Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2286
Gene name
LocationContig_1539:411..2486
Strand+
Gene length (bp)2075
Transcript length (bp)1698
Coding sequence length (bp)1698
Protein length (aa) 566

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03909 BSD BSD domain 1.6E-15 110 172
PF03909 BSD BSD domain 6.2E-14 189 244
PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain 1.8E-18 5 76

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P5N7|TFB1_NEUCR Putative RNA polymerase II transcription factor B subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B8B20.390 PE=3 SV=1 6 466 2.0E-143
sp|O13745|TFB1_SCHPO RNA polymerase II transcription factor B subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfb1 PE=1 SV=2 6 388 6.0E-61
sp|P32776|TFB1_YEAST RNA polymerase II transcription factor B subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFB1 PE=1 SV=1 6 323 6.0E-41
sp|Q9P5N7|TFB1_NEUCR Putative RNA polymerase II transcription factor B subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B8B20.390 PE=3 SV=1 469 549 4.0E-13
sp|P32780|TF2H1_HUMAN General transcription factor IIH subunit 1 OS=Homo sapiens GN=GTF2H1 PE=1 SV=1 6 413 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P5N7|TFB1_NEUCR Putative RNA polymerase II transcription factor B subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B8B20.390 PE=3 SV=1 6 466 2.0E-143
sp|O13745|TFB1_SCHPO RNA polymerase II transcription factor B subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfb1 PE=1 SV=2 6 388 6.0E-61
sp|P32776|TFB1_YEAST RNA polymerase II transcription factor B subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFB1 PE=1 SV=1 6 323 6.0E-41
sp|Q9P5N7|TFB1_NEUCR Putative RNA polymerase II transcription factor B subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B8B20.390 PE=3 SV=1 469 549 4.0E-13
sp|P32780|TF2H1_HUMAN General transcription factor IIH subunit 1 OS=Homo sapiens GN=GTF2H1 PE=1 SV=1 6 413 3.0E-10
sp|Q9DBA9|TF2H1_MOUSE General transcription factor IIH subunit 1 OS=Mus musculus GN=Gtf2h1 PE=1 SV=2 6 413 6.0E-09
sp|Q960E8|TF2H1_DROME General transcription factor IIH subunit 1 OS=Drosophila melanogaster GN=Tfb1 PE=2 SV=1 31 241 4.0E-08
sp|Q55FP1|TF2H1_DICDI General transcription factor IIH subunit 1 OS=Dictyostelium discoideum GN=gtf2h1 PE=3 SV=1 124 265 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2286
MATPTVTWTPNVEGPQPIFLPVSGITNLQQTPDSSAKVMLKIFEKAQDGADPVTYLFHFNTSEARNEAKSIKDVL
SRLLADLRSNDGSIPSASMAFSSAVNSQPSARWFDDSRLKTYIELQQSLMKKDKSLHQTYMEAIATKPESISGAA
FNSQFWSTRTNLLRAHAIETNQKRGPYNVLSTVKPRTVDGELKLNISVEQVQMILAQHPLVKRIYNENVPKLSEA
DFWSRFFLSQLFKKLRGERVTESDRPDPFFDKYDMNDNTRGSQSKIMAQSVPHIIDLEANEENQGGFKGGNAKDV
EMRPRANIPIVKTLNSLSEKIMANVAPSDGTVDHGQSDQWQGHGGRYDAYYEVSLRDLRDDDQEHRLMLNVKDKN
NIFSKQDCSPSANTGTFAKQNTADVLSEMRSIMNEAWASNADGSSLLAAVDCDDESDSGDDRQACLRVGCGAAVK
AAEKEVLSGILQQRSQKYERAPELQYLAESLKRSGARIAAVADEAETERESTIRKRKQEIRDHFERTGKKIRWKS
DMVGGGRHAVLKILQPVLDALDMAQGHYATALAVEDAAGA*
Coding >Hirsu2|2286
ATGGCAACTCCGACCGTCACCTGGACACCGAACGTGGAGGGTCCCCAGCCTATCTTCCTTCCAGTTTCCGGAATC
ACCAATCTCCAGCAAACACCCGACAGCTCCGCAAAGGTGATGCTCAAGATTTTCGAGAAAGCTCAAGACGGAGCT
GACCCTGTGACCTATCTCTTCCACTTCAACACCTCGGAGGCTCGGAACGAAGCCAAGTCAATCAAGGACGTTCTT
TCTAGACTATTGGCTGACCTGCGTAGCAACGATGGTAGCATTCCGAGCGCCTCGATGGCTTTCTCCAGCGCCGTA
AACTCGCAGCCGTCGGCACGTTGGTTTGACGACAGTCGACTGAAGACATATATTGAGCTGCAGCAATCCCTCATG
AAGAAAGACAAGAGCCTTCATCAGACGTACATGGAGGCGATCGCTACGAAGCCGGAATCCATATCTGGCGCTGCT
TTCAACTCTCAGTTCTGGTCCACGCGCACCAATCTCCTGCGAGCGCATGCAATAGAAACCAACCAGAAGAGAGGC
CCTTACAACGTGCTGTCGACAGTCAAGCCACGTACCGTAGACGGTGAGCTGAAGCTCAACATCAGCGTGGAGCAG
GTCCAGATGATACTAGCCCAGCATCCGCTCGTGAAGAGAATATACAATGAAAACGTACCGAAACTTTCTGAGGCA
GACTTCTGGTCTCGTTTCTTTCTCAGCCAGCTATTCAAGAAGCTTCGGGGCGAGCGGGTGACGGAGAGCGACCGC
CCCGACCCGTTCTTCGACAAATACGACATGAATGACAACACGCGAGGCTCACAGAGTAAGATTATGGCTCAAAGT
GTTCCGCACATCATCGACCTGGAGGCCAATGAGGAAAATCAAGGTGGTTTCAAAGGAGGAAATGCCAAAGATGTG
GAGATGCGACCCCGTGCGAATATTCCCATCGTGAAAACGCTTAACAGCCTCAGCGAGAAGATCATGGCCAACGTC
GCGCCATCGGATGGGACCGTTGATCATGGACAAAGTGACCAGTGGCAGGGGCATGGGGGACGCTACGACGCATAT
TACGAAGTCTCATTGCGTGACTTGAGAGATGACGACCAAGAACATCGCCTTATGCTAAACGTCAAAGACAAGAAC
AACATCTTTTCCAAGCAGGACTGCTCGCCGTCTGCAAACACGGGTACTTTCGCAAAGCAGAATACAGCTGACGTC
CTGTCCGAGATGAGAAGCATAATGAACGAGGCCTGGGCGAGCAACGCCGATGGCTCCTCTTTGTTAGCGGCAGTT
GACTGCGACGACGAGAGCGACAGCGGTGACGATAGACAGGCGTGCTTGCGCGTCGGCTGTGGGGCAGCCGTCAAA
GCAGCAGAAAAGGAAGTTCTGAGCGGTATCCTCCAGCAGCGGTCACAGAAATACGAACGCGCCCCCGAACTGCAG
TATTTGGCGGAGTCTCTCAAGCGATCGGGCGCACGCATCGCCGCCGTGGCAGATGAGGCCGAGACTGAGAGAGAG
TCTACCATTCGTAAGCGAAAGCAGGAGATTCGAGATCATTTCGAGCGCACGGGTAAGAAGATTCGGTGGAAGTCG
GACATGGTGGGAGGTGGGCGCCACGCCGTGTTGAAGATACTGCAGCCGGTGCTCGATGCACTGGACATGGCCCAA
GGGCATTACGCTACAGCCCTCGCGGTGGAAGACGCAGCCGGAGCATAG
Transcript >Hirsu2|2286
ATGGCAACTCCGACCGTCACCTGGACACCGAACGTGGAGGGTCCCCAGCCTATCTTCCTTCCAGTTTCCGGAATC
ACCAATCTCCAGCAAACACCCGACAGCTCCGCAAAGGTGATGCTCAAGATTTTCGAGAAAGCTCAAGACGGAGCT
GACCCTGTGACCTATCTCTTCCACTTCAACACCTCGGAGGCTCGGAACGAAGCCAAGTCAATCAAGGACGTTCTT
TCTAGACTATTGGCTGACCTGCGTAGCAACGATGGTAGCATTCCGAGCGCCTCGATGGCTTTCTCCAGCGCCGTA
AACTCGCAGCCGTCGGCACGTTGGTTTGACGACAGTCGACTGAAGACATATATTGAGCTGCAGCAATCCCTCATG
AAGAAAGACAAGAGCCTTCATCAGACGTACATGGAGGCGATCGCTACGAAGCCGGAATCCATATCTGGCGCTGCT
TTCAACTCTCAGTTCTGGTCCACGCGCACCAATCTCCTGCGAGCGCATGCAATAGAAACCAACCAGAAGAGAGGC
CCTTACAACGTGCTGTCGACAGTCAAGCCACGTACCGTAGACGGTGAGCTGAAGCTCAACATCAGCGTGGAGCAG
GTCCAGATGATACTAGCCCAGCATCCGCTCGTGAAGAGAATATACAATGAAAACGTACCGAAACTTTCTGAGGCA
GACTTCTGGTCTCGTTTCTTTCTCAGCCAGCTATTCAAGAAGCTTCGGGGCGAGCGGGTGACGGAGAGCGACCGC
CCCGACCCGTTCTTCGACAAATACGACATGAATGACAACACGCGAGGCTCACAGAGTAAGATTATGGCTCAAAGT
GTTCCGCACATCATCGACCTGGAGGCCAATGAGGAAAATCAAGGTGGTTTCAAAGGAGGAAATGCCAAAGATGTG
GAGATGCGACCCCGTGCGAATATTCCCATCGTGAAAACGCTTAACAGCCTCAGCGAGAAGATCATGGCCAACGTC
GCGCCATCGGATGGGACCGTTGATCATGGACAAAGTGACCAGTGGCAGGGGCATGGGGGACGCTACGACGCATAT
TACGAAGTCTCATTGCGTGACTTGAGAGATGACGACCAAGAACATCGCCTTATGCTAAACGTCAAAGACAAGAAC
AACATCTTTTCCAAGCAGGACTGCTCGCCGTCTGCAAACACGGGTACTTTCGCAAAGCAGAATACAGCTGACGTC
CTGTCCGAGATGAGAAGCATAATGAACGAGGCCTGGGCGAGCAACGCCGATGGCTCCTCTTTGTTAGCGGCAGTT
GACTGCGACGACGAGAGCGACAGCGGTGACGATAGACAGGCGTGCTTGCGCGTCGGCTGTGGGGCAGCCGTCAAA
GCAGCAGAAAAGGAAGTTCTGAGCGGTATCCTCCAGCAGCGGTCACAGAAATACGAACGCGCCCCCGAACTGCAG
TATTTGGCGGAGTCTCTCAAGCGATCGGGCGCACGCATCGCCGCCGTGGCAGATGAGGCCGAGACTGAGAGAGAG
TCTACCATTCGTAAGCGAAAGCAGGAGATTCGAGATCATTTCGAGCGCACGGGTAAGAAGATTCGGTGGAAGTCG
GACATGGTGGGAGGTGGGCGCCACGCCGTGTTGAAGATACTGCAGCCGGTGCTCGATGCACTGGACATGGCCCAA
GGGCATTACGCTACAGCCCTCGCGGTGGAAGACGCAGCCGGAGCATAG
Gene >Hirsu2|2286
ATGGCAACTCCGGTCGGGCGCACTCTGTTCAAGAAAAAAGATGGCATTCTCACGTTAACGAGCGACCATCAGACC
GTCACCTGGACACCGAACGTGGAGGGTCCCCAGCCTATCTTCCTTCCAGTTTCCGGAATCACCAGTGCGTTCAAA
TACCAGCTGCTACCTTCTCTTGCATATATTGTGTGTTTAATAACTCGGAACGACCCGCAGATCTCCAGCAAACAC
CCGACAGCTCCGCAAAGGTGATGCTCAAGATTTTCGAGAAAGCTCAAGACGGAGCTGACCCTGTGACCTATCTCT
TCCACTTCAACACCTCGGAGGCTCGGAACGAAGCCAAGTCAATCAAGGACGTTCTTTCTAGACTATTGGCTGACC
TGCGTAGCAACGATGGTAGCATTCCGAGGTCGGCAGTTGGGACACCGTTACCTGCTGGACCCTCAACCCCAATCG
GCAATGGCAGCGCCTCGATGGCTTTCTCCAGCGCCGTAAACTCGCAGCCGTCGGCACGTTGGTTTGACGACAGTC
GACTGAAGACATATATTGAGCTGCAGCAATCCCTCATGAAGAAAGACAAGAGCCTTCATCAGACGTACATGGAGG
CGATCGCTACGAAGCCGGAATCCATATCTGGCGCTGCTTTCAACTCTCAGTTCTGGTCCACGCGCACCAATCTCC
TGCGAGCGCATGCAATAGAAACCAACCAGAAGAGAGGCCCTTACAACGTGCTGTCGACAGTCAAGCCACGTACCG
TAGACGGTGAGCTGAAGCTCAACATCAGCGTGGAGCAGGTCCAGATGATACTAGCCCAGCATCCGCTCGTGAAGA
GAATATACAATGAAAACGTACCGAAACTTTCTGAGGCAGACTTCTGGTCTCGTTTCTTTCTCAGCCAGCTATTCA
AGAAGCTTCGGGGCGAGCGGGTGACGGAGAGCGACCGCCCCGACCCGTTCTTCGACAAATACGACATGAATGACA
ACACGCGAGGCTCACAGAGTAAGATTATGGCTCAAAGTGTTCCGCACATCATCGACCTGGAGGCCAATGAGGAAA
ATCAAGGTGGTTTCAAAGGAGGAAATGCCAAAGATGTGGAGATGCGACCCCGTGCGAATATTCCCATCGTGAAAA
CGCTTAACAGCCTCAGCGAGAAGATCATGGCCAACGTCGCGCCATCGGATGGGACCGTTGATCATGGACAAAGTG
ACCAGTGGCAGGGGCATGGGGGACGCTACGACGCATATTACGAAGTCTCATTGCGTGACTTGAGAGATGACGACC
AAGAACATCGCCTTATGCTAAACGTCAAAGACAAGAACAACATCTTTTCCAAGCAGGACTGCTCGCCGTCTGCAA
ACACGGGTACTTTCGCAAAGCAGAATACAGCTGACGTCCTGTCCGAGATGAGAAGCATAATGAACGAGGCCTGGG
CGAGCAACGCCGATGGCTCCTCTTTGTTAGCGGCAGTTGACTGCGACGACGAGAGCGACAGCGGTGACGATAGAC
AGGCGTGCTTGCGCGTCGGCTGTGGGGCAGCCGTCAAAGCAGCAGAAAAGGAAGTTCTGAGCGGTATCCTCCAGC
AGCGGTCACAGAAATACGGTCAGATTAGCGACGGAACATCCCCAATTGGCCTACCTTCTACAATAGCTGACAAGT
GTGCCCTGACACACGCCACCTGCATCGAGTTCCTCCATCAATTCTGGAATGCTTTTTTGTCGGCTGAGCCAGAAC
GCGCCCCCGAACTGCAGTATTTGGCGGAGTCTCTCAAGCGATCGGGCGCACGCATCGCCGCCGTGGCAGATGAGG
CCGAGACTGAGAGAGAGTCTACCATTCGTAAGCGAAAGCAGGAGATTCGAGATCATTTCGAGCGCACGGGTAAGA
AGATTCGGTGGAAGTCGGACATGGTGGGAGGTGGGCGCCACGCCGTGTTGAAGATACTGCAGCCGGTGCTCGATG
CACTGGACATGGCCCAAGGGCATTACGCTACAGCCCTCGCGGTGGAAGGTATACAAATCTCGACTGAGCACTGAG
CCGGACATACCGCTACCGCGAGGAATATTCTAGACGCAGCCGGAGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail