4 (Fragment) OS=Lytechinus pictus PE=3 SV=1 337 477 2.0E-23
sp|P10994|ACTS_PLEWA Actin, alpha skeletal muscle (Fragment) OS=Pleurodeles waltl PE=2 SV=1 382 484 8.0E-23
sp|Q9N4I0|ARP3_CAEEL Actin-related protein 3 OS=Caenorhabditis elegans GN=arx-1 PE=3 SV=1 20 480 5.0E-22
sp|Q9LSD6|ARP2_ARATH Actin-related protein 2 OS=Arabidopsis thaliana GN=ARP2 PE=1 SV=1 19 482 9.0E-21
sp|P53489|ARP2_CAEEL Actin-related protein 2 OS=Caenorhabditis elegans GN=arx-2 PE=3 SV=1 22 476 2.0E-20
sp|P43239|ACT1_PNECA Actin-1 OS=Pneumocystis carinii PE=2 SV=1 19 253 7.0E-20
sp|O96621|ARP2_DICDI Actin-related protein 2 OS=Dictyostelium discoideum GN=arpB PE=1 SV=1 19 485 1.0E-19
sp|Q6Z256|ARP2_ORYSJ Actin-related protein 2 OS=Oryza sativa subsp. japonica GN=ARP2 PE=3 SV=1 19 482 3.0E-19
sp|A2YUL5|ARP2_ORYSI Actin-related protein 2 OS=Oryza sativa subsp. indica GN=ARP2 PE=3 SV=2 19 482 3.0E-19
sp|Q7ZXV3|ARP2B_XENLA Actin-related protein 2-B OS=Xenopus laevis GN=actr2-b PE=2 SV=1 22 482 1.0E-18
sp|Q7SXW6|ARP2A_DANRE Actin-related protein 2-A OS=Danio rerio GN=actr2a PE=2 SV=1 22 482 1.0E-18
sp|Q56A35|ARP2B_DANRE Actin-related protein 2-B OS=Danio rerio GN=actr2b PE=2 SV=1 22 482 1.0E-18
sp|Q7ZTP2|ARP2A_XENLA Actin-related protein 2-A OS=Xenopus laevis GN=actr2-a PE=2 SV=1 22 482 2.0E-18
sp|P53488|ARP2_CHICK Actin-related protein 2 OS=Gallus gallus GN=ACTR2 PE=2 SV=1 22 482 2.0E-18
sp|P61161|ARP2_MOUSE Actin-related protein 2 OS=Mus musculus GN=Actr2 PE=1 SV=1 22 482 3.0E-18
sp|P61160|ARP2_HUMAN Actin-related protein 2 OS=Homo sapiens GN=ACTR2 PE=1 SV=1 22 482 3.0E-18
sp|A7MB62|ARP2_BOVIN Actin-related protein 2 OS=Bos taurus GN=ACTR2 PE=1 SV=1 22 482 3.0E-18
sp|Q5BL41|ARP2_XENTR Actin-related protein 2 OS=Xenopus tropicalis GN=actr2 PE=2 SV=1 22 482 4.0E-18
sp|Q5M7U6|ARP2_RAT Actin-related protein 2 OS=Rattus norvegicus GN=Actr2 PE=2 SV=1 22 482 4.0E-18
sp|Q9UUJ1|ARP2_SCHPO Actin-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp2 PE=1 SV=1 20 482 6.0E-18
sp|P32381|ARP2_YEAST Actin-related protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP2 PE=1 SV=1 24 482 8.0E-18
sp|P53487|ARP2_ACACA Actin-related protein 2 OS=Acanthamoeba castellanii GN=arp2 PE=2 SV=1 19 482 1.0E-17
sp|Q5R4K0|ARP2_PONAB Actin-related protein 2 OS=Pongo abelii GN=ACTR2 PE=2 SV=1 22 482 2.0E-17
sp|P42528|ARP3_DICDI Actin-related protein 3 OS=Dictyostelium discoideum GN=arpC PE=1 SV=1 23 480 7.0E-17
sp|A2AKE7|ACL10_MOUSE Actin-like protein 10 OS=Mus musculus GN=Actl10 PE=3 SV=1 163 481 2.0E-16
sp|Q641P0|ARP3B_MOUSE Actin-related protein 3B OS=Mus musculus GN=Actr3b PE=1 SV=1 25 480 5.0E-16
sp|P45888|ARP2_DROME Actin-related protein 2 OS=Drosophila melanogaster GN=Arp2 PE=2 SV=3 22 485 6.0E-16
sp|Q90WD0|ARP3_CHICK Actin-related protein 3 OS=Gallus gallus GN=ACTR3 PE=2 SV=1 23 480 8.0E-16
sp|Q9P1U1|ARP3B_HUMAN Actin-related protein 3B OS=Homo sapiens GN=ACTR3B PE=2 SV=1 25 480 1.0E-15
sp|Q4V7C7|ARP3_RAT Actin-related protein 3 OS=Rattus norvegicus GN=Actr3 PE=1 SV=1 23 480 2.0E-15
sp|Q99JY9|ARP3_MOUSE Actin-related protein 3 OS=Mus musculus GN=Actr3 PE=1 SV=3 23 480 2.0E-15
sp|Q5R8R1|ARP3_PONAB Actin-related protein 3 OS=Pongo abelii GN=ACTR3 PE=2 SV=3 23 480 2.0E-15
sp|P61158|ARP3_HUMAN Actin-related protein 3 OS=Homo sapiens GN=ACTR3 PE=1 SV=3 23 480 2.0E-15
sp|P61157|ARP3_BOVIN Actin-related protein 3 OS=Bos taurus GN=ACTR3 PE=1 SV=3 23 480 2.0E-15
sp|P30170|ACT10_SOLTU Actin-85C (Fragment) OS=Solanum tuberosum GN=AC85C PE=3 SV=1 35 253 3.0E-15
sp|Q6K908|ARP3_ORYSJ Actin-related protein 3 OS=Oryza sativa subsp. japonica GN=ARP3 PE=2 SV=1 23 480 5.0E-15
sp|A2X6S3|ARP3_ORYSI Actin-related protein 3 OS=Oryza sativa subsp. indica GN=ARP3 PE=3 SV=2 23 480 5.0E-15
sp|O73723|ARP3_TAKRU Actin-related protein 3 OS=Takifugu rubripes GN=actr3 PE=3 SV=1 23 480 7.0E-15
sp|A3ANB5|ARP7_ORYSJ Actin-related protein 7 OS=Oryza sativa subsp. japonica GN=ARP7 PE=2 SV=2 161 484 1.0E-14
sp|A2XMK6|ARP7_ORYSI Actin-related protein 7 OS=Oryza sativa subsp. indica GN=ARP7 PE=2 SV=2 161 484 1.0E-14
sp|Q11212|ACT_SPOLI Actin (Fragment) OS=Spodoptera littoralis PE=2 SV=1 26 232 2.0E-14
sp|Q4W9M3|ARP6_ASPFU Actin-like protein arp6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=arp6 PE=3 SV=1 155 476 3.0E-12
sp|Q8L4Y5|ARP7_ARATH Actin-related protein 7 OS=Arabidopsis thaliana GN=ARP7 PE=1 SV=1 161 484 3.0E-12
sp|P10982|ACT1_ABSGL Actin-1 (Fragment) OS=Absidia glauca GN=ACT1 PE=3 SV=1 19 196 6.0E-12
sp|Q5NBI2|ARP6_ORYSJ Actin-related protein 6 OS=Oryza sativa subsp. japonica GN=ARP6 PE=2 SV=1 159 483 2.0E-10
sp|A2WNB0|ARP6_ORYSI Actin-related protein 6 OS=Oryza sativa subsp. indica GN=ARP6 PE=3 SV=1 159 483 2.0E-10
sp|Q5JWF8|ACL10_HUMAN Actin-like protein 10 OS=Homo sapiens GN=ACTL10 PE=2 SV=1 195 480 4.0E-10
sp|Q39596|ACT_OXYRB Actin (Fragment) OS=Oxybasis rubra PE=3 SV=1 160 229 8.0E-10
sp|Q12406|ARP7_YEAST Actin-related protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP7 PE=1 SV=1 23 251 3.0E-09
sp|Q9GZN1|ARP6_HUMAN Actin-related protein 6 OS=Homo sapiens GN=ACTR6 PE=1 SV=1 153 483 6.0E-09
sp|Q9C9B2|ARP4A_ARATH Actin-related protein 4A OS=Arabidopsis thaliana GN=ARP4A PE=2 SV=1 15 100 8.0E-09
sp|Q54HE7|ACT28_DICDI Putative actin-28 OS=Dictyostelium discoideum GN=act28 PE=3 SV=1 337 476 8.0E-09
sp|A2XQX0|ARP9_ORYSI Actin-related protein 9 OS=Oryza sativa subsp. indica GN=ARP9 PE=3 SV=2 178 483 1.0E-08
sp|Q9D864|ARP6_MOUSE Actin-related protein 6 OS=Mus musculus GN=Actr6 PE=1 SV=2 153 483 2.0E-08
sp|Q0JF03|ARP9_ORYSJ Actin-related protein 9 OS=Oryza sativa subsp. japonica GN=ARP9 PE=2 SV=1 178 483 3.0E-08
sp|P00544|FGR_FSVGR Tyrosine-protein kinase transforming protein Fgr OS=Feline sarcoma virus (strain Gardner-Rasheed) GN=V-FGR PE=3 SV=1 19 196 4.0E-08
sp|Q54HE7|ACT28_DICDI Putative actin-28 OS=Dictyostelium discoideum GN=act28 PE=3 SV=1 160 253 6.0E-08
sp|Q9DEE9|ARP6_CHICK Actin-related protein 6 OS=Gallus gallus GN=ACTR6 PE=1 SV=1 153 483 6.0E-08
sp|Q9UTQ7|ARP9_SCHPO SWI/SNF and RSC complexes subunit arp9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp9 PE=1 SV=1 177 261 7.0E-08
sp|Q24733|ACT_DICVI Actin (Fragment) OS=Dictyocaulus viviparus PE=2 SV=1 454 484 7.0E-08
sp|Q9H568|ACTL8_HUMAN Actin-like protein 8 OS=Homo sapiens GN=ACTL8 PE=1 SV=1 381 475 1.0E-07
sp|O94241|ARP6_SCHPO Actin-like protein arp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp6 PE=3 SV=1 146 483 3.0E-07
sp|Q12406|ARP7_YEAST Actin-related protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP7 PE=1 SV=1 401 473 7.0E-07
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6002 0.8492 0.0132 0.142 0.1206 0.0008 0.1459 0.018 0.1192 0.0153

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2026
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|773
Ophiocordyceps australis map64 (Brazil) OphauB2|4394
Ophiocordyceps camponoti-floridani Ophcf2|02268
Ophiocordyceps camponoti-rufipedis Ophun1|3096
Ophiocordyceps kimflemingae Ophio5|5111
Ophiocordyceps subramaniannii Hirsu2|229 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|229
MAQQPLPPTAQPTDIYGGDEVSALVLDPGYCNTRAGFAGEDVPKSILPSFYGHVTSDPPRNVFGDECLIPRADFE
VRNYMNRDSVVEDWDVAAKIWEHMLIKRLQPERPTSPSKNGLNDDLKEQEQQQEQAPPPPPPPPPQDGEGDIAME
DAEAMEKPLQENPLLMTEAPWNTSKSREKAIEIIMENWGCPAFWLSRTPVLSAFAAGKATALVIDVGGANTSVTA
IHDGMVLKRSIQRSPVGGLWLSSQIRSLWETSEPKVNLVPTFMVENKTPVDAGMPAQARLRNWPFPISDSFRAYE
DERVLTEFKESVVEVWRGPGRYSVPGNEDYIKSQPGRVFEMPDGYNQMWREQRFKVTEGMWDETAGFPTAAEPER
LTKAQTIPELIRTALGAVDVDLRGNLLANVVVTGSTSLINGFNDRLNNELTAMYPGLKVKIHAAGLTSERRFGAW
IGGSILASLGTFHQMWISRKEYEENGPNVVEKRCK*
Coding >Hirsu2|229
ATGGCTCAGCAGCCTCTGCCACCGACGGCGCAGCCGACCGACATCTACGGCGGAGACGAGGTCTCTGCCCTTGTC
CTAGATCCGGGCTACTGCAACACGCGCGCGGGCTTCGCCGGCGAAGACGTCCCCAAGTCGATCCTCCCCTCCTTC
TACGGCCACGTCACCAGCGATCCGCCGCGCAATGTCTTTGGCGACGAGTGCCTCATTCCGCGGGCCGACTTCGAG
GTCCGCAACTACATGAACCGCGACAGCGTCGTCGAGGACTGGGATGTGGCCGCCAAGATCTGGGAGCACATGCTC
ATCAAGCGCCTGCAGCCCGAGCGGCCGACGTCGCCGTCCAAGAACGGCCTCAACGACGACCTGAAGGAGCAGGAA
CAACAACAGGAGCAAGCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCAGGACGGCGAGGGAGACATCGCCATGGAG
GATGCCGAGGCGATGGAAAAGCCGCTGCAGGAGAACCCGCTGCTGATGACGGAGGCGCCGTGGAACACGTCCAAG
TCGCGGGAGAAGGCCATCGAGATCATCATGGAGAACTGGGGGTGCCCCGCGTTCTGGCTGAGCCGCACGCCCGTG
CTGTCGGCCTTCGCGGCCGGCAAGGCCACGGCCCTGGTCATCGACGTCGGCGGCGCCAACACGTCCGTCACGGCC
ATCCACGACGGCATGGTGCTTAAGAGGTCGATCCAGCGGTCGCCCGTCGGCGGCCTGTGGCTGTCGTCCCAGATC
CGCAGCCTGTGGGAGACGTCGGAGCCCAAGGTGAACTTGGTGCCGACCTTCATGGTGGAGAACAAGACGCCGGTC
GACGCCGGCATGCCGGCCCAGGCGCGTCTGCGCAACTGGCCCTTCCCGATCAGCGACTCGTTCCGGGCGTACGAG
GACGAGCGCGTCCTGACCGAGTTCAAGGAGTCGGTCGTCGAGGTCTGGCGCGGCCCGGGCCGGTACAGCGTGCCG
GGCAACGAGGACTACATCAAGTCGCAGCCCGGGCGCGTCTTCGAGATGCCCGACGGCTACAACCAGATGTGGCGC
GAGCAGCGGTTCAAGGTGACGGAGGGCATGTGGGACGAGACGGCCGGCTTCCCCACGGCGGCCGAGCCGGAGCGC
CTGACCAAGGCCCAGACGATCCCGGAGCTGATCCGCACTGCCCTGGGTGCCGTCGATGTCGACCTGCGCGGTAAT
CTGCTGGCCAACGTCGTCGTCACCGGCAGCACCAGCCTCATCAACGGCTTCAACGACCGGCTCAACAACGAGCTG
ACGGCCATGTACCCGGGCCTCAAGGTCAAGATCCACGCCGCCGGCCTGACGAGCGAGCGCCGCTTCGGCGCCTGG
ATCGGCGGCAGCATCCTCGCCAGCCTCGGCACCTTCCACCAGATGTGGATCTCGCGTAAGGAGTACGAGGAGAAC
GGGCCCAACGTGGTCGAGAAGCGGTGCAAGTGA
Transcript >Hirsu2|229
ATGGCTCAGCAGCCTCTGCCACCGACGGCGCAGCCGACCGACATCTACGGCGGAGACGAGGTCTCTGCCCTTGTC
CTAGATCCGGGCTACTGCAACACGCGCGCGGGCTTCGCCGGCGAAGACGTCCCCAAGTCGATCCTCCCCTCCTTC
TACGGCCACGTCACCAGCGATCCGCCGCGCAATGTCTTTGGCGACGAGTGCCTCATTCCGCGGGCCGACTTCGAG
GTCCGCAACTACATGAACCGCGACAGCGTCGTCGAGGACTGGGATGTGGCCGCCAAGATCTGGGAGCACATGCTC
ATCAAGCGCCTGCAGCCCGAGCGGCCGACGTCGCCGTCCAAGAACGGCCTCAACGACGACCTGAAGGAGCAGGAA
CAACAACAGGAGCAAGCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCAGGACGGCGAGGGAGACATCGCCATGGAG
GATGCCGAGGCGATGGAAAAGCCGCTGCAGGAGAACCCGCTGCTGATGACGGAGGCGCCGTGGAACACGTCCAAG
TCGCGGGAGAAGGCCATCGAGATCATCATGGAGAACTGGGGGTGCCCCGCGTTCTGGCTGAGCCGCACGCCCGTG
CTGTCGGCCTTCGCGGCCGGCAAGGCCACGGCCCTGGTCATCGACGTCGGCGGCGCCAACACGTCCGTCACGGCC
ATCCACGACGGCATGGTGCTTAAGAGGTCGATCCAGCGGTCGCCCGTCGGCGGCCTGTGGCTGTCGTCCCAGATC
CGCAGCCTGTGGGAGACGTCGGAGCCCAAGGTGAACTTGGTGCCGACCTTCATGGTGGAGAACAAGACGCCGGTC
GACGCCGGCATGCCGGCCCAGGCGCGTCTGCGCAACTGGCCCTTCCCGATCAGCGACTCGTTCCGGGCGTACGAG
GACGAGCGCGTCCTGACCGAGTTCAAGGAGTCGGTCGTCGAGGTCTGGCGCGGCCCGGGCCGGTACAGCGTGCCG
GGCAACGAGGACTACATCAAGTCGCAGCCCGGGCGCGTCTTCGAGATGCCCGACGGCTACAACCAGATGTGGCGC
GAGCAGCGGTTCAAGGTGACGGAGGGCATGTGGGACGAGACGGCCGGCTTCCCCACGGCGGCCGAGCCGGAGCGC
CTGACCAAGGCCCAGACGATCCCGGAGCTGATCCGCACTGCCCTGGGTGCCGTCGATGTCGACCTGCGCGGTAAT
CTGCTGGCCAACGTCGTCGTCACCGGCAGCACCAGCCTCATCAACGGCTTCAACGACCGGCTCAACAACGAGCTG
ACGGCCATGTACCCGGGCCTCAAGGTCAAGATCCACGCCGCCGGCCTGACGAGCGAGCGCCGCTTCGGCGCCTGG
ATCGGCGGCAGCATCCTCGCCAGCCTCGGCACCTTCCACCAGATGTGGATCTCGCGTAAGGAGTACGAGGAGAAC
GGGCCCAACGTGGTCGAGAAGCGGTGCAAGTGA
Gene >Hirsu2|229
ATGGCTCAGCAGCCTCTGCCACCGACGGCGCAGCCGACCGACATCTACGGCGGAGGTGCGCCGCACTTCCTCTCC
CCTCGCCGCACCTGTAGCTGACCTCTTTTTTTTTTCTTCTTCCCTCCCGCTCCGCAGACGAGGTCTCTGCCCTTG
TCCTAGATCCGGGCTACTGCAACACGCGCGCGGGCTTCGCCGGCGAAGACGTCCCCAAGTCGATCCTCCCCTCCT
TCTACGGCCACGTCACCAGCGATCCGCCGCGCAATGTCTTTGGCGACGAGTGCCTCATTCCGCGGGCCGACTTCG
AGGTCCGCAACTACATGAACCGCGACAGCGTCGTCGAGGACTGGGATGTGGCCGCCAAGATCTGGGAGCACATGC
TCATCAAGCGCCTGCAGCCCGAGCGGCCGACGTCGCCGTCCAAGAACGGCCTCAACGACGACCTGAAGGAGCAGG
AACAACAACAGGAGCAAGCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCAGGACGGCGAGGGAGACATCGCCATGG
AGGATGCCGAGGCGATGGAAAAGCCGCTGCAGGAGAACCCGCTGCTGATGACGGAGGCGCCGTGGAACACGTCCA
AGTCGCGGGAGAAGGCCATCGAGATCATCATGGAGAACTGGGGGTGCCCCGCGTTCTGGCTGAGCCGCACGCCCG
TGCTGTCGGCCTTCGCGGCCGGCAAGGCCACGGCCCTGGTCATCGACGTCGGCGGCGCCAACACGTCCGTCACGG
CCATCCACGACGGCATGGTGCTTAAGAGGTCGATCCAGCGGTCGCCCGTCGGCGGCCTGTGGCTGTCGTCCCAGA
TCCGCAGCCTGTGGGAGACGTCGGAGCCCAAGGTGAACTTGGTGCCGACCTTCATGGTGGAGAACAAGACGCCGG
TCGACGCCGGCATGCCGGCCCAGGCGCGTCTGCGCAACTGGCCCTTCCCGATCAGCGACTCGTTCCGGGCGTACG
AGGACGAGCGCGTCCTGACCGAGTTCAAGGAGTCGGTCGTCGAGGTCTGGCGCGGCCCGGGCCGGTACAGCGTGC
CGGGCAACGAGGACTACATCAAGTCGCAGCCCGGGCGCGTCTTCGAGATGCCCGACGGCTACAACCAGATGTGGC
GCGAGCAGCGGTTCAAGGTGACGGAGGGCATGTGGGACGAGACGGCCGGCTTCCCCACGGCGGCCGAGCCGGAGC
GCCTGACCAAGGCCCAGACGATCCCGGAGCTGATCCGCACTGCCCTGGGTGCCGTCGATGTCGACCTGCGCGGTA
ATCTGCTGGCCAACGTCGTCGTCACCGGCAGCACCAGCCTCATCAACGGCTTCAACGACCGGCTCAACAACGAGC
TGACGGCCATGTACCCGGGCCTCAAGGTCAAGATCCACGCCGCCGGCCTGACGAGCGAGCGCCGCTTCGGCGCCT
GGATCGGCGGCAGCATCCTCGCCAGCCTCGGCACCTTCCACCAGATGTGGATCTCGCGTAAGGAGTACGAGGAGA
ACGGGCCCAACGTGGTCGAGAAGCGGTGCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail