Ophiocordyceps subramaniannii

General Properties

Protein ID	Hirsu2\|2287
Gene name
Location	Contig_1539:2856..3993
Strand	-
Gene length (bp)	1137
Transcript length (bp)	1137
Coding sequence length (bp)	1137
Protein length (aa)	379

Overview

PFAM Domains

PFAM Domain ID	Short name	Long name	E-value	Start	End
PF00004	AAA	ATPase family associated with various cellular activities (AAA)	3.1E-38	107	233
PF17862	AAA_lid_3	AAA+ lid domain	4.3E-08	258	290

Swissprot hits

[Show all]

Swissprot ID	Swissprot Description	Start	End	E-value
sp\|Q7ZZ25\|ATD1A_DANRE	ATPase family AAA domain-containing protein 1-A OS=Danio rerio GN=atad1a PE=2 SV=2	42	288	2.0E-55
sp\|P28737\|MSP1_YEAST	Protein MSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSP1 PE=1 SV=2	45	288	2.0E-54
sp\|Q9D5T0\|ATAD1_MOUSE	ATPase family AAA domain-containing protein 1 OS=Mus musculus GN=Atad1 PE=1 SV=1	40	288	2.0E-54
sp\|Q8NBU5\|ATAD1_HUMAN	ATPase family AAA domain-containing protein 1 OS=Homo sapiens GN=ATAD1 PE=1 SV=1	40	288	2.0E-54
sp\|Q505J9\|ATAD1_RAT	ATPase family AAA domain-containing protein 1 OS=Rattus norvegicus GN=Atad1 PE=1 SV=1	40	288	2.0E-54

[Show all]

[Show less]

Swissprot ID	Swissprot Description	Start	End	E-value
sp\|Q7ZZ25\|ATD1A_DANRE	ATPase family AAA domain-containing protein 1-A OS=Danio rerio GN=atad1a PE=2 SV=2	42	288	2.0E-55
sp\|P28737\|MSP1_YEAST	Protein MSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSP1 PE=1 SV=2	45	288	2.0E-54
sp\|Q9D5T0\|ATAD1_MOUSE	ATPase family AAA domain-containing protein 1 OS=Mus musculus GN=Atad1 PE=1 SV=1	40	288	2.0E-54
sp\|Q8NBU5\|ATAD1_HUMAN	ATPase family AAA domain-containing protein 1 OS=Homo sapiens GN=ATAD1 PE=1 SV=1	40	288	2.0E-54
sp\|Q505J9\|ATAD1_RAT	ATPase family AAA domain-containing protein 1 OS=Rattus norvegicus GN=Atad1 PE=1 SV=1	40	288	2.0E-54
sp\|F6QV99\|ATAD1_BOVIN	ATPase family AAA domain-containing protein 1 OS=Bos taurus GN=ATAD1 PE=2 SV=2	40	288	2.0E-54
sp\|B4F6J6\|ATAD1_XENTR	ATPase family AAA domain-containing protein 1 OS=Xenopus tropicalis GN=atad1 PE=2 SV=2	11	303	1.0E-52
sp\|Q503W7\|ATD1B_DANRE	ATPase family AAA domain-containing protein 1-B OS=Danio rerio GN=atad1b PE=2 SV=2	11	288	1.0E-50
sp\|B7PXE3\|SPAST_IXOSC	Spastin OS=Ixodes scapularis GN=spas PE=3 SV=1	4	344	1.0E-45
sp\|O28972\|Y1297_ARCFU	Cell division cycle protein 48 homolog AF_1297 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1297 PE=3 SV=1	105	344	5.0E-45
sp\|Q6AZT2\|SPAST_XENLA	Spastin OS=Xenopus laevis GN=spast PE=2 SV=1	66	344	5.0E-44
sp\|Q5ZK92\|SPAST_CHICK	Spastin OS=Gallus gallus GN=SPAST PE=2 SV=1	66	344	8.0E-44
sp\|A8XV40\|SPAST_CAEBR	Probable spastin homolog spas-1 OS=Caenorhabditis briggsae GN=spas-1 PE=3 SV=2	60	345	1.0E-43
sp\|Q8MNV0\|SPAST_CAEEL	Probable spastin homolog spas-1 OS=Caenorhabditis elegans GN=spas-1 PE=1 SV=2	103	344	1.0E-43
sp\|Q05AS3\|SPAST_XENTR	Spastin OS=Xenopus tropicalis GN=spast PE=2 SV=1	66	344	4.0E-43
sp\|Q9P7J5\|YJNA_SCHPO	Uncharacterized AAA domain-containing protein C24B10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC24B10.10c PE=3 SV=1	38	281	1.0E-42
sp\|P54815\|MSP1_CAEEL	Mitochondrial sorting homolog OS=Caenorhabditis elegans GN=mspn-1 PE=3 SV=2	41	284	2.0E-42
sp\|B3M301\|SPAST_DROAN	Spastin OS=Drosophila ananassae GN=spas PE=3 SV=1	66	344	1.0E-41
sp\|B4K799\|SPAST_DROMO	Spastin OS=Drosophila mojavensis GN=spas PE=3 SV=1	79	344	1.0E-41
sp\|O05209\|VAT_THEAC	VCP-like ATPase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=vat PE=1 SV=1	79	294	1.0E-41
sp\|A2VDN5\|SPAST_BOVIN	Spastin OS=Bos taurus GN=SPAST PE=2 SV=1	66	344	1.0E-41
sp\|B2RYN7\|SPAST_RAT	Spastin OS=Rattus norvegicus GN=Spast PE=1 SV=1	66	344	3.0E-41
sp\|Q298L4\|SPAST_DROPS	Spastin OS=Drosophila pseudoobscura pseudoobscura GN=spas PE=3 SV=1	79	344	3.0E-41
sp\|B4G437\|SPAST_DROPE	Spastin OS=Drosophila persimilis GN=spas PE=3 SV=1	79	344	3.0E-41
sp\|Q9QYY8\|SPAST_MOUSE	Spastin OS=Mus musculus GN=Spast PE=1 SV=3	66	344	3.0E-41
sp\|B4M0H8\|SPAST_DROVI	Spastin OS=Drosophila virilis GN=spas PE=3 SV=1	79	344	3.0E-41
sp\|Q9UBP0\|SPAST_HUMAN	Spastin OS=Homo sapiens GN=SPAST PE=1 SV=1	66	344	3.0E-41
sp\|Q7QBW0\|SPAST_ANOGA	Spastin OS=Anopheles gambiae GN=spas PE=3 SV=6	79	344	4.0E-41
sp\|Q9P3U2\|YKX4_SCHPO	Uncharacterized AAA domain-containing protein C328.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.04 PE=3 SV=1	78	345	5.0E-41
sp\|B4NBP4\|SPAST_DROWI	Spastin OS=Drosophila willistoni GN=spas PE=3 SV=1	79	344	7.0E-41
sp\|Q58556\|Y1156_METJA	Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1156 PE=3 SV=1	105	288	8.0E-41
sp\|Q6PIW4\|FIGL1_HUMAN	Fidgetin-like protein 1 OS=Homo sapiens GN=FIGNL1 PE=1 SV=2	77	347	1.0E-40
sp\|Q719N1\|SPAST_PIG	Spastin (Fragment) OS=Sus scrofa GN=SPAST PE=2 SV=2	66	344	1.0E-40
sp\|B4JII0\|SPAST_DROGR	Spastin OS=Drosophila grimshawi GN=spas PE=3 SV=1	79	344	1.0E-40
sp\|Q60QD1\|FIGL1_CAEBR	Fidgetin-like protein 1 OS=Caenorhabditis briggsae GN=figl-1 PE=3 SV=1	66	344	1.0E-40
sp\|Q6NW58\|SPAST_DANRE	Spastin OS=Danio rerio GN=spast PE=2 SV=2	66	344	2.0E-40
sp\|Q9SEX2\|KTNA1_ARATH	Katanin p60 ATPase-containing subunit A1 OS=Arabidopsis thaliana GN=AAA1 PE=1 SV=1	57	345	3.0E-40
sp\|B7NZ88\|KATL1_RABIT	Katanin p60 ATPase-containing subunit A-like 1 OS=Oryctolagus cuniculus GN=KATNAL1 PE=3 SV=1	61	346	5.0E-40
sp\|Q9DBY8\|NVL_MOUSE	Nuclear valosin-containing protein-like OS=Mus musculus GN=Nvl PE=1 SV=1	63	327	7.0E-40
sp\|Q9VQN8\|FIGL1_DROME	Fidgetin-like protein 1 OS=Drosophila melanogaster GN=CG3326 PE=2 SV=2	85	329	7.0E-40
sp\|O61577\|KTNA1_STRPU	Katanin p60 ATPase-containing subunit A1 OS=Strongylocentrotus purpuratus GN=KATNA1 PE=1 SV=1	66	286	7.0E-40
sp\|A9RA82\|KATL1_PAPAN	Katanin p60 ATPase-containing subunit A-like 1 OS=Papio anubis GN=KATNAL1 PE=3 SV=1	61	346	9.0E-40
sp\|Q5XIK7\|KATL1_RAT	Katanin p60 ATPase-containing subunit A-like 1 OS=Rattus norvegicus GN=Katnal1 PE=1 SV=1	61	346	1.0E-39
sp\|B4USW8\|KATL1_OTOGA	Katanin p60 ATPase-containing subunit A-like 1 OS=Otolemur garnettii GN=KATNAL1 PE=3 SV=1	2	346	1.0E-39
sp\|Q9BW62\|KATL1_HUMAN	Katanin p60 ATPase-containing subunit A-like 1 OS=Homo sapiens GN=KATNAL1 PE=1 SV=1	61	346	1.0E-39
sp\|Q6GX84\|FIGL1_RAT	Fidgetin-like protein 1 OS=Rattus norvegicus GN=Fignl1 PE=2 SV=1	77	347	2.0E-39
sp\|Q8K0T4\|KATL1_MOUSE	Katanin p60 ATPase-containing subunit A-like 1 OS=Mus musculus GN=Katnal1 PE=1 SV=1	27	346	2.0E-39
sp\|A8QFF6\|SPAST_BRUMA	Probable spastin homolog Bm1_53365 OS=Brugia malayi GN=Bm1_53365 PE=3 SV=1	27	347	3.0E-39
sp\|Q8BPY9\|FIGL1_MOUSE	Fidgetin-like protein 1 OS=Mus musculus GN=Fignl1 PE=1 SV=1	77	347	3.0E-39
sp\|B3EX35\|KATL1_SORAR	Katanin p60 ATPase-containing subunit A-like 1 OS=Sorex araneus GN=KATNAL1 PE=3 SV=1	61	346	5.0E-39
sp\|Q9HPF0\|CDCH_HALSA	Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1	65	292	1.0E-38
sp\|A4IHT0\|FIGL1_XENTR	Fidgetin-like protein 1 OS=Xenopus tropicalis GN=fignl1 PE=2 SV=1	77	346	3.0E-38
sp\|Q8SSJ5\|CDC48_ENCCU	Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC48 PE=1 SV=1	105	342	5.0E-38
sp\|O15381\|NVL_HUMAN	Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1	63	328	7.0E-38
sp\|Q8I0P1\|SPAST_DROME	Spastin OS=Drosophila melanogaster GN=spas PE=1 SV=2	79	344	7.0E-38
sp\|B4PL32\|SPAST_DROYA	Spastin OS=Drosophila yakuba GN=spas PE=3 SV=1	79	344	8.0E-38
sp\|B4HGG6\|SPAST_DROSE	Spastin OS=Drosophila sechellia GN=spas PE=3 SV=1	79	344	9.0E-38
sp\|B3P8A3\|SPAST_DROER	Spastin OS=Drosophila erecta GN=spas PE=3 SV=1	79	344	9.0E-38
sp\|P23787\|TERA_XENLA	Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3	63	359	9.0E-38
sp\|Q7ZU99\|TERA_DANRE	Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1	63	359	1.0E-37
sp\|Q6DDU8\|FIGL1_XENLA	Fidgetin-like protein 1 OS=Xenopus laevis GN=fignl1 PE=2 SV=1	77	346	1.0E-37
sp\|Q07590\|SAV_SULAC	Protein SAV OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=sav PE=3 SV=2	105	343	1.0E-37
sp\|Q5U3S1\|KATL1_DANRE	Katanin p60 ATPase-containing subunit A-like 1 OS=Danio rerio GN=katnal1 PE=2 SV=1	105	345	2.0E-37
sp\|Q6GL04\|TERA_XENTR	Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1	63	359	2.0E-37
sp\|Q980M1\|PAN_SULSO	Proteasome-activating nucleotidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pan PE=3 SV=1	63	286	3.0E-37
sp\|B4QSF0\|SPAST_DROSI	Spastin OS=Drosophila simulans GN=spas PE=3 SV=1	79	344	5.0E-37
sp\|P40328\|TBP6_YEAST	Probable 26S protease subunit YTA6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA6 PE=1 SV=2	77	346	6.0E-37
sp\|P39955\|SAP1_YEAST	Protein SAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAP1 PE=1 SV=1	78	346	6.0E-37
sp\|P46468\|CDAT_PLAF7	Putative cell division cycle ATPase OS=Plasmodium falciparum (isolate 3D7) GN=PF07_0047 PE=3 SV=2	105	288	8.0E-37
sp\|C3NFW6\|PAN_SULIN	Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pan PE=3 SV=1	63	286	1.0E-36
sp\|C3N7K8\|PAN_SULIY	Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pan PE=3 SV=1	63	286	1.0E-36
sp\|C3MY47\|PAN_SULIM	Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pan PE=3 SV=1	63	286	1.0E-36
sp\|C3MRF1\|PAN_SULIL	Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pan PE=3 SV=1	63	286	1.0E-36
sp\|C4KIR6\|PAN_SULIK	Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pan PE=3 SV=1	63	286	1.0E-36
sp\|C3MZI6\|PAN_SULIA	Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.27) GN=pan PE=3 SV=1	63	286	1.0E-36
sp\|Q54KQ7\|SPAST_DICDI	Spastin OS=Dictyostelium discoideum GN=DDB_G0287165 PE=3 SV=1	88	345	2.0E-36
sp\|A7I8B8\|PAN_METB6	Proteasome-activating nucleotidase OS=Methanoregula boonei (strain 6A8) GN=pan PE=3 SV=1	60	296	2.0E-36
sp\|Q5RII9\|KTNA1_DANRE	Katanin p60 ATPase-containing subunit A1 OS=Danio rerio GN=katna1 PE=2 SV=1	63	345	4.0E-36
sp\|O26824\|PAN_METTH	Proteasome-activating nucleotidase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pan PE=3 SV=1	52	289	5.0E-36
sp\|P62334\|PRS10_MOUSE	26S protease regulatory subunit 10B OS=Mus musculus GN=Psmc6 PE=1 SV=1	60	286	6.0E-36
sp\|P62335\|PRS10_ICTTR	26S protease regulatory subunit 10B OS=Ictidomys tridecemlineatus GN=PSMC6 PE=2 SV=1	60	286	6.0E-36
sp\|P62333\|PRS10_HUMAN	26S protease regulatory subunit 10B OS=Homo sapiens GN=PSMC6 PE=1 SV=1	60	286	6.0E-36
sp\|C0ZPK5\|FTSH_RHOE4	ATP-dependent zinc metalloprotease FtsH OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=ftsH PE=3 SV=1	56	288	6.0E-36
sp\|O14325\|YB7A_SCHPO	Uncharacterized AAA domain-containing protein C16E9.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16E9.10c PE=1 SV=1	76	328	7.0E-36
sp\|Q9D3R6\|KATL2_MOUSE	Katanin p60 ATPase-containing subunit A-like 2 OS=Mus musculus GN=Katnal2 PE=2 SV=2	90	286	7.0E-36
sp\|Q9WV86\|KTNA1_MOUSE	Katanin p60 ATPase-containing subunit A1 OS=Mus musculus GN=Katna1 PE=1 SV=1	66	345	8.0E-36
sp\|O17071\|PRS10_CAEEL	Probable 26S protease regulatory subunit 10B OS=Caenorhabditis elegans GN=rpt-4 PE=1 SV=2	60	289	8.0E-36
sp\|Q9CD58\|FTSH_MYCLE	ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium leprae (strain TN) GN=ftsH PE=3 SV=1	56	288	1.0E-35
sp\|D1C1U7\|FTSH1_SPHTD	ATP-dependent zinc metalloprotease FtsH 1 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH1 PE=3 SV=1	64	285	1.0E-35
sp\|O75449\|KTNA1_HUMAN	Katanin p60 ATPase-containing subunit A1 OS=Homo sapiens GN=KATNA1 PE=1 SV=1	66	345	1.0E-35
sp\|Q01853\|TERA_MOUSE	Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4	63	359	1.0E-35
sp\|P55072\|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4	63	359	1.0E-35
sp\|P46462\|TERA_RAT	Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3	63	359	1.0E-35
sp\|Q3ZBT1\|TERA_BOVIN	Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1	63	359	1.0E-35
sp\|D5HA94\|FTSH2_SALRM	ATP-dependent zinc metalloprotease FtsH 2 OS=Salinibacter ruber (strain M8) GN=ftsH2 PE=3 SV=1	58	285	1.0E-35
sp\|B5X3X5\|KTNA1_SALSA	Katanin p60 ATPase-containing subunit A1 OS=Salmo salar GN=katna1 PE=2 SV=1	105	345	2.0E-35
sp\|P03974\|TERA_PIG	Transitional endoplasmic reticulum ATPase OS=Sus scrofa GN=VCP PE=1 SV=5	63	359	2.0E-35
sp\|Q2KIW6\|PRS10_BOVIN	26S protease regulatory subunit 10B OS=Bos taurus GN=PSMC6 PE=2 SV=1	60	286	2.0E-35
sp\|Q0IIR9\|KTNA1_XENTR	Katanin p60 ATPase-containing subunit A1 OS=Xenopus tropicalis GN=katna1 PE=2 SV=1	105	345	2.0E-35
sp\|O43078\|ALF1_SCHPO	ATPase-like fidgetin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alf1 PE=1 SV=1	66	345	2.0E-35
sp\|Q4R407\|KTNA1_MACFA	Katanin p60 ATPase-containing subunit A1 OS=Macaca fascicularis GN=KATNA1 PE=2 SV=1	66	345	2.0E-35
sp\|A6VHR1\|PAN_METM7	Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pan PE=3 SV=1	65	289	3.0E-35
sp\|A0JMA9\|KATL2_XENTR	Katanin p60 ATPase-containing subunit A-like 2 OS=Xenopus tropicalis GN=katnal2 PE=2 SV=1	90	296	4.0E-35
sp\|Q8IYT4\|KATL2_HUMAN	Katanin p60 ATPase-containing subunit A-like 2 OS=Homo sapiens GN=KATNAL2 PE=2 SV=3	90	296	4.0E-35
sp\|Q3UMC0\|SPAT5_MOUSE	Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=1 SV=2	105	343	4.0E-35
sp\|Q6E0V2\|KTNA1_RAT	Katanin p60 ATPase-containing subunit A1 OS=Rattus norvegicus GN=Katna1 PE=1 SV=1	66	345	4.0E-35
sp\|P9WQN3\|FTSH_MYCTU	ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ftsH PE=1 SV=1	56	299	5.0E-35
sp\|A5U8T5\|FTSH_MYCTA	ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ftsH PE=3 SV=1	56	299	5.0E-35
sp\|P0A4V9\|FTSH_MYCBO	ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ftsH PE=3 SV=1	56	299	5.0E-35
sp\|P73437\|FTSH4_SYNY3	ATP-dependent zinc metalloprotease FtsH 4 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH4 PE=2 SV=1	48	322	5.0E-35
sp\|Q6LWR0\|PAN_METMP	Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain S2 / LL) GN=pan PE=3 SV=1	65	289	6.0E-35
sp\|P9WQN2\|FTSH_MYCTO	ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ftsH PE=3 SV=1	56	288	6.0E-35
sp\|A9A916\|PAN_METM6	Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pan PE=3 SV=1	65	289	7.0E-35
sp\|A4G0S4\|PAN_METM5	Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pan PE=3 SV=1	65	289	7.0E-35
sp\|Q1HGK7\|KTNA1_CHICK	Katanin p60 ATPase-containing subunit A1 OS=Gallus gallus GN=KATNA1 PE=2 SV=1	66	345	1.0E-34
sp\|B8G4Q6\|FTSH_CHLAD	ATP-dependent zinc metalloprotease FtsH OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=ftsH PE=3 SV=1	60	285	1.0E-34
sp\|Q975U2\|PAN_SULTO	Proteasome-activating nucleotidase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pan PE=3 SV=2	57	286	1.0E-34
sp\|D3F124\|FTSH1_CONWI	ATP-dependent zinc metalloprotease FtsH 1 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH1 PE=3 SV=1	60	285	1.0E-34
sp\|O16299\|FIGL1_CAEEL	Fidgetin-like protein 1 OS=Caenorhabditis elegans GN=figl-1 PE=1 SV=1	66	288	1.0E-34
sp\|O28972\|Y1297_ARCFU	Cell division cycle protein 48 homolog AF_1297 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1297 PE=3 SV=1	56	286	2.0E-34
sp\|P72991\|FTSH3_SYNY3	ATP-dependent zinc metalloprotease FtsH 3 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH3 PE=1 SV=1	102	285	2.0E-34
sp\|P25694\|CDC48_YEAST	Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC48 PE=1 SV=3	60	296	2.0E-34
sp\|P75120\|FTSH_MYCPN	ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ftsH PE=3 SV=1	105	288	2.0E-34
sp\|Q9PUL2\|KTNA1_XENLA	Katanin p60 ATPase-containing subunit A1 (Fragment) OS=Xenopus laevis GN=katna1 PE=2 SV=1	105	344	2.0E-34
sp\|D1C2C6\|FTSH2_SPHTD	ATP-dependent zinc metalloprotease FtsH 2 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH2 PE=3 SV=1	102	285	2.0E-34
sp\|Q7URM7\|FTSH2_RHOBA	ATP-dependent zinc metalloprotease FtsH 2 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ftsH2 PE=3 SV=1	60	297	3.0E-34
sp\|D3FFN2\|FTSH_MYCGH	ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma gallisepticum (strain R(high / passage 156)) GN=ftsH PE=3 SV=1	105	286	3.0E-34
sp\|B9KXV3\|FTSH1_THERP	ATP-dependent zinc metalloprotease FtsH 1 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ftsH1 PE=3 SV=1	64	285	4.0E-34
sp\|Q67T82\|FTSH2_SYMTH	ATP-dependent zinc metalloprotease FtsH 2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH2 PE=3 SV=1	64	286	4.0E-34
sp\|B2JVU2\|FTSH_BURP8	ATP-dependent zinc metalloprotease FtsH OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ftsH PE=3 SV=1	57	324	5.0E-34
sp\|Q9ZM66\|FTSH_HELPJ	ATP-dependent zinc metalloprotease FtsH OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ftsH PE=3 SV=1	102	285	7.0E-34
sp\|D4GUJ7\|PAN1_HALVD	Proteasome-activating nucleotidase 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pan1 PE=1 SV=2	64	286	8.0E-34
sp\|Q9P3A7\|CDC48_SCHPO	Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc48 PE=1 SV=2	66	289	9.0E-34
sp\|P47695\|FTSH_MYCGE	ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ftsH PE=3 SV=1	29	288	1.0E-33
sp\|Q5AWS6\|CDC48_EMENI	Cell division control protein 48 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdc48 PE=1 SV=2	66	289	1.0E-33
sp\|Q0W257\|PAN_METAR	Proteasome-activating nucleotidase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pan PE=3 SV=1	60	298	1.0E-33
sp\|Q39102\|FTSH1_ARATH	ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Arabidopsis thaliana GN=FTSH1 PE=1 SV=2	64	289	1.0E-33
sp\|A6UQT3\|PAN_METVS	Proteasome-activating nucleotidase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pan PE=3 SV=1	66	288	2.0E-33
sp\|Q9SS94\|CD48C_ARATH	Cell division control protein 48 homolog C OS=Arabidopsis thaliana GN=CDC48C PE=2 SV=2	89	328	2.0E-33
sp\|Q1AV13\|FTSH_RUBXD	ATP-dependent zinc metalloprotease FtsH OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=ftsH PE=3 SV=1	32	285	2.0E-33
sp\|Q6M2F0\|FTSH_CORGL	ATP-dependent zinc metalloprotease FtsH OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ftsH PE=3 SV=1	56	283	2.0E-33
sp\|O82150\|FTSH_TOBAC	ATP-dependent zinc metalloprotease FTSH, chloroplastic OS=Nicotiana tabacum GN=FTSH PE=2 SV=2	64	289	2.0E-33
sp\|Q67JH0\|FTSH3_SYMTH	ATP-dependent zinc metalloprotease FtsH 3 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH3 PE=3 SV=1	102	285	2.0E-33
sp\|B8D065\|FTSH_HALOH	ATP-dependent zinc metalloprotease FtsH OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=ftsH PE=3 SV=1	36	286	2.0E-33
sp\|B1AI94\|FTSH_UREP2	ATP-dependent zinc metalloprotease FtsH OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=ftsH PE=3 SV=1	97	289	3.0E-33
sp\|O78516\|FTSH_GUITH	ATP-dependent zinc metalloprotease FtsH OS=Guillardia theta GN=ftsH PE=3 SV=1	64	283	3.0E-33
sp\|Q55700\|FTSH2_SYNY3	ATP-dependent zinc metalloprotease FtsH 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH2 PE=1 SV=1	42	283	4.0E-33
sp\|A0PXM8\|FTSH_CLONN	ATP-dependent zinc metalloprotease FtsH OS=Clostridium novyi (strain NT) GN=ftsH PE=3 SV=1	60	322	4.0E-33
sp\|Q9MAK9\|PS10B_ARATH	26S protease regulatory subunit S10B homolog B OS=Arabidopsis thaliana GN=RPT4B PE=1 SV=1	52	289	4.0E-33
sp\|Q5AWS6\|CDC48_EMENI	Cell division control protein 48 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdc48 PE=1 SV=2	105	292	5.0E-33
sp\|B8GGN4\|PAN_METPE	Proteasome-activating nucleotidase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pan PE=3 SV=1	66	286	5.0E-33
sp\|O28303\|PAN_ARCFU	Proteasome-activating nucleotidase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pan PE=1 SV=1	63	291	5.0E-33
sp\|P71408\|FTSH_HELPY	ATP-dependent zinc metalloprotease FtsH OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ftsH PE=1 SV=2	102	285	5.0E-33
sp\|O74445\|PRS10_SCHPO	Probable 26S protease subunit rpt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt4 PE=3 SV=2	65	289	5.0E-33
sp\|Q10ZF7\|FTSH_TRIEI	ATP-dependent zinc metalloprotease FtsH OS=Trichodesmium erythraeum (strain IMS101) GN=ftsH PE=3 SV=1	66	283	5.0E-33
sp\|P32794\|AFG2_YEAST	ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1	66	332	6.0E-33
sp\|O32617\|FTSH_HELFC	ATP-dependent zinc metalloprotease FtsH OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=ftsH PE=3 SV=1	102	285	6.0E-33
sp\|Q4L3G8\|FTSH_STAHJ	ATP-dependent zinc metalloprotease FtsH OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ftsH PE=3 SV=1	102	288	6.0E-33
sp\|Q8SQK0\|PRS8_ENCCU	26S protease regulatory subunit 8 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT6 PE=1 SV=2	64	311	9.0E-33
sp\|Q2FQ56\|PAN_METHJ	Proteasome-activating nucleotidase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pan PE=3 SV=1	60	290	1.0E-32
sp\|Q2JNP0\|FTSH_SYNJB	ATP-dependent zinc metalloprotease FtsH OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ftsH PE=3 SV=1	102	285	1.0E-32
sp\|B0K657\|FTSH2_THEPX	ATP-dependent zinc metalloprotease FtsH 2 OS=Thermoanaerobacter sp. (strain X514) GN=ftsH2 PE=3 SV=1	63	312	1.0E-32
sp\|P51327\|FTSH_PORPU	ATP-dependent zinc metalloprotease FtsH OS=Porphyra purpurea GN=ftsH PE=3 SV=1	87	292	1.0E-32
sp\|Q9SEI3\|PS10A_ARATH	26S protease regulatory subunit 10B homolog A OS=Arabidopsis thaliana GN=RPT4A PE=1 SV=1	52	289	1.0E-32
sp\|Q8NB90\|SPAT5_HUMAN	Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3	105	330	1.0E-32
sp\|Q6KHA4\|FTSH_MYCMO	ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ftsH PE=3 SV=1	102	289	1.0E-32
sp\|Q8EUA6\|FTSH_MYCPE	ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma penetrans (strain HF-2) GN=ftsH PE=3 SV=1	87	286	2.0E-32
sp\|B2XTF7\|FTSH_HETA2	ATP-dependent zinc metalloprotease FtsH OS=Heterosigma akashiwo (strain NIES-293) GN=ftsH PE=3 SV=1	103	291	2.0E-32
sp\|B4SCV5\|FTSH_PELPB	ATP-dependent zinc metalloprotease FtsH OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ftsH PE=3 SV=1	62	291	2.0E-32
sp\|A3CV35\|PAN_METMJ	Proteasome-activating nucleotidase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pan PE=3 SV=1	60	293	2.0E-32
sp\|Q9BAE0\|FTSH_MEDSA	ATP-dependent zinc metalloprotease FTSH, chloroplastic OS=Medicago sativa GN=FTSH PE=2 SV=1	64	285	2.0E-32
sp\|Q39444\|FTSH_CAPAN	ATP-dependent zinc metalloprotease FTSH, chloroplastic (Fragment) OS=Capsicum annuum GN=FTSH PE=2 SV=1	64	285	2.0E-32
sp\|D4HA34\|FTSH_PROAS	ATP-dependent zinc metalloprotease FtsH OS=Propionibacterium acnes (strain SK137) GN=ftsH PE=3 SV=1	59	283	2.0E-32
sp\|A8ZNZ4\|FTSH_ACAM1	ATP-dependent zinc metalloprotease FtsH OS=Acaryochloris marina (strain MBIC 11017) GN=ftsH PE=3 SV=1	102	294	2.0E-32
sp\|Q9C5U3\|PRS8A_ARATH	26S protease regulatory subunit 8 homolog A OS=Arabidopsis thaliana GN=RPT6A PE=1 SV=1	64	313	3.0E-32
sp\|Q7KN62\|TERA_DROME	Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1	63	343	3.0E-32
sp\|Q2SF13\|FTSH_HAHCH	ATP-dependent zinc metalloprotease FtsH OS=Hahella chejuensis (strain KCTC 2396) GN=ftsH PE=3 SV=1	47	288	4.0E-32
sp\|D0MGU8\|FTSH_RHOM4	ATP-dependent zinc metalloprotease FtsH OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) GN=ftsH PE=3 SV=1	102	285	4.0E-32
sp\|P54812\|TERA2_CAEEL	Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans GN=cdc-48.2 PE=1 SV=2	63	370	4.0E-32
sp\|Q58556\|Y1156_METJA	Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1156 PE=3 SV=1	64	286	5.0E-32
sp\|Q94BQ2\|PRS8B_ARATH	26S protease regulatory subunit 8 homolog B OS=Arabidopsis thaliana GN=RPT6B PE=1 SV=1	64	313	5.0E-32
sp\|Q9FH02\|FTSH5_ARATH	ATP-dependent zinc metalloprotease FTSH 5, chloroplastic OS=Arabidopsis thaliana GN=FTSH5 PE=1 SV=1	64	289	5.0E-32
sp\|Q5UT56\|PAN2_HALVD	Proteasome-activating nucleotidase 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pan2 PE=2 SV=1	64	286	5.0E-32
sp\|P34123\|PRS6B_DICDI	26S protease regulatory subunit 6B homolog OS=Dictyostelium discoideum GN=psmC4 PE=1 SV=1	95	286	6.0E-32
sp\|Q8SR13\|PRS6A_ENCCU	26S protease regulatory subunit 6A OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT5 PE=1 SV=1	65	296	6.0E-32
sp\|C7M0M0\|FTSH_ACIFD	ATP-dependent zinc metalloprotease FtsH OS=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) GN=ftsH PE=3 SV=1	102	286	6.0E-32
sp\|O14126\|PRS6A_SCHPO	26S protease regulatory subunit 6A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tbp1 PE=3 SV=1	46	288	7.0E-32
sp\|Q54GX5\|PEX1_DICDI	Peroxisome biogenesis factor 1 OS=Dictyostelium discoideum GN=pex1 PE=3 SV=1	105	288	8.0E-32
sp\|A0LR74\|FTSH_ACIC1	ATP-dependent zinc metalloprotease FtsH OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=ftsH PE=3 SV=1	105	278	9.0E-32
sp\|P54774\|CDC48_SOYBN	Cell division cycle protein 48 homolog OS=Glycine max GN=CDC48 PE=2 SV=1	105	361	9.0E-32
sp\|Q9P3A7\|CDC48_SCHPO	Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc48 PE=1 SV=2	105	301	1.0E-31
sp\|O80860\|FTSH2_ARATH	ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Arabidopsis thaliana GN=FTSH2 PE=1 SV=1	102	285	1.0E-31
sp\|A6LD25\|FTSH_PARD8	ATP-dependent zinc metalloprotease FtsH OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=ftsH PE=3 SV=1	57	285	1.0E-31
sp\|B8J992\|FTSH_ANAD2	ATP-dependent zinc metalloprotease FtsH OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=ftsH PE=3 SV=1	64	285	1.0E-31
sp\|Q9LET7\|CI111_ARATH	Calmodulin-interacting protein 111 OS=Arabidopsis thaliana GN=CIP111 PE=1 SV=1	105	288	1.0E-31
sp\|B7T1V0\|FTSH_VAULI	ATP-dependent zinc metalloprotease FtsH OS=Vaucheria litorea GN=ftsH PE=3 SV=1	102	283	1.0E-31
sp\|Q1XDF9\|FTSH_PYRYE	ATP-dependent zinc metalloprotease FtsH OS=Pyropia yezoensis GN=ftsH PE=3 SV=1	64	283	1.0E-31
sp\|Q58576\|PAN_METJA	Proteasome-activating nucleotidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pan PE=1 SV=1	63	288	1.0E-31
sp\|Q01939\|PRS8_YEAST	26S protease regulatory subunit 8 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT6 PE=1 SV=4	64	314	1.0E-31
sp\|P54811\|TERA1_CAEEL	Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans GN=cdc-48.1 PE=1 SV=1	63	377	1.0E-31
sp\|Q8TI88\|PAN_METAC	Proteasome-activating nucleotidase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pan PE=3 SV=2	60	291	1.0E-31
sp\|C7MC16\|FTSH_BRAFD	ATP-dependent zinc metalloprotease FtsH OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860) GN=ftsH PE=3 SV=1	57	290	2.0E-31
sp\|P73179\|FTSH1_SYNY3	ATP-dependent zinc metalloprotease FtsH 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH1 PE=2 SV=1	66	283	2.0E-31
sp\|Q8YMZ8\|FTSH_NOSS1	ATP-dependent zinc metalloprotease FtsH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ftsH PE=3 SV=1	66	283	2.0E-31
sp\|Q3JMH0\|FTSH_BURP1	ATP-dependent zinc metalloprotease FtsH OS=Burkholderia pseudomallei (strain 1710b) GN=ftsH PE=3 SV=2	102	292	2.0E-31
sp\|Q8SQI9\|PRS6B_ENCCU	26S protease regulatory subunit 6B homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_1970 PE=1 SV=1	64	304	2.0E-31
sp\|D1C4U5\|FTSH3_SPHTD	ATP-dependent zinc metalloprotease FtsH 3 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH3 PE=3 SV=1	63	286	2.0E-31
sp\|O05209\|VAT_THEAC	VCP-like ATPase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=vat PE=1 SV=1	65	330	3.0E-31
sp\|Q5Z974\|FTSH1_ORYSJ	ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH1 PE=2 SV=1	64	285	3.0E-31
sp\|Q54PJ1\|PRS10_DICDI	26S protease regulatory subunit 10B OS=Dictyostelium discoideum GN=psmC6 PE=1 SV=1	64	289	3.0E-31
sp\|Q8TX03\|PAN_METKA	Proteasome-activating nucleotidase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pan PE=3 SV=1	11	289	3.0E-31
sp\|Q8PY58\|PAN_METMA	Proteasome-activating nucleotidase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pan PE=3 SV=1	60	286	3.0E-31
sp\|D5D8E3\|FTSH_SULMD	ATP-dependent zinc metalloprotease FtsH OS=Sulcia muelleri (strain DMIN) GN=ftsH PE=3 SV=1	102	285	4.0E-31
sp\|Q6F0E5\|FTSH_MESFL	ATP-dependent zinc metalloprotease FtsH OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ftsH PE=3 SV=1	105	289	4.0E-31
sp\|Q09803\|VPS4_SCHPO	Suppressor protein of bem1/bed5 double mutants OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps4 PE=3 SV=1	79	286	4.0E-31
sp\|P46508\|YME1_SCHMA	ATP-dependent zinc metalloprotease YME1 homolog OS=Schistosoma mansoni PE=2 SV=1	102	296	5.0E-31
sp\|Q6MJV1\|FTSH2_BDEBA	ATP-dependent zinc metalloprotease FtsH 2 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ftsH2 PE=3 SV=1	62	285	5.0E-31
sp\|P23787\|TERA_XENLA	Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3	66	286	6.0E-31
sp\|P46507\|PRS6B_MANSE	26S protease regulatory subunit 6B OS=Manduca sexta PE=2 SV=1	105	288	6.0E-31
sp\|Q6GL04\|TERA_XENTR	Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1	66	286	7.0E-31
sp\|O14325\|YB7A_SCHPO	Uncharacterized AAA domain-containing protein C16E9.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16E9.10c PE=1 SV=1	31	287	7.0E-31
sp\|Q9UN37\|VPS4A_HUMAN	Vacuolar protein sorting-associated protein 4A OS=Homo sapiens GN=VPS4A PE=1 SV=1	105	292	7.0E-31
sp\|Q655S1\|FTSH2_ORYSJ	ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH2 PE=3 SV=1	102	285	7.0E-31
sp\|Q793F9\|VPS4A_RAT	Vacuolar protein sorting-associated protein 4A OS=Rattus norvegicus GN=Vps4a PE=1 SV=1	105	292	7.0E-31
sp\|Q8VEJ9\|VPS4A_MOUSE	Vacuolar protein sorting-associated protein 4A OS=Mus musculus GN=Vps4a PE=1 SV=1	105	292	7.0E-31
sp\|B8I4B9\|FTSH_CLOCE	ATP-dependent zinc metalloprotease FtsH OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=ftsH PE=3 SV=1	102	312	7.0E-31
sp\|O18413\|PRS8_DROME	26S protease regulatory subunit 8 OS=Drosophila melanogaster GN=Rpt6 PE=1 SV=2	64	313	7.0E-31
sp\|P49825\|FTSH_ODOSI	ATP-dependent zinc metalloprotease FtsH OS=Odontella sinensis GN=ftsH PE=3 SV=1	48	298	7.0E-31
sp\|Q1PDW5\|FTSH6_ARATH	ATP-dependent zinc metalloprotease FTSH 6, chloroplastic OS=Arabidopsis thaliana GN=FTSH6 PE=2 SV=1	65	285	8.0E-31
sp\|C5CES8\|FTSH_KOSOT	ATP-dependent zinc metalloprotease FtsH OS=Kosmotoga olearia (strain TBF 19.5.1) GN=ftsH PE=3 SV=1	63	285	8.0E-31
sp\|Q0TTK8\|FTSH_CLOP1	ATP-dependent zinc metalloprotease FtsH OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ftsH PE=3 SV=1	102	287	8.0E-31
sp\|P85200\|PRS6B_HELAN	26S protease regulatory subunit 6B homolog OS=Helianthus annuus PE=1 SV=1	95	286	9.0E-31
sp\|P46468\|CDAT_PLAF7	Putative cell division cycle ATPase OS=Plasmodium falciparum (isolate 3D7) GN=PF07_0047 PE=3 SV=2	47	288	1.0E-30
sp\|P25694\|CDC48_YEAST	Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC48 PE=1 SV=3	66	289	1.0E-30
sp\|C8W731\|FTSH_ATOPD	ATP-dependent zinc metalloprotease FtsH OS=Atopobium parvulum (strain ATCC 33793 / DSM 20469 / JCM 10300 / VPI 0546) GN=ftsH PE=3 SV=1	51	286	1.0E-30
sp\|P54814\|PRS8_MANSE	26S protease regulatory subunit 8 OS=Manduca sexta PE=2 SV=1	64	313	1.0E-30
sp\|Q07844\|RIX7_YEAST	Ribosome biogenesis ATPase RIX7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIX7 PE=1 SV=1	64	348	1.0E-30
sp\|Q9SEI4\|PRS6B_ARATH	26S protease regulatory subunit 6B homolog OS=Arabidopsis thaliana GN=RPT3 PE=1 SV=1	95	286	1.0E-30
sp\|P54778\|PRS6B_SOLTU	26S protease regulatory subunit 6B homolog OS=Solanum tuberosum PE=2 SV=1	95	286	1.0E-30
sp\|Q4R7L3\|PRS6B_MACFA	26S protease regulatory subunit 6B OS=Macaca fascicularis GN=PSMC4 PE=2 SV=1	95	288	1.0E-30
sp\|P43686\|PRS6B_HUMAN	26S protease regulatory subunit 6B OS=Homo sapiens GN=PSMC4 PE=1 SV=2	95	288	1.0E-30
sp\|Q3T030\|PRS6B_BOVIN	26S protease regulatory subunit 6B OS=Bos taurus GN=PSMC4 PE=2 SV=1	95	288	1.0E-30
sp\|A1TZE0\|FTSH_MARHV	ATP-dependent zinc metalloprotease FtsH OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ftsH PE=3 SV=1	105	323	1.0E-30
sp\|P37476\|FTSH_BACSU	ATP-dependent zinc metalloprotease FtsH OS=Bacillus subtilis (strain 168) GN=ftsH PE=1 SV=1	102	288	1.0E-30
sp\|Q8W585\|FTSH8_ARATH	ATP-dependent zinc metalloprotease FTSH 8, chloroplastic OS=Arabidopsis thaliana GN=FTSH8 PE=1 SV=1	102	285	1.0E-30
sp\|Q63570\|PRS6B_RAT	26S protease regulatory subunit 6B OS=Rattus norvegicus GN=Psmc4 PE=1 SV=1	95	288	1.0E-30
sp\|P54775\|PRS6B_MOUSE	26S protease regulatory subunit 6B OS=Mus musculus GN=Psmc4 PE=1 SV=2	95	288	1.0E-30
sp\|Q9WZ49\|FTSH_THEMA	ATP-dependent zinc metalloprotease FtsH OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ftsH PE=1 SV=1	64	288	1.0E-30
sp\|Q9HPF0\|CDCH_HALSA	Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1	65	350	2.0E-30
sp\|Q7ZU99\|TERA_DANRE	Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1	66	286	2.0E-30
sp\|Q01853\|TERA_MOUSE	Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4	66	286	2.0E-30
sp\|P55072\|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4	66	286	2.0E-30
sp\|P46462\|TERA_RAT	Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3	66	286	2.0E-30
sp\|Q3ZBT1\|TERA_BOVIN	Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1	66	286	2.0E-30
sp\|P03974\|TERA_PIG	Transitional endoplasmic reticulum ATPase OS=Sus scrofa GN=VCP PE=1 SV=5	66	286	2.0E-30
sp\|O13764\|PEX6_SCHPO	Peroxisomal ATPase pex6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex6 PE=3 SV=1	34	337	2.0E-30
sp\|A6QBN8\|FTSH_SULNB	ATP-dependent zinc metalloprotease FtsH OS=Sulfurovum sp. (strain NBC37-1) GN=ftsH PE=3 SV=1	102	285	2.0E-30
sp\|A8F7F7\|FTSH_PSELT	ATP-dependent zinc metalloprotease FtsH OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=ftsH PE=3 SV=1	64	285	2.0E-30
sp\|B2UE66\|FTSH_RALPJ	ATP-dependent zinc metalloprotease FtsH OS=Ralstonia pickettii (strain 12J) GN=ftsH PE=3 SV=1	64	285	2.0E-30
sp\|Q0DHL4\|FTSH8_ORYSJ	ATP-dependent zinc metalloprotease FTSH 8, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH8 PE=3 SV=1	102	296	2.0E-30
sp\|P24004\|PEX1_YEAST	Peroxisomal ATPase PEX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX1 PE=1 SV=2	105	293	2.0E-30
sp\|Q54CS8\|PEX6_DICDI	Peroxisomal biogenesis factor 6 OS=Dictyostelium discoideum GN=pex6 PE=3 SV=1	63	348	2.0E-30
sp\|P53549\|PRS10_YEAST	26S protease subunit RPT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT4 PE=1 SV=4	65	309	2.0E-30
sp\|P62198\|PRS8_RAT	26S protease regulatory subunit 8 OS=Rattus norvegicus GN=Psmc5 PE=1 SV=1	64	313	2.0E-30
sp\|P62197\|PRS8_PIG	26S protease regulatory subunit 8 OS=Sus scrofa GN=PSMC5 PE=2 SV=1	64	313	2.0E-30
sp\|P62196\|PRS8_MOUSE	26S protease regulatory subunit 8 OS=Mus musculus GN=Psmc5 PE=1 SV=1	64	313	2.0E-30
sp\|P62195\|PRS8_HUMAN	26S protease regulatory subunit 8 OS=Homo sapiens GN=PSMC5 PE=1 SV=1	64	313	2.0E-30
sp\|P62194\|PRS8_BOVIN	26S protease regulatory subunit 8 OS=Bos taurus GN=PSMC5 PE=2 SV=1	64	313	2.0E-30
sp\|P33297\|PRS6A_YEAST	26S protease regulatory subunit 6A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT5 PE=1 SV=3	46	286	2.0E-30
sp\|Q96372\|CDC48_CAPAN	Cell division cycle protein 48 homolog OS=Capsicum annuum GN=CAFP PE=2 SV=1	105	343	2.0E-30
sp\|D1J722\|FTSH_ECTSI	ATP-dependent zinc metalloprotease FtsH OS=Ectocarpus siliculosus GN=ftsH PE=3 SV=1	56	283	2.0E-30
sp\|O42931\|PRS7_SCHPO	26S protease regulatory subunit 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt1 PE=1 SV=2	64	286	3.0E-30
sp\|Q9YAC7\|PAN_AERPE	Proteasome-activating nucleotidase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pan PE=3 SV=1	66	302	3.0E-30
sp\|B7J0N5\|FTSH_BORBZ	ATP-dependent zinc metalloprotease FtsH OS=Borrelia burgdorferi (strain ZS7) GN=ftsH PE=3 SV=1	65	285	3.0E-30
sp\|B0K5A3\|FTSH1_THEPX	ATP-dependent zinc metalloprotease FtsH 1 OS=Thermoanaerobacter sp. (strain X514) GN=ftsH1 PE=3 SV=1	42	285	3.0E-30
sp\|P54774\|CDC48_SOYBN	Cell division cycle protein 48 homolog OS=Glycine max GN=CDC48 PE=2 SV=1	66	289	4.0E-30
sp\|P54609\|CD48A_ARATH	Cell division control protein 48 homolog A OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1	105	343	4.0E-30
sp\|P46467\|VPS4B_MOUSE	Vacuolar protein sorting-associated protein 4B OS=Mus musculus GN=Vps4b PE=1 SV=2	105	292	4.0E-30
sp\|Q9LZF6\|CD48E_ARATH	Cell division control protein 48 homolog E OS=Arabidopsis thaliana GN=CDC48E PE=1 SV=2	105	343	4.0E-30
sp\|P46465\|PRS6A_ORYSJ	26S protease regulatory subunit 6A homolog OS=Oryza sativa subsp. japonica GN=TBP1 PE=2 SV=2	46	286	4.0E-30
sp\|P59652\|FTSH_STRR6	ATP-dependent zinc metalloprotease FtsH OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ftsH PE=3 SV=1	102	285	4.0E-30
sp\|O69076\|FTSH_STRPN	ATP-dependent zinc metalloprotease FtsH OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ftsH PE=3 SV=3	102	285	4.0E-30
sp\|O83746\|FTSH_TREPA	ATP-dependent zinc metalloprotease FtsH OS=Treponema pallidum (strain Nichols) GN=ftsH PE=3 SV=1	102	286	4.0E-30
sp\|B1ZMG6\|FTSH_OPITP	ATP-dependent zinc metalloprotease FtsH OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=ftsH PE=3 SV=1	105	291	4.0E-30
sp\|Q86JA1\|PRS7_DICDI	26S protease regulatory subunit 7 OS=Dictyostelium discoideum GN=psmC2 PE=1 SV=1	17	286	4.0E-30
sp\|Q7KN62\|TERA_DROME	Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1	66	289	5.0E-30
sp\|Q54SY2\|NVL_DICDI	Putative ribosome biogenesis ATPase nvl OS=Dictyostelium discoideum GN=nvl PE=3 SV=1	63	286	5.0E-30
sp\|D2NQQ7\|FTSH_ROTMD	ATP-dependent zinc metalloprotease FtsH OS=Rothia mucilaginosa (strain DY-18) GN=ftsH PE=3 SV=1	56	283	5.0E-30
sp\|O75351\|VPS4B_HUMAN	Vacuolar protein sorting-associated protein 4B OS=Homo sapiens GN=VPS4B PE=1 SV=2	105	292	5.0E-30
sp\|C7N914\|FTSH_LEPBD	ATP-dependent zinc metalloprotease FtsH OS=Leptotrichia buccalis (strain ATCC 14201 / DSM 1135 / JCM 12969 / NCTC 10249 / C-1013-b) GN=ftsH PE=3 SV=1	102	285	5.0E-30
sp\|P41836\|PRS8_SCHPO	26S protease regulatory subunit 8 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=let1 PE=3 SV=1	64	320	6.0E-30
sp\|Q90732\|PRS4_CHICK	26S protease regulatory subunit 4 OS=Gallus gallus GN=PSMC1 PE=2 SV=1	65	288	6.0E-30
sp\|Q8S2A7\|FTSH3_ORYSJ	ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH3 PE=3 SV=1	102	289	6.0E-30
sp\|B9L3S8\|FTSH2_THERP	ATP-dependent zinc metalloprotease FtsH 2 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ftsH2 PE=3 SV=1	58	285	6.0E-30
sp\|C7N1I1\|FTSH_SLAHD	ATP-dependent zinc metalloprotease FtsH OS=Slackia heliotrinireducens (strain ATCC 29202 / DSM 20476 / NCTC 11029 / RHS 1) GN=ftsH PE=3 SV=1	66	283	7.0E-30
sp\|Q9TJ83\|FTSH_CYAME	ATP-dependent zinc metalloprotease FtsH OS=Cyanidioschyzon merolae GN=ftsH PE=3 SV=1	103	286	7.0E-30
sp\|O60058\|AFG2_SCHPO	ATPase family gene 2 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=afg2 PE=3 SV=1	64	287	7.0E-30
sp\|Q9HNP9\|PAN2_HALSA	Proteasome-activating nucleotidase 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pan2 PE=3 SV=1	46	313	7.0E-30
sp\|Q60AK1\|FTSH_METCA	ATP-dependent zinc metalloprotease FtsH OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ftsH PE=3 SV=1	105	322	7.0E-30
sp\|Q67LC0\|FTSH1_SYMTH	ATP-dependent zinc metalloprotease FtsH 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH1 PE=3 SV=1	102	286	8.0E-30
sp\|P54776\|PRS6A_SOLLC	26S protease regulatory subunit 6A homolog OS=Solanum lycopersicum GN=TBP1 PE=2 SV=1	46	286	8.0E-30
sp\|Q5R658\|VPS4B_PONAB	Vacuolar protein sorting-associated protein 4B OS=Pongo abelii GN=VPS4B PE=2 SV=1	105	292	8.0E-30
sp\|Q0VD48\|VPS4B_BOVIN	Vacuolar protein sorting-associated protein 4B OS=Bos taurus GN=VPS4B PE=2 SV=1	105	292	9.0E-30
sp\|P94304\|FTSH_BACPE	ATP-dependent zinc metalloprotease FtsH OS=Bacillus pseudofirmus (strain OF4) GN=ftsH PE=3 SV=2	102	285	9.0E-30
sp\|Q5BL07\|PEX1_MOUSE	Peroxisome biogenesis factor 1 OS=Mus musculus GN=Pex1 PE=1 SV=2	105	287	9.0E-30
sp\|O19922\|FTSH_CYACA	ATP-dependent zinc metalloprotease FtsH OS=Cyanidium caldarium GN=ftsH PE=3 SV=1	103	286	9.0E-30
sp\|Q96372\|CDC48_CAPAN	Cell division cycle protein 48 homolog OS=Capsicum annuum GN=CAFP PE=2 SV=1	66	289	1.0E-29
sp\|O60058\|AFG2_SCHPO	ATPase family gene 2 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=afg2 PE=3 SV=1	105	330	1.0E-29
sp\|Q6LUJ8\|FTSH_PHOPR	ATP-dependent zinc metalloprotease FtsH OS=Photobacterium profundum GN=ftsH PE=3 SV=1	57	285	1.0E-29
sp\|P34808\|KTNA1_CAEEL	Meiotic spindle formation protein mei-1 OS=Caenorhabditis elegans GN=mei-1 PE=1 SV=1	107	345	1.0E-29
sp\|D2QZ34\|FTSH_PIRSD	ATP-dependent zinc metalloprotease FtsH OS=Pirellula staleyi (strain ATCC 27377 / DSM 6068 / ICPB 4128) GN=ftsH PE=3 SV=1	102	278	1.0E-29
sp\|Q9M895\|FTSI3_ARATH	Probable inactive ATP-dependent zinc metalloprotease FTSHI 3, chloroplastic OS=Arabidopsis thaliana GN=FTSHI3 PE=1 SV=1	105	296	1.0E-29
sp\|Q54PN7\|PRS6A_DICDI	26S protease regulatory subunit 6A homolog OS=Dictyostelium discoideum GN=psmC3 PE=1 SV=1	47	286	1.0E-29
sp\|P33299\|PRS7_YEAST	26S protease regulatory subunit 7 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT1 PE=1 SV=1	64	286	1.0E-29
sp\|P62193\|PRS4_RAT	26S protease regulatory subunit 4 OS=Rattus norvegicus GN=Psmc1 PE=2 SV=1	65	288	1.0E-29
sp\|P62192\|PRS4_MOUSE	26S protease regulatory subunit 4 OS=Mus musculus GN=Psmc1 PE=1 SV=1	65	288	1.0E-29
sp\|P62191\|PRS4_HUMAN	26S protease regulatory subunit 4 OS=Homo sapiens GN=PSMC1 PE=1 SV=1	65	288	1.0E-29
sp\|P34124\|PRS8_DICDI	26S protease regulatory subunit 8 OS=Dictyostelium discoideum GN=psmC5 PE=1 SV=2	64	313	1.0E-29
sp\|A2SHH9\|FTSH_METPP	ATP-dependent zinc metalloprotease FtsH OS=Methylibium petroleiphilum (strain PM1) GN=ftsH PE=3 SV=1	91	285	1.0E-29
sp\|P54609\|CD48A_ARATH	Cell division control protein 48 homolog A OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1	66	289	2.0E-29
sp\|Q9LZF6\|CD48E_ARATH	Cell division control protein 48 homolog E OS=Arabidopsis thaliana GN=CDC48E PE=1 SV=2	66	289	2.0E-29
sp\|P46470\|PRS8_XENLA	26S protease regulatory subunit 8 OS=Xenopus laevis GN=psmc5 PE=2 SV=2	64	313	2.0E-29
sp\|Q3JEE4\|FTSH_NITOC	ATP-dependent zinc metalloprotease FtsH OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ftsH PE=3 SV=1	102	283	2.0E-29
sp\|Q2NIN5\|FTSH_AYWBP	ATP-dependent zinc metalloprotease FtsH OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=ftsH PE=3 SV=1	102	275	2.0E-29
sp\|Q9SSB4\|PRS7B_ARATH	26S protease regulatory subunit 7 homolog B OS=Arabidopsis thaliana GN=RPT1B PE=1 SV=2	65	286	2.0E-29
sp\|D1C8C0\|FTSH4_SPHTD	ATP-dependent zinc metalloprotease FtsH 4 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsh4 PE=3 SV=1	58	285	2.0E-29
sp\|Q98PE4\|FTSH_MYCPU	ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ftsH PE=3 SV=1	105	289	2.0E-29
sp\|P46466\|PRS4_ORYSJ	26S protease regulatory subunit 4 homolog OS=Oryza sativa subsp. japonica GN=TBP2 PE=2 SV=2	46	288	2.0E-29
sp\|B3DV46\|FTSH1_METI4	ATP-dependent zinc metalloprotease FtsH 1 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH1 PE=3 SV=1	60	273	2.0E-29
sp\|Q920A7\|AFG31_MOUSE	AFG3-like protein 1 OS=Mus musculus GN=Afg3l1 PE=1 SV=2	54	334	3.0E-29
sp\|Q9HRW6\|PAN1_HALSA	Proteasome-activating nucleotidase 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pan1 PE=3 SV=3	105	289	3.0E-29
sp\|Q58889\|PRS2_METJA	Putative 26S protease regulatory subunit homolog MJ1494 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1494 PE=3 SV=2	105	283	3.0E-29
sp\|C8WEG0\|FTSH_ZYMMN	ATP-dependent zinc metalloprotease FtsH OS=Zymomonas mobilis subsp. mobilis (strain NCIMB 11163 / B70) GN=ftsH PE=3 SV=1	102	285	3.0E-29
sp\|Q9SCN8\|CD48D_ARATH	Cell division control protein 48 homolog D OS=Arabidopsis thaliana GN=CDC48D PE=1 SV=1	66	289	3.0E-29
sp\|P0AAI4\|FTSH_SHIFL	ATP-dependent zinc metalloprotease FtsH OS=Shigella flexneri GN=ftsH PE=3 SV=1	57	285	3.0E-29
sp\|P0AAI3\|FTSH_ECOLI	ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli (strain K12) GN=ftsH PE=1 SV=1	57	285	3.0E-29
sp\|P63343\|FTSH_SALTY	ATP-dependent zinc metalloprotease FtsH OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ftsH PE=3 SV=1	57	285	3.0E-29
sp\|P63344\|FTSH_SALTI	ATP-dependent zinc metalloprotease FtsH OS=Salmonella typhi GN=ftsH PE=3 SV=1	57	285	3.0E-29
sp\|Q84WU8\|FTSH3_ARATH	ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Arabidopsis thaliana GN=FTSH3 PE=1 SV=1	102	291	3.0E-29
sp\|P46469\|FTSH_LACLA	ATP-dependent zinc metalloprotease FtsH OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ftsH PE=3 SV=1	102	288	3.0E-29
sp\|Q8X9L0\|FTSH_ECO57	ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli O157:H7 GN=ftsH PE=3 SV=1	57	285	3.0E-29
sp\|O04019\|PS6AB_ARATH	26S protease regulatory subunit 6A homolog B OS=Arabidopsis thaliana GN=RPT5B PE=1 SV=3	46	286	3.0E-29
sp\|Q9SL67\|PRS4B_ARATH	26S proteasome regulatory subunit 4 homolog B OS=Arabidopsis thaliana GN=RPT2B PE=1 SV=1	46	288	3.0E-29
sp\|Q41365\|PRS7_SPIOL	26S protease regulatory subunit 7 OS=Spinacia oleracea GN=RPT1 PE=2 SV=1	64	286	3.0E-29
sp\|Q8K9G8\|FTSH_BUCAP	ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ftsH PE=3 SV=1	57	318	4.0E-29
sp\|Q9SSB5\|PRS7A_ARATH	26S protease regulatory subunit 7 homolog A OS=Arabidopsis thaliana GN=RPT1A PE=1 SV=1	64	286	4.0E-29
sp\|Q8VZI8\|FTSHA_ARATH	ATP-dependent zinc metalloprotease FTSH 10, mitochondrial OS=Arabidopsis thaliana GN=FTSH10 PE=1 SV=1	102	291	4.0E-29
sp\|B3PNH3\|FTSH_MYCA5	ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma arthritidis (strain 158L3-1) GN=ftsH PE=3 SV=1	99	288	4.0E-29
sp\|O64982\|PRS7_PRUPE	26S protease regulatory subunit 7 OS=Prunus persica GN=RPT1 PE=2 SV=1	64	286	4.0E-29
sp\|A7YSY2\|SPA5L_BOVIN	Spermatogenesis-associated protein 5-like protein 1 OS=Bos taurus GN=SPATA5L1 PE=2 SV=1	90	343	4.0E-29
sp\|A0LN68\|FTSH_SYNFM	ATP-dependent zinc metalloprotease FtsH OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=ftsH PE=3 SV=1	102	285	4.0E-29
sp\|Q6MLS7\|FTSH1_BDEBA	ATP-dependent zinc metalloprotease FtsH 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ftsH1 PE=3 SV=1	102	285	4.0E-29
sp\|A0L4S0\|FTSH_MAGMM	ATP-dependent zinc metalloprotease FtsH OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=ftsH PE=3 SV=1	102	287	4.0E-29
sp\|D1BLD0\|FTSH_VEIPT	ATP-dependent zinc metalloprotease FtsH OS=Veillonella parvula (strain ATCC 10790 / DSM 2008 / JCM 12972 / Te3) GN=ftsH PE=3 SV=1	102	274	4.0E-29
sp\|Q9FXT9\|PRS7_ORYSJ	26S protease regulatory subunit 7 OS=Oryza sativa subsp. japonica GN=RPT1A PE=2 SV=1	64	286	4.0E-29
sp\|Q9SCN8\|CD48D_ARATH	Cell division control protein 48 homolog D OS=Arabidopsis thaliana GN=CDC48D PE=1 SV=1	105	288	5.0E-29
sp\|A6TWP7\|FTSH2_ALKMQ	ATP-dependent zinc metalloprotease FtsH 2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=ftsH2 PE=3 SV=1	102	283	5.0E-29
sp\|Q9SZD4\|PRS4A_ARATH	26S proteasome regulatory subunit 4 homolog A OS=Arabidopsis thaliana GN=RPT2A PE=1 SV=1	46	288	5.0E-29
sp\|O57940\|PAN_PYRHO	Proteasome-activating nucleotidase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pan PE=3 SV=1	63	288	5.0E-29
sp\|Q9Y4W6\|AFG32_HUMAN	AFG3-like protein 2 OS=Homo sapiens GN=AFG3L2 PE=1 SV=2	54	334	5.0E-29
sp\|P46463\|PEX1_PICPA	Peroxisome biosynthesis protein PAS1 OS=Komagataella pastoris GN=PEX1 PE=3 SV=1	105	289	5.0E-29
sp\|Q8JZQ2\|AFG32_MOUSE	AFG3-like protein 2 OS=Mus musculus GN=Afg3l2 PE=1 SV=1	54	334	7.0E-29
sp\|A1AT11\|FTSH_PELPD	ATP-dependent zinc metalloprotease FtsH OS=Pelobacter propionicus (strain DSM 2379) GN=ftsH PE=3 SV=1	40	293	7.0E-29
sp\|B2A3Q4\|FTSH_NATTJ	ATP-dependent zinc metalloprotease FtsH OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=ftsH PE=3 SV=1	102	285	7.0E-29
sp\|Q9V287\|PAN_PYRAB	Proteasome-activating nucleotidase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pan PE=3 SV=2	63	288	7.0E-29
sp\|B9MPK5\|FTSH_CALBD	ATP-dependent zinc metalloprotease FtsH OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=ftsH PE=3 SV=1	64	273	8.0E-29
sp\|Q9SEI2\|PS6AA_ARATH	26S protease regulatory subunit 6A homolog A OS=Arabidopsis thaliana GN=RPT5A PE=1 SV=1	46	286	8.0E-29
sp\|Q54PT2\|VPS4_DICDI	Vacuolar protein sorting-associated protein 4 OS=Dictyostelium discoideum GN=vps4 PE=3 SV=1	105	286	9.0E-29
sp\|D3FA80\|FTSH2_CONWI	ATP-dependent zinc metalloprotease FtsH 2 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH2 PE=3 SV=1	64	286	9.0E-29
sp\|C6V4R9\|FTSH_NEORI	ATP-dependent zinc metalloprotease FtsH OS=Neorickettsia risticii (strain Illinois) GN=ftsH PE=3 SV=1	102	312	9.0E-29
sp\|O23894\|PRS6A_BRACM	26S protease regulatory subunit 6A homolog OS=Brassica campestris GN=TBP1 PE=2 SV=1	46	286	9.0E-29
sp\|Q8U4H3\|PAN_PYRFU	Proteasome-activating nucleotidase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pan PE=1 SV=1	63	288	1.0E-28
sp\|Q92JJ9\|FTSH_RICCN	ATP-dependent zinc metalloprotease FtsH OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ftsH PE=3 SV=1	102	285	1.0E-28
sp\|B8H444\|FTSH_CAUCN	ATP-dependent zinc metalloprotease FtsH OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ftsH PE=2 SV=1	102	312	1.0E-28
sp\|Q25544\|PRS8_NAEFO	26S protease regulatory subunit 8 homolog OS=Naegleria fowleri PE=2 SV=1	65	313	1.0E-28
sp\|D5H7Z5\|FTSH1_SALRM	ATP-dependent zinc metalloprotease FtsH 1 OS=Salinibacter ruber (strain M8) GN=ftsH1 PE=3 SV=1	48	285	1.0E-28
sp\|Q68XR9\|FTSH_RICTY	ATP-dependent zinc metalloprotease FtsH OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ftsH PE=3 SV=1	102	285	1.0E-28
sp\|Q6MDI5\|FTSH_PARUW	ATP-dependent zinc metalloprotease FtsH OS=Protochlamydia amoebophila (strain UWE25) GN=ftsH PE=3 SV=1	65	317	1.0E-28
sp\|D1CDT8\|FTSH_THET1	ATP-dependent zinc metalloprotease FtsH OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1) GN=ftsH PE=3 SV=1	105	285	1.0E-28
sp\|P48601\|PRS4_DROME	26S protease regulatory subunit 4 OS=Drosophila melanogaster GN=Rpt2 PE=1 SV=2	65	288	1.0E-28
sp\|Q4UN68\|FTSH_RICFE	ATP-dependent zinc metalloprotease FtsH OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ftsH PE=3 SV=1	102	285	1.0E-28
sp\|Q9ZEA2\|FTSH_RICPR	ATP-dependent zinc metalloprotease FtsH OS=Rickettsia prowazekii (strain Madrid E) GN=ftsH PE=3 SV=1	102	285	2.0E-28
sp\|Q3ULF4\|SPG7_MOUSE	Paraplegin OS=Mus musculus GN=Spg7 PE=1 SV=1	102	312	2.0E-28
sp\|B3QZS3\|FTSH2_PHYMT	ATP-dependent zinc metalloprotease FtsH 2 OS=Phytoplasma mali (strain AT) GN=ftsH2 PE=3 SV=1	65	285	2.0E-28
sp\|Q2LUQ1\|FTSH_SYNAS	ATP-dependent zinc metalloprotease FtsH OS=Syntrophus aciditrophicus (strain SB) GN=ftsH PE=3 SV=1	105	295	2.0E-28
sp\|Q8SRH0\|PRS4_ENCCU	26S protease regulatory subunit 4 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT2 PE=1 SV=1	65	288	2.0E-28
sp\|Q83FV7\|FTSH_TROWT	ATP-dependent zinc metalloprotease FtsH OS=Tropheryma whipplei (strain Twist) GN=ftsH PE=3 SV=1	66	283	2.0E-28
sp\|A9GAW6\|FTSH3_SORC5	ATP-dependent zinc metalloprotease FtsH 3 OS=Sorangium cellulosum (strain So ce56) GN=ftsH3 PE=3 SV=1	66	288	2.0E-28
sp\|O16368\|PRS4_CAEEL	Probable 26S protease regulatory subunit 4 OS=Caenorhabditis elegans GN=rpt-2 PE=3 SV=1	63	288	2.0E-28
sp\|Q2KJI7\|AFG32_BOVIN	AFG3-like protein 2 OS=Bos taurus GN=AFG3L2 PE=2 SV=1	54	334	2.0E-28
sp\|Q9ZNT0\|VPS4_ARATH	Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 OS=Arabidopsis thaliana GN=SKD1 PE=1 SV=1	107	279	2.0E-28
sp\|P71377\|FTSH_HAEIN	ATP-dependent zinc metalloprotease FtsH OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ftsH PE=3 SV=1	57	300	2.0E-28
sp\|Q8SSJ5\|CDC48_ENCCU	Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC48 PE=1 SV=1	105	289	3.0E-28
sp\|Q8NB90\|SPAT5_HUMAN	Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3	51	286	3.0E-28
sp\|Q18787\|PRS7_CAEEL	26S protease regulatory subunit 7 OS=Caenorhabditis elegans GN=rpt-1 PE=1 SV=1	64	286	3.0E-28
sp\|A9EXK6\|FTSH4_SORC5	ATP-dependent zinc metalloprotease FtsH 4 OS=Sorangium cellulosum (strain So ce56) GN=ftsH4 PE=3 SV=1	64	290	3.0E-28
sp\|A5W382\|FTSH_PSEP1	ATP-dependent zinc metalloprotease FtsH OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ftsH PE=3 SV=1	63	285	3.0E-28
sp\|Q3B8D5\|KATL2_XENLA	Katanin p60 ATPase-containing subunit A-like 2 OS=Xenopus laevis GN=katnal2 PE=2 SV=1	90	286	3.0E-28
sp\|Q04Q03\|FTSH_LEPBJ	ATP-dependent zinc metalloprotease FtsH OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=ftsH PE=3 SV=1	102	285	3.0E-28
sp\|Q9UQ90\|SPG7_HUMAN	Paraplegin OS=Homo sapiens GN=SPG7 PE=1 SV=2	102	312	3.0E-28
sp\|Q5JHS5\|PAN_THEKO	Proteasome-activating nucleotidase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pan PE=3 SV=1	64	286	5.0E-28
sp\|Q9BVQ7\|SPA5L_HUMAN	Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens GN=SPATA5L1 PE=1 SV=2	98	327	5.0E-28
sp\|Q1LLA9\|FTSH_CUPMC	ATP-dependent zinc metalloprotease FtsH OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ftsH PE=3 SV=1	57	300	5.0E-28
sp\|B6YXR2\|PAN_THEON	Proteasome-activating nucleotidase OS=Thermococcus onnurineus (strain NA1) GN=pan PE=3 SV=1	64	286	5.0E-28
sp\|Q8LQJ9\|FTSH4_ORYSJ	ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH4 PE=3 SV=1	64	319	5.0E-28
sp\|D0LWB8\|FTSH_HALO1	ATP-dependent zinc metalloprotease FtsH OS=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2) GN=ftsH PE=3 SV=1	102	285	6.0E-28
sp\|Q9FGM0\|FTSHB_ARATH	ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=FTSH11 PE=1 SV=1	102	312	6.0E-28
sp\|Q1RGP0\|FTSH_RICBR	ATP-dependent zinc metalloprotease FtsH OS=Rickettsia bellii (strain RML369-C) GN=ftsH PE=3 SV=1	102	296	8.0E-28
sp\|O80983\|FTSH4_ARATH	ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Arabidopsis thaliana GN=FTSH4 PE=1 SV=2	102	285	8.0E-28
sp\|P54811\|TERA1_CAEEL	Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans GN=cdc-48.1 PE=1 SV=1	66	289	9.0E-28
sp\|P57462\|FTSH_BUCAI	ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ftsH PE=3 SV=2	57	285	9.0E-28
sp\|Q9FNP1\|PEX1_ARATH	Peroxisome biogenesis protein 1 OS=Arabidopsis thaliana GN=PEX1 PE=2 SV=2	107	288	1.0E-27
sp\|P52917\|VPS4_YEAST	Vacuolar protein sorting-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS4 PE=1 SV=1	105	292	1.0E-27
sp\|Q9ERZ6\|FIGN_MOUSE	Fidgetin OS=Mus musculus GN=Fign PE=1 SV=1	87	347	1.0E-27
sp\|Q5AG40\|VPS4_CANAL	Vacuolar protein sorting-associated protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS4 PE=2 SV=1	105	286	1.0E-27
sp\|C5J6A7\|FTSH_MYCCR	ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma conjunctivae (strain ATCC 25834 / HRC/581 / NCTC 10147) GN=ftsH PE=3 SV=1	102	289	1.0E-27
sp\|A6TSZ1\|FTSH1_ALKMQ	ATP-dependent zinc metalloprotease FtsH 1 OS=Alkaliphilus metalliredigens (strain QYMF) GN=ftsH1 PE=3 SV=1	66	289	1.0E-27
sp\|Q07590\|SAV_SULAC	Protein SAV OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=sav PE=3 SV=2	98	286	2.0E-27
sp\|P46502\|PRS6B_CAEEL	Probable 26S protease regulatory subunit 6B OS=Caenorhabditis elegans GN=rpt-3 PE=3 SV=1	95	288	2.0E-27
sp\|Q89AF2\|FTSH_BUCBP	ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ftsH PE=3 SV=1	60	285	2.0E-27
sp\|Q9HG03\|PEX6_PENCH	Peroxisomal biogenesis factor 6 OS=Penicillium chrysogenum GN=pex6 PE=3 SV=1	73	292	2.0E-27
sp\|B1GZK7\|FTSH_UNCTG	ATP-dependent zinc metalloprotease FtsH OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=ftsH PE=3 SV=1	102	296	2.0E-27
sp\|Q8RY16\|PEX6_ARATH	Peroxisome biogenesis protein 6 OS=Arabidopsis thaliana GN=PEX6 PE=1 SV=1	22	337	2.0E-27
sp\|Q0VA52\|SPA5L_XENTR	Spermatogenesis-associated protein 5-like protein 1 OS=Xenopus tropicalis GN=spata5l1 PE=2 SV=1	74	286	2.0E-27
sp\|Q3UMC0\|SPAT5_MOUSE	Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=1 SV=2	50	286	3.0E-27
sp\|Q63569\|PRS6A_RAT	26S protease regulatory subunit 6A OS=Rattus norvegicus GN=Psmc3 PE=2 SV=1	47	286	3.0E-27
sp\|C1F8X6\|FTSH_ACIC5	ATP-dependent zinc metalloprotease FtsH OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=ftsH PE=3 SV=1	102	285	3.0E-27
sp\|O88685\|PRS6A_MOUSE	26S protease regulatory subunit 6A OS=Mus musculus GN=Psmc3 PE=1 SV=2	47	286	3.0E-27
sp\|P17980\|PRS6A_HUMAN	26S protease regulatory subunit 6A OS=Homo sapiens GN=PSMC3 PE=1 SV=3	47	286	3.0E-27
sp\|B3DY14\|FTSH2_METI4	ATP-dependent zinc metalloprotease FtsH 2 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH2 PE=3 SV=1	102	288	3.0E-27
sp\|O88967\|YMEL1_MOUSE	ATP-dependent zinc metalloprotease YME1L1 OS=Mus musculus GN=Yme1l1 PE=1 SV=1	63	319	3.0E-27
sp\|A1URA3\|FTSH_BARBK	ATP-dependent zinc metalloprotease FtsH OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ftsH PE=3 SV=1	65	285	3.0E-27
sp\|Q9C1E9\|PEX6_COLOR	Peroxisomal biogenesis factor 6 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=PEX6 PE=3 SV=2	85	292	4.0E-27
sp\|Q96TA2\|YMEL1_HUMAN	ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens GN=YME1L1 PE=1 SV=2	63	319	4.0E-27
sp\|Q5R8D7\|PRS7_PONAB	26S protease regulatory subunit 7 OS=Pongo abelii GN=PSMC2 PE=2 SV=3	64	286	4.0E-27
sp\|P54812\|TERA2_CAEEL	Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans GN=cdc-48.2 PE=1 SV=2	66	289	5.0E-27
sp\|Q4A5F0\|FTSH_MYCS5	ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma synoviae (strain 53) GN=ftsH PE=3 SV=2	105	289	5.0E-27
sp\|A2ZVG7\|FTSH9_ORYSJ	ATP-dependent zinc metalloprotease FTSH 9, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH9 PE=3 SV=1	102	294	5.0E-27
sp\|Q8LQJ8\|FTSH5_ORYSJ	ATP-dependent zinc metalloprotease FTSH 5, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH5 PE=3 SV=1	102	319	6.0E-27
sp\|P40327\|PRS4_YEAST	26S protease regulatory subunit 4 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT2 PE=1 SV=3	65	311	6.0E-27
sp\|P36612\|PRS4_SCHPO	26S protease regulatory subunit 4 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mts2 PE=2 SV=1	65	311	6.0E-27
sp\|C5A6P8\|PAN_THEGJ	Proteasome-activating nucleotidase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pan PE=3 SV=1	64	288	6.0E-27
sp\|O42586\|PR6AB_XENLA	26S protease regulatory subunit 6A-B OS=Xenopus laevis GN=psmc3-b PE=2 SV=1	47	286	7.0E-27
sp\|Q5SI82\|FTSH_THET8	ATP-dependent zinc metalloprotease FtsH OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ftsH PE=1 SV=1	102	273	7.0E-27
sp\|Q9HGM3\|YTA12_SCHPO	Mitochondrial respiratory chain complexes assembly protein rca1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yta12 PE=3 SV=1	102	285	1.0E-26
sp\|Q5HY92\|FIGN_HUMAN	Fidgetin OS=Homo sapiens GN=FIGN PE=1 SV=2	87	347	1.0E-26
sp\|A9KIG5\|FTSH_CLOPH	ATP-dependent zinc metalloprotease FtsH OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ftsH PE=3 SV=1	95	291	1.0E-26
sp\|P46471\|PRS7_MOUSE	26S protease regulatory subunit 7 OS=Mus musculus GN=Psmc2 PE=1 SV=5	64	286	1.0E-26
sp\|A9FDV9\|FTSH2_SORC5	ATP-dependent zinc metalloprotease FtsH 2 OS=Sorangium cellulosum (strain So ce56) GN=ftsH2 PE=3 SV=1	105	278	1.0E-26
sp\|Q4R4R0\|PRS7_MACFA	26S protease regulatory subunit 7 OS=Macaca fascicularis GN=PSMC2 PE=2 SV=3	64	286	1.0E-26
sp\|P35998\|PRS7_HUMAN	26S protease regulatory subunit 7 OS=Homo sapiens GN=PSMC2 PE=1 SV=3	64	286	1.0E-26
sp\|Q5E9F9\|PRS7_BOVIN	26S protease regulatory subunit 7 OS=Bos taurus GN=PSMC2 PE=2 SV=3	64	286	1.0E-26
sp\|P46472\|PRS7_XENLA	26S protease regulatory subunit 7 OS=Xenopus laevis GN=psmc2 PE=2 SV=1	17	286	1.0E-26
sp\|Q88Z31\|FTSH_LACPL	ATP-dependent zinc metalloprotease FtsH OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ftsH PE=2 SV=1	102	273	1.0E-26
sp\|C6VKW6\|FTSH_LACPJ	ATP-dependent zinc metalloprotease FtsH OS=Lactobacillus plantarum (strain JDM1) GN=ftsH PE=3 SV=1	102	273	1.0E-26
sp\|Q55BV5\|PRS4_DICDI	26S protease regulatory subunit 4 homolog OS=Dictyostelium discoideum GN=psmC1 PE=1 SV=1	65	288	1.0E-26
sp\|P33298\|PRS6B_YEAST	26S protease regulatory subunit 6B homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT3 PE=1 SV=2	64	286	1.0E-26
sp\|B3R057\|FTSH1_PHYMT	ATP-dependent zinc metalloprotease FtsH 1 OS=Phytoplasma mali (strain AT) GN=ftsH1 PE=3 SV=1	103	286	1.0E-26
sp\|O43933\|PEX1_HUMAN	Peroxisome biogenesis factor 1 OS=Homo sapiens GN=PEX1 PE=1 SV=1	105	286	2.0E-26
sp\|Q63347\|PRS7_RAT	26S protease regulatory subunit 7 OS=Rattus norvegicus GN=Psmc2 PE=1 SV=3	17	286	2.0E-26
sp\|A9NE17\|FTSH_ACHLI	ATP-dependent zinc metalloprotease FtsH OS=Acholeplasma laidlawii (strain PG-8A) GN=ftsH PE=3 SV=1	102	274	2.0E-26
sp\|Q925S8\|YMEL1_RAT	ATP-dependent zinc metalloprotease YME1L1 OS=Rattus norvegicus GN=Yme1l1 PE=2 SV=1	63	319	2.0E-26
sp\|P39925\|AFG3_YEAST	Mitochondrial respiratory chain complexes assembly protein AFG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG3 PE=1 SV=1	102	328	2.0E-26
sp\|Q3A579\|FTSH_PELCD	ATP-dependent zinc metalloprotease FtsH OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ftsH PE=3 SV=1	64	312	3.0E-26
sp\|Q6PL18\|ATAD2_HUMAN	ATPase family AAA domain-containing protein 2 OS=Homo sapiens GN=ATAD2 PE=1 SV=1	76	286	3.0E-26
sp\|B4U7U4\|FTSH_HYDS0	ATP-dependent zinc metalloprotease FtsH OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=ftsH PE=3 SV=1	105	285	4.0E-26
sp\|B2UMY1\|FTSH_AKKM8	ATP-dependent zinc metalloprotease FtsH OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=ftsH PE=3 SV=1	57	285	4.0E-26
sp\|A9BJK3\|FTSH3_PETMO	ATP-dependent zinc metalloprotease FtsH 3 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH3 PE=3 SV=1	64	285	4.0E-26
sp\|Q7SGP2\|PEX6_NEUCR	Peroxisomal biogenesis factor 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pex-6 PE=3 SV=1	85	357	5.0E-26
sp\|A9BHD3\|FTSH2_PETMO	ATP-dependent zinc metalloprotease FtsH 2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH2 PE=3 SV=1	65	312	5.0E-26
sp\|Q5RDX4\|ATAD2_PONAB	ATPase family AAA domain-containing protein 2 OS=Pongo abelii GN=ATAD2 PE=2 SV=1	76	286	7.0E-26
sp\|P32795\|YME1_YEAST	Mitochondrial inner membrane i-AAA protease supercomplex subunit YME1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YME1 PE=1 SV=1	102	312	7.0E-26
sp\|Q1D491\|FTSH_MYXXD	ATP-dependent zinc metalloprotease FtsH OS=Myxococcus xanthus (strain DK 1622) GN=ftsH PE=3 SV=1	64	310	8.0E-26
sp\|P54813\|YME1_CAEEL	ATP-dependent zinc metalloprotease YME1 homolog OS=Caenorhabditis elegans GN=ymel-1 PE=3 SV=2	105	285	8.0E-26
sp\|A7YSY2\|SPA5L_BOVIN	Spermatogenesis-associated protein 5-like protein 1 OS=Bos taurus GN=SPATA5L1 PE=2 SV=1	105	286	9.0E-26
sp\|P78578\|PRS6B_ASPNG	26S protease regulatory subunit 6B homolog OS=Aspergillus niger GN=tbpA PE=3 SV=1	64	286	9.0E-26
sp\|Q9LET7\|CI111_ARATH	Calmodulin-interacting protein 111 OS=Arabidopsis thaliana GN=CIP111 PE=1 SV=1	105	286	1.0E-25
sp\|Q3B6R3\|FTSH_CHLL7	ATP-dependent zinc metalloprotease FtsH OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=ftsH PE=3 SV=1	102	271	1.0E-25
sp\|Q8CDM1\|ATAD2_MOUSE	ATPase family AAA domain-containing protein 2 OS=Mus musculus GN=Atad2 PE=1 SV=1	48	286	1.0E-25
sp\|P40341\|YTA12_YEAST	Mitochondrial respiratory chain complexes assembly protein YTA12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA12 PE=1 SV=2	102	296	1.0E-25
sp\|Q9C0W2\|YHI5_SCHPO	Uncharacterized AAA domain-containing protein P22H7.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi026 PE=3 SV=1	51	286	2.0E-25
sp\|Q03Z46\|FTSH_LEUMM	ATP-dependent zinc metalloprotease FtsH OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ftsH PE=3 SV=1	102	273	2.0E-25
sp\|Q74Z13\|PEX6_ASHGO	Peroxisomal biogenesis factor 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PEX6 PE=3 SV=1	90	286	2.0E-25
sp\|B3R0R7\|FTSH3_PHYMT	ATP-dependent zinc metalloprotease FtsH 3 OS=Phytoplasma mali (strain AT) GN=ftsH3 PE=3 SV=1	103	286	2.0E-25
sp\|P33760\|PEX6_YEAST	Peroxisomal ATPase PEX6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX6 PE=1 SV=1	85	286	2.0E-25
sp\|P32794\|AFG2_YEAST	ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1	65	287	3.0E-25
sp\|Q9UVU5\|PEX6_PICAN	Peroxisomal biogenesis factor 6 OS=Pichia angusta GN=PEX6 PE=1 SV=1	85	295	3.0E-25
sp\|D3EZK2\|FTSH3_CONWI	ATP-dependent zinc metalloprotease FtsH 3 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH3 PE=3 SV=1	102	285	3.0E-25
sp\|Q9ULI0\|ATD2B_HUMAN	ATPase family AAA domain-containing protein 2B OS=Homo sapiens GN=ATAD2B PE=1 SV=3	76	286	3.0E-25
sp\|Q67WJ2\|FTSH6_ORYSJ	ATP-dependent zinc metalloprotease FTSH 6, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH6 PE=3 SV=1	105	285	4.0E-25
sp\|Q9FIM2\|FTSH9_ARATH	ATP-dependent zinc metalloprotease FTSH 9, chloroplastic OS=Arabidopsis thaliana GN=FTSH9 PE=2 SV=1	60	285	4.0E-25
sp\|Q07844\|RIX7_YEAST	Ribosome biogenesis ATPase RIX7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIX7 PE=1 SV=1	58	287	5.0E-25
sp\|Q7UUZ7\|FTSH1_RHOBA	ATP-dependent zinc metalloprotease FtsH 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ftsH1 PE=3 SV=1	102	319	6.0E-25
sp\|Q503S1\|FIGN_DANRE	Fidgetin OS=Danio rerio GN=fign PE=2 SV=1	20	347	6.0E-25
sp\|C6A7B2\|ARC_BIFLB	AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain Bl-04 / DGCC2908 / RB 4825 / SD5219) GN=arc PE=3 SV=1	64	309	1.0E-24
sp\|C6AHX0\|ARC_BIFAS	AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain DSM 10140 / JCM 10602 / LMG 18314) GN=arc PE=3 SV=1	64	309	1.0E-24
sp\|B8DTX4\|ARC_BIFA0	AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=arc PE=3 SV=1	64	309	1.0E-24
sp\|D3R4I7\|ARC_BIFAB	AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain BB-12) GN=arc PE=3 SV=1	64	309	1.0E-24
sp\|O74894\|PRS6B_SCHPO	26S protease regulatory subunit 6B homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt3 PE=3 SV=1	105	304	1.0E-24
sp\|A9GRC9\|FTSH1_SORC5	ATP-dependent zinc metalloprotease FtsH 1 OS=Sorangium cellulosum (strain So ce56) GN=ftsH1 PE=3 SV=1	102	278	1.0E-24
sp\|P54777\|PEX6_RAT	Peroxisome assembly factor 2 OS=Rattus norvegicus GN=Pex6 PE=1 SV=1	109	339	2.0E-24
sp\|B0B970\|FTSH_CHLT2	ATP-dependent zinc metalloprotease FtsH OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=ftsH PE=3 SV=1	64	273	2.0E-24
sp\|Q99LC9\|PEX6_MOUSE	Peroxisome assembly factor 2 OS=Mus musculus GN=Pex6 PE=1 SV=1	109	287	2.0E-24
sp\|P40340\|TBP7_YEAST	Tat-binding homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA7 PE=1 SV=2	62	287	3.0E-24
sp\|O67077\|FTSH_AQUAE	ATP-dependent zinc metalloprotease FtsH OS=Aquifex aeolicus (strain VF5) GN=ftsH PE=1 SV=1	105	273	3.0E-24
sp\|Q13608\|PEX6_HUMAN	Peroxisome assembly factor 2 OS=Homo sapiens GN=PEX6 PE=1 SV=2	109	287	5.0E-24
sp\|Q6CPV1\|PEX6_KLULA	Peroxisomal biogenesis factor 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PEX6 PE=3 SV=1	85	286	6.0E-24
sp\|D1AXT4\|FTSH_STRM9	ATP-dependent zinc metalloprotease FtsH OS=Streptobacillus moniliformis (strain ATCC 14647 / DSM 12112 / NCTC 10651 / 9901) GN=ftsH PE=3 SV=1	102	285	9.0E-24
sp\|Q9DBY8\|NVL_MOUSE	Nuclear valosin-containing protein-like OS=Mus musculus GN=Nvl PE=1 SV=1	105	286	1.0E-23
sp\|Q9SD67\|FTSH7_ARATH	ATP-dependent zinc metalloprotease FTSH 7, chloroplastic OS=Arabidopsis thaliana GN=FTSH7 PE=2 SV=1	55	285	1.0E-23
sp\|O74941\|PEX1_SCHPO	Peroxisomal ATPase pex1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex1 PE=3 SV=1	105	288	2.0E-23
sp\|Q83XX3\|FTSH_OENOE	ATP-dependent zinc metalloprotease FtsH OS=Oenococcus oeni GN=ftsH PE=2 SV=1	102	273	2.0E-23
sp\|Q6FW67\|PEX6_CANGA	Peroxisomal biogenesis factor 6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PEX6 PE=3 SV=1	85	286	2.0E-23
sp\|P36966\|PEX6_YARLI	Peroxisomal biogenesis factor 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PEX6 PE=3 SV=2	87	286	2.0E-23
sp\|O15381\|NVL_HUMAN	Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1	105	286	3.0E-23
sp\|Q9BVQ7\|SPA5L_HUMAN	Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens GN=SPATA5L1 PE=1 SV=2	105	286	3.0E-23
sp\|A9BFL9\|FTSH1_PETMO	ATP-dependent zinc metalloprotease FtsH 1 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH1 PE=3 SV=1	64	285	3.0E-23
sp\|Q5UQE0\|YR476_MIMIV	Putative AAA family ATPase R476 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R476 PE=3 SV=1	86	290	4.0E-23
sp\|P54816\|TBP7_CAEEL	Tat-binding homolog 7 OS=Caenorhabditis elegans GN=lex-1 PE=1 SV=3	76	325	5.0E-23
sp\|Q6H6R9\|FTSH7_ORYSJ	ATP-dependent zinc metalloprotease FTSH 7, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH7 PE=3 SV=1	64	285	6.0E-23
sp\|O22993\|FTSI1_ARATH	Probable inactive ATP-dependent zinc metalloprotease FTSHI 1, chloroplastic OS=Arabidopsis thaliana GN=FTSHI1 PE=1 SV=1	61	286	1.0E-22
sp\|F4IAE9\|Y1591_ARATH	ATPase family AAA domain-containing protein At1g05910 OS=Arabidopsis thaliana GN=At1g05910 PE=2 SV=1	56	289	1.0E-22
sp\|Q7TT47\|SPG7_RAT	Paraplegin OS=Rattus norvegicus GN=Spg7 PE=2 SV=1	102	298	2.0E-22
sp\|O59824\|YME1_SCHPO	ATP-dependent zinc metalloprotease YME1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.04c PE=3 SV=1	102	294	2.0E-22
sp\|A8X0L9\|TBP7_CAEBR	Tat-binding homolog 7 OS=Caenorhabditis briggsae GN=lex-1 PE=3 SV=2	76	325	3.0E-22
sp\|A1A0U4\|ARC_BIFAA	AAA ATPase forming ring-shaped complexes OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=arc PE=3 SV=1	64	235	3.0E-22
sp\|O42587\|PR6AA_XENLA	26S protease regulatory subunit 6A-A OS=Xenopus laevis GN=psmc3-a PE=2 SV=1	47	286	3.0E-22
sp\|A8MPR5\|FTSI2_ARATH	Probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic OS=Arabidopsis thaliana GN=FTSHI2 PE=1 SV=1	102	283	4.0E-22
sp\|Q6BS73\|PEX6_DEBHA	Peroxisomal biogenesis factor 6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PEX6 PE=3 SV=2	85	286	7.0E-22
sp\|P42811\|PRS2_METTM	Putative 26S protease regulatory subunit homolog MTBMA_c13930 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c13930 PE=3 SV=1	105	283	8.0E-22
sp\|Q4JVP5\|ARC_CORJK	AAA ATPase forming ring-shaped complexes OS=Corynebacterium jeikeium (strain K411) GN=arc PE=3 SV=1	64	283	1.0E-21
sp\|O14114\|YEJJ_SCHPO	Uncharacterized AAA domain-containing protein C31G5.19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC31G5.19 PE=3 SV=1	76	297	1.0E-21
sp\|D2Q9C6\|ARC_BIFDB	AAA ATPase forming ring-shaped complexes OS=Bifidobacterium dentium (strain ATCC 27534 / DSM 20436 / JCM 1195 / Bd1) GN=arc PE=3 SV=1	64	235	1.0E-21
sp\|B2GIP2\|ARC_KOCRD	AAA ATPase forming ring-shaped complexes OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=arc PE=3 SV=1	64	248	2.0E-21
sp\|Q9ZPR1\|CD48B_ARATH	Cell division control protein 48 homolog B OS=Arabidopsis thaliana GN=CDC48B PE=2 SV=1	105	357	2.0E-21
sp\|Q9SS94\|CD48C_ARATH	Cell division control protein 48 homolog C OS=Arabidopsis thaliana GN=CDC48C PE=2 SV=2	53	340	3.0E-21
sp\|F4KF14\|FTSI4_ARATH	Probable inactive ATP-dependent zinc metalloprotease FTSHI 4, chloroplastic OS=Arabidopsis thaliana GN=FTSHI4 PE=1 SV=1	105	283	3.0E-21
sp\|C3PGA0\|ARC_CORA7	AAA ATPase forming ring-shaped complexes OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=arc PE=3 SV=1	64	301	5.0E-21
sp\|Q9ZPR1\|CD48B_ARATH	Cell division control protein 48 homolog B OS=Arabidopsis thaliana GN=CDC48B PE=2 SV=1	105	285	1.0E-19
sp\|Q54SY2\|NVL_DICDI	Putative ribosome biogenesis ATPase nvl OS=Dictyostelium discoideum GN=nvl PE=3 SV=1	87	286	2.0E-15
sp\|Q13608\|PEX6_HUMAN	Peroxisome assembly factor 2 OS=Homo sapiens GN=PEX6 PE=1 SV=2	107	286	5.0E-08
sp\|Q99LC9\|PEX6_MOUSE	Peroxisome assembly factor 2 OS=Mus musculus GN=Pex6 PE=1 SV=1	107	294	3.0E-07
sp\|Q0VA52\|SPA5L_XENTR	Spermatogenesis-associated protein 5-like protein 1 OS=Xenopus tropicalis GN=spata5l1 PE=2 SV=1	90	154	3.0E-06

[Show less]

GO

GO Term	Description	Terminal node
GO:0016887	ATP hydrolysis activity	Yes
GO:0005524	ATP binding	Yes
GO:0030554	adenyl nucleotide binding	No
GO:0016787	hydrolase activity	No
GO:0032555	purine ribonucleotide binding	No
GO:0005488	binding	No
GO:0003824	catalytic activity	No
GO:0036094	small molecule binding	No
GO:0017111	nucleoside-triphosphatase activity	No
GO:1901363	heterocyclic compound binding	No
GO:0097159	organic cyclic compound binding	No
GO:0016462	pyrophosphatase activity	No
GO:0016818	hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides	No
GO:1901265	nucleoside phosphate binding	No
GO:0035639	purine ribonucleoside triphosphate binding	No
GO:0016817	hydrolase activity, acting on acid anhydrides	No
GO:0043167	ion binding	No
GO:0032559	adenyl ribonucleotide binding	No
GO:0000166	nucleotide binding	No
GO:0043168	anion binding	No
GO:0032553	ribonucleotide binding	No
GO:0003674	molecular_function	No
GO:0097367	carbohydrate derivative binding	No
GO:0017076	purine nucleotide binding	No

Deeploc

[Help with interpreting the results of Deeploc 2.0]

Localizations	Signals	Cytoplasm	Nucleus	Extracellular	Cell membrane	Mitochondrion	Plastid	Endoplasmic reticulum	Lysosome vacuole	Golgi apparatus	Peroxisome
Cytoplasm		0.4723	0.5106	0.0277	0.041	0.1656	0.027	0.2524	0.1141	0.0802	0.3305

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID	4
Orthogroup	643
Change Orthofinder run

Species	Protein ID
Ophiocordyceps australis 1348a (Ghana)	OphauG2\|4140
Ophiocordyceps australis map64 (Brazil)	OphauB2\|2507
Ophiocordyceps camponoti-floridani	Ophcf2\|04290
Ophiocordyceps camponoti-rufipedis	Ophun1\|2109
Ophiocordyceps kimflemingae	Ophio5\|4802
Ophiocordyceps subramaniannii	Hirsu2\|10500
Ophiocordyceps subramaniannii	Hirsu2\|2287 (this protein)

Sequences

Type of sequence	Sequence
Locus	Download genbank file of locus Download genbank file of locus (reverse complement) The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein	>Hirsu2\|2287 MRIHPLRPSIWQTGADPTRSRNGIEINVASGVTDNHRREARGPKLNEYEKRIATGQIDRDSLHTTFADVHAPVET ISTLKLLTSLALVRPDAFSYGVLAQDKIPGCLLYGPPGTGKTMLAKAVAKESGANMLEISGASINDKWVGESEKL IRAVFTLAKRLSPCVVFIDEADSLLASRSMLSNRPSRREHINQFLKEWDGIEETNAFVMVATNRPFDLDDAVLRR LPRKVLVDLPLKSDRAAILSLLLKGESLDDSASLDEYAERTTYYSGSDLKNVCVAAAMAAVEEENAAAARHTGPE PFRYPERRVLRGDHFEKALRLIPASISEDMDSLKMIRKFDKEFGSGEKKNKKTIGFGVFDAKQYAGPSEARVRHG PNL*
Coding	>Hirsu2\|2287 ATGAGGATTCATCCTCTGAGGCCGAGTATTTGGCAGACTGGCGCGGACCCAACACGGTCCCGCAATGGGATCGAG ATTAACGTAGCCTCAGGGGTGACGGACAACCACAGACGTGAAGCACGGGGTCCGAAGCTGAACGAATACGAGAAG CGAATAGCCACCGGACAAATTGACCGCGATAGCCTGCACACAACGTTCGCCGACGTTCACGCCCCCGTTGAGACG ATTTCGACGCTCAAGCTGCTCACCTCACTAGCCCTCGTGCGACCTGACGCGTTCTCGTATGGCGTGCTGGCGCAA GACAAGATCCCGGGCTGTCTTCTATACGGACCGCCCGGAACAGGTAAGACGATGCTTGCCAAGGCTGTCGCCAAA GAGAGCGGTGCGAATATGCTCGAGATTAGCGGCGCCTCAATCAACGATAAGTGGGTAGGTGAGAGCGAGAAACTG ATTCGTGCGGTCTTCACGCTGGCGAAGCGTCTGTCACCCTGTGTCGTCTTCATCGACGAGGCAGATTCACTGCTG GCAAGCCGGAGCATGCTCAGCAACCGGCCTTCTCGCAGGGAACACATCAACCAATTCCTTAAGGAGTGGGATGGC ATAGAGGAGACCAATGCTTTTGTTATGGTGGCCACCAATCGCCCCTTTGATCTCGATGATGCGGTCCTGCGGCGG CTTCCACGCAAGGTTCTCGTCGACCTACCCCTCAAAAGCGATCGCGCTGCCATTCTGAGCTTGCTGCTTAAGGGG GAGAGTCTGGACGACTCCGCCTCCCTCGACGAGTACGCAGAGAGAACGACCTATTACTCCGGCTCAGATCTCAAA AACGTCTGCGTTGCGGCGGCTATGGCTGCCGTAGAAGAAGAGAACGCAGCGGCGGCCAGGCACACCGGCCCTGAG CCTTTCCGCTATCCCGAGCGGCGCGTCCTGCGCGGGGATCACTTCGAAAAGGCTCTGCGGTTGATCCCGGCCAGC ATCAGCGAAGACATGGACTCCCTCAAAATGATCCGCAAATTTGACAAGGAGTTTGGCAGTGGTGAGAAGAAAAAC AAAAAGACGATCGGTTTCGGTGTTTTCGATGCGAAACAGTATGCCGGGCCCAGTGAAGCTAGAGTTCGTCATGGT CCTAACCTTTGA
Transcript	>Hirsu2\|2287 ATGAGGATTCATCCTCTGAGGCCGAGTATTTGGCAGACTGGCGCGGACCCAACACGGTCCCGCAATGGGATCGAG ATTAACGTAGCCTCAGGGGTGACGGACAACCACAGACGTGAAGCACGGGGTCCGAAGCTGAACGAATACGAGAAG CGAATAGCCACCGGACAAATTGACCGCGATAGCCTGCACACAACGTTCGCCGACGTTCACGCCCCCGTTGAGACG ATTTCGACGCTCAAGCTGCTCACCTCACTAGCCCTCGTGCGACCTGACGCGTTCTCGTATGGCGTGCTGGCGCAA GACAAGATCCCGGGCTGTCTTCTATACGGACCGCCCGGAACAGGTAAGACGATGCTTGCCAAGGCTGTCGCCAAA GAGAGCGGTGCGAATATGCTCGAGATTAGCGGCGCCTCAATCAACGATAAGTGGGTAGGTGAGAGCGAGAAACTG ATTCGTGCGGTCTTCACGCTGGCGAAGCGTCTGTCACCCTGTGTCGTCTTCATCGACGAGGCAGATTCACTGCTG GCAAGCCGGAGCATGCTCAGCAACCGGCCTTCTCGCAGGGAACACATCAACCAATTCCTTAAGGAGTGGGATGGC ATAGAGGAGACCAATGCTTTTGTTATGGTGGCCACCAATCGCCCCTTTGATCTCGATGATGCGGTCCTGCGGCGG CTTCCACGCAAGGTTCTCGTCGACCTACCCCTCAAAAGCGATCGCGCTGCCATTCTGAGCTTGCTGCTTAAGGGG GAGAGTCTGGACGACTCCGCCTCCCTCGACGAGTACGCAGAGAGAACGACCTATTACTCCGGCTCAGATCTCAAA AACGTCTGCGTTGCGGCGGCTATGGCTGCCGTAGAAGAAGAGAACGCAGCGGCGGCCAGGCACACCGGCCCTGAG CCTTTCCGCTATCCCGAGCGGCGCGTCCTGCGCGGGGATCACTTCGAAAAGGCTCTGCGGTTGATCCCGGCCAGC ATCAGCGAAGACATGGACTCCCTCAAAATGATCCGCAAATTTGACAAGGAGTTTGGCAGTGGTGAGAAGAAAAAC AAAAAGACGATCGGTTTCGGTGTTTTCGATGCGAAACAGTATGCCGGGCCCAGTGAAGCTAGAGTTCGTCATGGT CCTAACCTTTGA
Gene	>Hirsu2\|2287 ATGAGGATTCATCCTCTGAGGCCGAGTATTTGGCAGACTGGCGCGGACCCAACACGGTCCCGCAATGGGATCGAG ATTAACGTAGCCTCAGGGGTGACGGACAACCACAGACGTGAAGCACGGGGTCCGAAGCTGAACGAATACGAGAAG CGAATAGCCACCGGACAAATTGACCGCGATAGCCTGCACACAACGTTCGCCGACGTTCACGCCCCCGTTGAGACG ATTTCGACGCTCAAGCTGCTCACCTCACTAGCCCTCGTGCGACCTGACGCGTTCTCGTATGGCGTGCTGGCGCAA GACAAGATCCCGGGCTGTCTTCTATACGGACCGCCCGGAACAGGTAAGACGATGCTTGCCAAGGCTGTCGCCAAA GAGAGCGGTGCGAATATGCTCGAGATTAGCGGCGCCTCAATCAACGATAAGTGGGTAGGTGAGAGCGAGAAACTG ATTCGTGCGGTCTTCACGCTGGCGAAGCGTCTGTCACCCTGTGTCGTCTTCATCGACGAGGCAGATTCACTGCTG GCAAGCCGGAGCATGCTCAGCAACCGGCCTTCTCGCAGGGAACACATCAACCAATTCCTTAAGGAGTGGGATGGC ATAGAGGAGACCAATGCTTTTGTTATGGTGGCCACCAATCGCCCCTTTGATCTCGATGATGCGGTCCTGCGGCGG CTTCCACGCAAGGTTCTCGTCGACCTACCCCTCAAAAGCGATCGCGCTGCCATTCTGAGCTTGCTGCTTAAGGGG GAGAGTCTGGACGACTCCGCCTCCCTCGACGAGTACGCAGAGAGAACGACCTATTACTCCGGCTCAGATCTCAAA AACGTCTGCGTTGCGGCGGCTATGGCTGCCGTAGAAGAAGAGAACGCAGCGGCGGCCAGGCACACCGGCCCTGAG CCTTTCCGCTATCCCGAGCGGCGCGTCCTGCGCGGGGATCACTTCGAAAAGGCTCTGCGGTTGATCCCGGCCAGC ATCAGCGAAGACATGGACTCCCTCAAAATGATCCGCAAATTTGACAAGGAGTTTGGCAGTGGTGAGAAGAAAAAC AAAAAGACGATCGGTTTCGGTGTTTTCGATGCGAAACAGTATGCCGGGCCCAGTGAAGCTAGAGTTCGTCATGGT CCTAACCTTTGA

Fungal Genomics

General Properties

Overview

PFAM Domains

Swissprot hits

GO

Deeploc

SignalP

Transmembrane Domains

Transcription Factor Class

CAZymes

Secondary Metabolism

Expression data

Orthologs

Sequences