Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2277
Gene name
LocationContig_1532:1652..5686
Strand-
Gene length (bp)4034
Transcript length (bp)3798
Coding sequence length (bp)3798
Protein length (aa) 1266

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01237 Oxysterol_BP Oxysterol-binding protein 8.3E-132 869 1243
PF12796 Ank_2 Ankyrin repeats (3 copies) 6.1E-09 165 228
PF00023 Ank Ankyrin repeat 4.8E-05 201 228
PF00023 Ank Ankyrin repeat 1.3E-03 311 339
PF13637 Ank_4 Ankyrin repeats (many copies) 4.2E-07 168 222
PF13857 Ank_5 Ankyrin repeats (many copies) 1.4E-06 193 243
PF13606 Ank_3 Ankyrin repeat 4.4E-04 201 228
PF00169 PH PH domain 2.3E-11 401 493
PF15409 PH_8 Pleckstrin homology domain 9.1E-08 406 491

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.05c PE=1 SV=2 843 1264 6.0E-154
sp|Q12451|OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH2 PE=1 SV=1 846 1245 4.0E-146
sp|P35845|OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWH1 PE=1 SV=4 549 1246 2.0E-140
sp|Q9BZF3|OSBL6_HUMAN Oxysterol-binding protein-related protein 6 OS=Homo sapiens GN=OSBPL6 PE=1 SV=1 407 1254 3.0E-80
sp|Q8S8P9|ORP1B_ARATH Oxysterol-binding protein-related protein 1B OS=Arabidopsis thaliana GN=ORP1B PE=2 SV=1 855 1246 7.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.05c PE=1 SV=2 843 1264 6.0E-154
sp|Q12451|OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH2 PE=1 SV=1 846 1245 4.0E-146
sp|P35845|OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWH1 PE=1 SV=4 549 1246 2.0E-140
sp|Q9BZF3|OSBL6_HUMAN Oxysterol-binding protein-related protein 6 OS=Homo sapiens GN=OSBPL6 PE=1 SV=1 407 1254 3.0E-80
sp|Q8S8P9|ORP1B_ARATH Oxysterol-binding protein-related protein 1B OS=Arabidopsis thaliana GN=ORP1B PE=2 SV=1 855 1246 7.0E-80
sp|Q8BXR9|OSBL6_MOUSE Oxysterol-binding protein-related protein 6 OS=Mus musculus GN=Osbpl6 PE=1 SV=1 849 1254 1.0E-78
sp|Q8L751|ORP1C_ARATH Oxysterol-binding protein-related protein 1C OS=Arabidopsis thaliana GN=ORP1C PE=2 SV=1 868 1264 1.0E-76
sp|O80866|ORP1A_ARATH Oxysterol-binding protein-related protein 1A OS=Arabidopsis thaliana GN=ORP1A PE=2 SV=1 855 1264 1.0E-76
sp|Q9SAF0|ORP1D_ARATH Oxysterol-binding protein-related protein 1D OS=Arabidopsis thaliana GN=ORP1D PE=2 SV=1 868 1247 4.0E-75
sp|Q9SU36|ORP2B_ARATH Oxysterol-binding protein-related protein 2B OS=Arabidopsis thaliana GN=ORP2B PE=2 SV=2 855 1264 1.0E-74
sp|Q9DBS9|OSBL3_MOUSE Oxysterol-binding protein-related protein 3 OS=Mus musculus GN=Osbpl3 PE=1 SV=2 868 1254 2.0E-74
sp|Q940Y1|ORP2A_ARATH Oxysterol-binding protein-related protein 2A OS=Arabidopsis thaliana GN=ORP2A PE=2 SV=1 669 1245 3.0E-74
sp|Q9H4L5|OSBL3_HUMAN Oxysterol-binding protein-related protein 3 OS=Homo sapiens GN=OSBPL3 PE=1 SV=1 868 1254 9.0E-74
sp|P22059|OSBP1_HUMAN Oxysterol-binding protein 1 OS=Homo sapiens GN=OSBP PE=1 SV=1 608 1264 5.0E-73
sp|Q9BZF2|OSBL7_HUMAN Oxysterol-binding protein-related protein 7 OS=Homo sapiens GN=OSBPL7 PE=2 SV=1 868 1256 1.0E-72
sp|Q3B7Z2|OSBP1_MOUSE Oxysterol-binding protein 1 OS=Mus musculus GN=Osbp PE=1 SV=3 608 1264 1.0E-72
sp|P16258|OSBP1_RABIT Oxysterol-binding protein 1 OS=Oryctolagus cuniculus GN=OSBP PE=1 SV=1 608 1247 2.0E-71
sp|Q91XL9|OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus GN=Osbpl1a PE=1 SV=2 799 1244 5.0E-71
sp|Q8K4M9|OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 799 1244 6.0E-70
sp|Q969R2|OSBP2_HUMAN Oxysterol-binding protein 2 OS=Homo sapiens GN=OSBP2 PE=1 SV=2 810 1247 7.0E-70
sp|Q5QNQ6|OSBP2_MOUSE Oxysterol-binding protein 2 OS=Mus musculus GN=Osbp2 PE=1 SV=1 667 1247 1.0E-69
sp|Q9BXW6|OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens GN=OSBPL1A PE=1 SV=2 852 1244 3.0E-67
sp|Q8BX94|OSBL2_MOUSE Oxysterol-binding protein-related protein 2 OS=Mus musculus GN=Osbpl2 PE=1 SV=1 808 1244 7.0E-67
sp|Q9H1P3|OSBL2_HUMAN Oxysterol-binding protein-related protein 2 OS=Homo sapiens GN=OSBPL2 PE=1 SV=1 808 1244 3.0E-65
sp|P35845|OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWH1 PE=1 SV=4 163 499 3.0E-62
sp|Q54QP6|OSB8_DICDI Oxysterol-binding protein 8 OS=Dictyostelium discoideum GN=osbH PE=1 SV=1 874 1246 1.0E-61
sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.05c PE=1 SV=2 108 494 3.0E-60
sp|Q9SR33|ORP3B_ARATH Oxysterol-binding protein-related protein 3B OS=Arabidopsis thaliana GN=ORP3B PE=2 SV=1 871 1254 2.0E-59
sp|Q54ID7|OSB11_DICDI Oxysterol-binding protein 11 OS=Dictyostelium discoideum GN=osbK PE=3 SV=1 861 1247 2.0E-59
sp|Q93Y40|ORP3C_ARATH Oxysterol-binding protein-related protein 3C OS=Arabidopsis thaliana GN=ORP3C PE=2 SV=1 840 1248 2.0E-58
sp|Q9LZM1|ORP3A_ARATH Oxysterol-binding protein-related protein 3A OS=Arabidopsis thaliana GN=ORP3A PE=1 SV=1 871 1253 5.0E-56
sp|O13944|YEH1_SCHPO Oxysterol-binding protein homolog C23H4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H4.01c PE=1 SV=2 857 1257 2.0E-52
sp|Q12451|OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH2 PE=1 SV=1 169 554 7.0E-49
sp|P38713|OSH3_YEAST Oxysterol-binding protein homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH3 PE=1 SV=1 869 1257 1.0E-42
sp|B9EJ86|OSBL8_MOUSE Oxysterol-binding protein-related protein 8 OS=Mus musculus GN=Osbpl8 PE=1 SV=1 870 1238 8.0E-22
sp|Q9BZF1|OSBL8_HUMAN Oxysterol-binding protein-related protein 8 OS=Homo sapiens GN=OSBPL8 PE=1 SV=3 870 1237 9.0E-22
sp|Q9ER64|OSBL5_MOUSE Oxysterol-binding protein-related protein 5 OS=Mus musculus GN=Osbpl5 PE=1 SV=3 867 1222 8.0E-21
sp|Q02201|OSH6_YEAST Oxysterol-binding protein homolog 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH6 PE=1 SV=1 879 1226 2.0E-20
sp|Q9H0X9|OSBL5_HUMAN Oxysterol-binding protein-related protein 5 OS=Homo sapiens GN=OSBPL5 PE=1 SV=1 867 1222 4.0E-19
sp|Q9ERS4|PKHA3_MOUSE Pleckstrin homology domain-containing family A member 3 OS=Mus musculus GN=Plekha3 PE=2 SV=1 402 520 1.0E-18
sp|Q9HB20|PKHA3_HUMAN Pleckstrin homology domain-containing family A member 3 OS=Homo sapiens GN=PLEKHA3 PE=1 SV=2 402 520 1.0E-18
sp|S4R1M9|OSB10_MOUSE Oxysterol-binding protein-related protein 10 OS=Mus musculus GN=Osbpl10 PE=1 SV=1 863 1222 1.0E-17
sp|Q86KG4|OSB4_DICDI Oxysterol-binding protein 4 OS=Dictyostelium discoideum GN=osbD PE=3 SV=2 863 1225 2.0E-17
sp|Q9BXB5|OSB10_HUMAN Oxysterol-binding protein-related protein 10 OS=Homo sapiens GN=OSBPL10 PE=1 SV=2 863 1222 2.0E-17
sp|Q9UUA1|YJX1_SCHPO Oxysterol-binding protein homolog C23B6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.01c PE=1 SV=2 861 1234 3.0E-16
sp|P38755|OSH7_YEAST Oxysterol-binding protein homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH7 PE=1 SV=1 879 1105 4.0E-16
sp|Q5U3N0|PKHA8_DANRE Pleckstrin homology domain-containing family A member 8 OS=Danio rerio GN=plekha8 PE=2 SV=1 402 520 5.0E-16
sp|D3ZY60|PKHA8_RAT Pleckstrin homology domain-containing family A member 8 OS=Rattus norvegicus GN=Plekha8 PE=1 SV=1 402 520 6.0E-16
sp|F1MS15|PKHA8_BOVIN Pleckstrin homology domain-containing family A member 8 OS=Bos taurus GN=PLEKHA8 PE=3 SV=2 402 520 7.0E-16
sp|Q80W71|PKHA8_MOUSE Pleckstrin homology domain-containing family A member 8 OS=Mus musculus GN=Plekha8 PE=1 SV=2 402 520 7.0E-16
sp|Q96JA3|PKHA8_HUMAN Pleckstrin homology domain-containing family A member 8 OS=Homo sapiens GN=PLEKHA8 PE=1 SV=3 402 520 1.0E-15
sp|D2KC46|PKHA8_CANLF Pleckstrin homology domain-containing family A member 8 OS=Canis lupus familiaris GN=PLEKHA8 PE=1 SV=2 402 520 1.0E-15
sp|Q9UW21|OBPAL_CANAL Oxysterol-binding protein-like protein OBPalpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPALPHA PE=3 SV=1 872 1222 2.0E-15
sp|P16258|OSBP1_RABIT Oxysterol-binding protein 1 OS=Oryctolagus cuniculus GN=OSBP PE=1 SV=1 399 556 2.0E-15
sp|Q969R2|OSBP2_HUMAN Oxysterol-binding protein 2 OS=Homo sapiens GN=OSBP2 PE=1 SV=2 372 489 2.0E-15
sp|P22059|OSBP1_HUMAN Oxysterol-binding protein 1 OS=Homo sapiens GN=OSBP PE=1 SV=1 403 556 3.0E-15
sp|Q3B7Z2|OSBP1_MOUSE Oxysterol-binding protein 1 OS=Mus musculus GN=Osbp PE=1 SV=3 403 489 6.0E-15
sp|Q9UW25|OBPA_CANAL Oxysterol-binding protein-like protein OBPa OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPA PE=3 SV=1 861 1124 1.0E-14
sp|Q54PS9|OSB9_DICDI Oxysterol-binding protein 9 OS=Dictyostelium discoideum GN=osbI PE=3 SV=1 870 980 3.0E-14
sp|Q96SU4|OSBL9_HUMAN Oxysterol-binding protein-related protein 9 OS=Homo sapiens GN=OSBPL9 PE=1 SV=2 878 1213 3.0E-14
sp|A2A8Z1|OSBL9_MOUSE Oxysterol-binding protein-related protein 9 OS=Mus musculus GN=Osbpl9 PE=1 SV=1 878 1213 4.0E-14
sp|Q5R9W4|OSBL9_PONAB Oxysterol-binding protein-related protein 9 OS=Pongo abelii GN=OSBPL9 PE=2 SV=1 878 1213 6.0E-14
sp|Q5QNQ6|OSBP2_MOUSE Oxysterol-binding protein 2 OS=Mus musculus GN=Osbp2 PE=1 SV=1 384 489 6.0E-14
sp|P0C199|KES1_USTMA Protein KES1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=KES1 PE=3 SV=1 871 1098 9.0E-14
sp|Q0IJ05|OSBL9_XENTR Oxysterol-binding protein-related protein 9 OS=Xenopus tropicalis GN=osbpl9 PE=2 SV=1 878 1213 3.0E-13
sp|Q9BXB4|OSB11_HUMAN Oxysterol-binding protein-related protein 11 OS=Homo sapiens GN=OSBPL11 PE=1 SV=2 878 1224 5.0E-13
sp|Q54NM4|OSB10_DICDI Oxysterol-binding protein 10 OS=Dictyostelium discoideum GN=osbJ PE=3 SV=1 861 1070 2.0E-11
sp|Q8K4M9|OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 168 437 3.0E-10
sp|Q91XL9|OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus GN=Osbpl1a PE=1 SV=2 168 519 5.0E-10
sp|Q9SVZ9|ORP4A_ARATH Oxysterol-binding protein-related protein 4A OS=Arabidopsis thaliana GN=ORP4A PE=2 SV=2 879 1226 1.0E-09
sp|Q9BXW6|OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens GN=OSBPL1A PE=1 SV=2 168 437 3.0E-09
sp|Q6P3Q6|C43BP_XENTR Collagen type IV alpha-3-binding protein OS=Xenopus tropicalis GN=col4a3bp PE=2 SV=1 404 486 3.0E-09
sp|Q5M7Y0|C43BP_DANRE Collagen type IV alpha-3-binding protein OS=Danio rerio GN=col4a3bp PE=1 SV=2 385 486 5.0E-09
sp|Q5R6M6|C43BP_PONAB Collagen type IV alpha-3-binding protein OS=Pongo abelii GN=COL4A3BP PE=2 SV=1 404 489 1.0E-08
sp|Q6VVX2|C43BP_CRIGR Collagen type IV alpha-3-binding protein OS=Cricetulus griseus GN=COL4A3BP PE=1 SV=1 404 489 1.0E-08
sp|Q9EQG9|C43BP_MOUSE Collagen type IV alpha-3-binding protein OS=Mus musculus GN=Col4a3bp PE=1 SV=1 404 489 1.0E-08
sp|Q9GKI7|C43BP_BOVIN Collagen type IV alpha-3-binding protein OS=Bos taurus GN=COL4A3BP PE=2 SV=1 404 489 1.0E-08
sp|Q9Y5P4|C43BP_HUMAN Collagen type IV alpha-3-binding protein OS=Homo sapiens GN=COL4A3BP PE=1 SV=1 404 489 1.0E-08
sp|Q9SW00|ORP4B_ARATH Oxysterol-binding protein-related protein 4B OS=Arabidopsis thaliana GN=ORP4B PE=2 SV=2 852 1222 2.0E-08
sp|Q6NRZ4|C43BP_XENLA Collagen type IV alpha-3-binding protein OS=Xenopus laevis GN=col4a3bp PE=2 SV=1 404 486 6.0E-08
sp|O43021|YGV7_SCHPO Oxysterol-binding protein homolog C354.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.07c PE=3 SV=4 869 1222 8.0E-08
sp|O74178|KES1_SCHPO Protein kes1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kes1 PE=2 SV=2 873 1222 1.0E-07
sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 130 358 3.0E-07
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 181 353 6.0E-07
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 181 353 9.0E-07
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 181 426 9.0E-07
sp|Q9BZL4|PP12C_HUMAN Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens GN=PPP1R12C PE=1 SV=1 165 345 1.0E-06
sp|Q1RJR6|Y317_RICBR Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 194 331 1.0E-06
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 170 367 1.0E-06
sp|Q9SAF0|ORP1D_ARATH Oxysterol-binding protein-related protein 1D OS=Arabidopsis thaliana GN=ORP1D PE=2 SV=1 402 477 2.0E-06
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 195 371 2.0E-06
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 170 343 4.0E-06
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 166 370 4.0E-06
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 110 367 5.0E-06
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 170 345 7.0E-06
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 165 285 8.0E-06
sp|Q559T8|Y0701_DICDI Probable serine/threonine-protein kinase DDB_G0272282 OS=Dictyostelium discoideum GN=DDB_G0272282 PE=3 SV=1 404 526 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2277
MSDAADSPHRRSMSAAALSLLRRKDTREEESGSEDGRVASAPPPLPTPRHPASSSASVASQQGLARSHGHGHGHG
HTSKHSTASNMLGRTPSNPSPATPTKPSAVQERTASLEQSVRKFRAVEALRSGDTASISRAIRESADNGRRFSTS
SASTLGLGTGPGPLDDTTILHLAIQCAEFAVIEYVLSDGIGLIDINGRDKDGNTPLHLAATHGRTHAVKLLLEQK
DINDAIANQHGQLPIDLARNPEIFQLLQLSRSLFAEAKVKQVQDLIARKDYDTLAHVLEEPRLKTVLDINSPEFA
SEPATVQAGGTLLHEAARKKNTQLIQVLLLHGADPFRRDRKGKLPQAVTGDDGVKAILKKSPAAVAAQRGIQEKA
VLGHAAAQGSSSAAPGDLMAGREAREIKGYLKKWTNYRKGYQLRWFVLEDGVLSYYKHQDDAGSACRGAINMKIA
KLHMSADEKTKFEIIGKSSVKYTLKANHEVEAKRWFWALNNSIQWTKDQAKEEERQAARSAELLKQAKAEQGSSL
SVHESHSESTSLSDLPRSPSQAPSRSLSTSNARPHRRASTVGSIDDDDMVDGATEAGASSRAPAHHHHHHRGQHM
SADHDDDDDDDACDDRSMSEESGATKDALNITAQSAKLQLETMSSVHSALLGELSQSPATPLSDTKVTQALSTYD
ASIRSLTGLVGDLLRISRDRDAYWQYRLDRESNMRRMWEESMQQVAREQEELEARVGEAESKRRLTKKALREMME
GGAGGAAAAVTSSNTPTTEKLQAEVEAEAKPPSRNLERKATALDQLGELSESDSDDGDEFFDAVDAGQVEVAEIP
TGESQRETEGVVVSGVDISSSFKGYENGIRHRLKMDADDRPKVSLWGILKSMIGKDMTKMTLPVSFNEPTSLLYR
CGEDMEYADLLDLAVERADPIERLIYVAAFAASEYASTIGRVAKPFNPLLGETFEYVRPDKNYRFFIEQVSHHPP
VGAAWAESPHWTYWGESAVRSKFYGKSFDINPLGTWFLKLRPKAGGREDLYTWKKVTSSVIGIITGSPTVDNYGP
MEIKNWTTGEVALLEFKPRGWKASSAYHLSGKILDAQGNVRFSLGGRWNSKLYARLTPGYEANVEEPKESRPVER
GGGLTDPSRAYLVWEANERPAGIPFNLTPFVLTFNHIDDQLRPWLAPTDSRLRPDQRAMEDGEYDFAAEEKNRLE
ESQRARRREREARGEDFSPAWFSKTRCEVTGEEYWKFNGKYWEQRERAGPSGDDRAWAGLEPIFS*
Coding >Hirsu2|2277
ATGTCGGATGCTGCCGACAGCCCGCACAGGCGGTCCATGTCCGCCGCCGCCCTCTCGCTGCTCCGCCGCAAAGAC
ACGCGCGAGGAGGAATCCGGCTCCGAAGACGGCCGGGTCGCGTCCGCGCCGCCGCCGCTGCCCACGCCCCGCCAT
CCCGCCAGCTCCAGCGCCAGCGTGGCCTCCCAGCAGGGCCTCGCCCGCAGCCACGGCCACGGCCACGGCCACGGC
CACACCTCGAAGCACTCGACAGCCTCCAACATGCTCGGCCGCACCCCGTCCAACCCGTCCCCGGCCACGCCCACC
AAGCCGTCCGCCGTCCAGGAGAGGACGGCCAGCCTGGAGCAGTCGGTCCGCAAGTTCAGGGCCGTCGAGGCCCTG
CGCAGCGGCGACACCGCCTCCATCTCCAGGGCCATCCGCGAGAGCGCCGACAACGGCCGCCGCTTCAGCACCTCG
TCCGCCTCCACCCTCGGCCTCGGCACCGGCCCCGGCCCGCTAGACGACACCACCATCCTGCACCTGGCCATCCAG
TGCGCCGAGTTCGCCGTCATCGAATACGTCCTGTCCGACGGCATCGGCCTCATCGACATCAACGGCCGCGACAAG
GACGGCAACACGCCCCTGCACCTTGCCGCCACCCACGGCCGCACCCACGCCGTCAAGCTCCTCCTCGAGCAAAAG
GACATCAACGACGCCATCGCCAACCAGCACGGCCAGCTGCCCATCGACCTGGCCCGCAACCCCGAAATCTTCCAG
CTCCTGCAGCTGTCCCGCTCCCTGTTCGCCGAGGCCAAGGTCAAGCAGGTCCAGGATCTCATCGCCAGGAAAGAC
TACGACACCCTCGCCCACGTCCTGGAGGAGCCCCGCCTCAAGACGGTGCTCGACATCAACAGCCCCGAGTTCGCG
TCCGAGCCGGCCACCGTCCAGGCCGGCGGCACCCTGCTCCACGAGGCCGCCCGCAAGAAGAACACGCAGCTCATC
CAGGTCCTGCTCCTGCACGGCGCCGACCCCTTCCGTCGCGACCGAAAGGGGAAGCTCCCCCAGGCCGTCACCGGC
GATGACGGCGTCAAGGCCATCCTTAAGAAGTCGCCCGCCGCCGTCGCGGCCCAGAGGGGCATCCAGGAGAAGGCC
GTCCTCGGACACGCCGCCGCGCAGGGCAGCTCCTCGGCCGCGCCCGGCGACCTCATGGCCGGCAGGGAGGCGCGC
GAGATCAAGGGCTACCTCAAGAAGTGGACAAACTACCGCAAGGGATACCAGCTGCGCTGGTTCGTGCTCGAGGAC
GGCGTCCTGAGCTACTACAAGCACCAGGACGACGCCGGCTCGGCCTGTCGAGGCGCCATCAACATGAAGATTGCC
AAGCTGCACATGAGCGCCGACGAGAAGACAAAGTTTGAGATCATCGGCAAGTCGTCCGTCAAGTACACCCTCAAG
GCCAACCACGAGGTCGAGGCCAAGCGCTGGTTCTGGGCCCTCAACAACTCCATCCAGTGGACCAAGGACCAGGCC
AAGGAGGAGGAGCGCCAGGCCGCCCGCAGCGCCGAGCTGCTCAAGCAGGCCAAGGCGGAACAGGGCAGCTCGCTG
TCCGTCCACGAGTCGCACAGCGAGAGCACCAGCCTGTCCGACCTCCCGAGGAGCCCGTCGCAGGCGCCGAGCCGC
TCCCTGTCGACGTCAAATGCCCGTCCGCACAGGCGCGCCAGCACCGTGGGCAGCATCGACGACGACGACATGGTC
GACGGCGCCACCGAGGCCGGGGCCTCTTCCAGGGCACCGGCGCACCACCACCACCACCACCGCGGGCAGCACATG
TCGGCGGACCACGACGACGACGACGACGACGACGCCTGCGACGACCGGAGCATGTCCGAGGAGTCCGGGGCTACT
AAGGATGCGCTCAACATCACGGCGCAGTCGGCCAAGCTGCAGCTGGAAACGATGTCGAGCGTCCACTCGGCTTTG
CTTGGCGAGCTCTCGCAGAGCCCCGCGACGCCCCTGTCGGACACCAAGGTGACCCAGGCCCTGTCGACCTACGAC
GCCTCCATCCGCAGCCTGACCGGCCTCGTCGGGGACCTCCTCCGCATCTCGAGAGATCGCGATGCCTACTGGCAG
TATCGCCTGGACCGCGAGTCGAACATGCGGCGGATGTGGGAGGAGAGCATGCAGCAGGTGGCGCGCGAGCAGGAG
GAGCTGGAGGCCCGCGTCGGCGAGGCCGAGTCGAAACGGCGCCTGACCAAGAAGGCGCTGCGGGAGATGATGGAG
GGCGGCGCCGGCGGGGCCGCCGCCGCCGTGACGTCGAGCAACACACCGACAACGGAAAAGCTGCAGGCCGAGGTG
GAGGCGGAAGCCAAGCCGCCGTCGCGGAACCTGGAACGCAAGGCGACGGCGCTCGACCAGCTCGGGGAGCTCTCG
GAGAGCGACTCGGACGACGGCGATGAGTTTTTCGACGCCGTGGACGCCGGCCAAGTCGAGGTGGCCGAGATCCCG
ACGGGCGAGAGCCAGCGGGAGACGGAGGGCGTCGTCGTTTCGGGCGTCGACATCAGCTCGTCGTTCAAAGGATAC
GAGAACGGCATCAGACACCGGCTCAAGATGGACGCCGACGACCGCCCGAAGGTGTCCCTATGGGGCATCTTGAAA
TCCATGATCGGCAAGGACATGACCAAGATGACGCTGCCCGTGTCCTTCAACGAGCCGACGTCGCTGCTGTACCGC
TGCGGCGAGGACATGGAGTACGCGGACCTGCTGGACCTGGCCGTGGAGCGGGCCGACCCGATCGAGCGGCTCATC
TACGTGGCGGCGTTTGCGGCGAGCGAGTACGCGTCGACGATCGGGCGCGTGGCCAAGCCCTTCAACCCGCTGCTG
GGCGAGACGTTCGAGTACGTGCGGCCGGACAAGAACTACCGCTTCTTCATCGAGCAGGTCAGCCACCACCCGCCG
GTGGGCGCGGCCTGGGCCGAGTCGCCGCACTGGACGTACTGGGGCGAGTCGGCGGTGCGGTCCAAGTTTTACGGC
AAGTCGTTCGACATCAACCCGCTCGGCACCTGGTTCCTCAAGCTCAGGCCCAAGGCGGGCGGGCGGGAGGACCTG
TACACGTGGAAGAAGGTGACGTCGTCGGTCATCGGCATCATCACGGGCAGCCCGACGGTGGACAACTACGGGCCG
ATGGAGATCAAGAACTGGACGACGGGCGAGGTGGCGCTGCTCGAGTTCAAGCCGCGGGGCTGGAAGGCGTCGAGC
GCGTACCACCTGTCGGGCAAGATCCTGGACGCGCAGGGCAACGTGCGCTTCAGCCTGGGCGGGCGGTGGAACTCG
AAGCTGTACGCGCGGCTGACGCCCGGGTACGAGGCCAACGTGGAGGAGCCCAAGGAGAGCCGGCCGGTGGAGCGG
GGCGGGGGCCTGACGGACCCGAGCCGGGCGTACCTGGTGTGGGAGGCCAACGAGCGGCCGGCGGGGATCCCGTTC
AACCTGACGCCCTTTGTGCTGACCTTTAACCACATCGACGACCAGCTGCGGCCGTGGCTGGCGCCGACGGACTCG
CGGCTGCGGCCGGACCAGCGGGCCATGGAGGACGGCGAGTACGACTTCGCGGCCGAGGAGAAGAACCGGCTGGAG
GAGAGCCAGCGGGCGCGGCGGAGGGAGCGGGAGGCGCGAGGCGAGGACTTTTCGCCGGCCTGGTTCAGCAAGACG
AGGTGCGAGGTGACGGGCGAGGAGTACTGGAAGTTCAACGGCAAGTACTGGGAGCAGCGGGAGCGGGCGGGGCCG
AGCGGAGACGACCGTGCATGGGCCGGACTGGAGCCCATCTTCTCGTGA
Transcript >Hirsu2|2277
ATGTCGGATGCTGCCGACAGCCCGCACAGGCGGTCCATGTCCGCCGCCGCCCTCTCGCTGCTCCGCCGCAAAGAC
ACGCGCGAGGAGGAATCCGGCTCCGAAGACGGCCGGGTCGCGTCCGCGCCGCCGCCGCTGCCCACGCCCCGCCAT
CCCGCCAGCTCCAGCGCCAGCGTGGCCTCCCAGCAGGGCCTCGCCCGCAGCCACGGCCACGGCCACGGCCACGGC
CACACCTCGAAGCACTCGACAGCCTCCAACATGCTCGGCCGCACCCCGTCCAACCCGTCCCCGGCCACGCCCACC
AAGCCGTCCGCCGTCCAGGAGAGGACGGCCAGCCTGGAGCAGTCGGTCCGCAAGTTCAGGGCCGTCGAGGCCCTG
CGCAGCGGCGACACCGCCTCCATCTCCAGGGCCATCCGCGAGAGCGCCGACAACGGCCGCCGCTTCAGCACCTCG
TCCGCCTCCACCCTCGGCCTCGGCACCGGCCCCGGCCCGCTAGACGACACCACCATCCTGCACCTGGCCATCCAG
TGCGCCGAGTTCGCCGTCATCGAATACGTCCTGTCCGACGGCATCGGCCTCATCGACATCAACGGCCGCGACAAG
GACGGCAACACGCCCCTGCACCTTGCCGCCACCCACGGCCGCACCCACGCCGTCAAGCTCCTCCTCGAGCAAAAG
GACATCAACGACGCCATCGCCAACCAGCACGGCCAGCTGCCCATCGACCTGGCCCGCAACCCCGAAATCTTCCAG
CTCCTGCAGCTGTCCCGCTCCCTGTTCGCCGAGGCCAAGGTCAAGCAGGTCCAGGATCTCATCGCCAGGAAAGAC
TACGACACCCTCGCCCACGTCCTGGAGGAGCCCCGCCTCAAGACGGTGCTCGACATCAACAGCCCCGAGTTCGCG
TCCGAGCCGGCCACCGTCCAGGCCGGCGGCACCCTGCTCCACGAGGCCGCCCGCAAGAAGAACACGCAGCTCATC
CAGGTCCTGCTCCTGCACGGCGCCGACCCCTTCCGTCGCGACCGAAAGGGGAAGCTCCCCCAGGCCGTCACCGGC
GATGACGGCGTCAAGGCCATCCTTAAGAAGTCGCCCGCCGCCGTCGCGGCCCAGAGGGGCATCCAGGAGAAGGCC
GTCCTCGGACACGCCGCCGCGCAGGGCAGCTCCTCGGCCGCGCCCGGCGACCTCATGGCCGGCAGGGAGGCGCGC
GAGATCAAGGGCTACCTCAAGAAGTGGACAAACTACCGCAAGGGATACCAGCTGCGCTGGTTCGTGCTCGAGGAC
GGCGTCCTGAGCTACTACAAGCACCAGGACGACGCCGGCTCGGCCTGTCGAGGCGCCATCAACATGAAGATTGCC
AAGCTGCACATGAGCGCCGACGAGAAGACAAAGTTTGAGATCATCGGCAAGTCGTCCGTCAAGTACACCCTCAAG
GCCAACCACGAGGTCGAGGCCAAGCGCTGGTTCTGGGCCCTCAACAACTCCATCCAGTGGACCAAGGACCAGGCC
AAGGAGGAGGAGCGCCAGGCCGCCCGCAGCGCCGAGCTGCTCAAGCAGGCCAAGGCGGAACAGGGCAGCTCGCTG
TCCGTCCACGAGTCGCACAGCGAGAGCACCAGCCTGTCCGACCTCCCGAGGAGCCCGTCGCAGGCGCCGAGCCGC
TCCCTGTCGACGTCAAATGCCCGTCCGCACAGGCGCGCCAGCACCGTGGGCAGCATCGACGACGACGACATGGTC
GACGGCGCCACCGAGGCCGGGGCCTCTTCCAGGGCACCGGCGCACCACCACCACCACCACCGCGGGCAGCACATG
TCGGCGGACCACGACGACGACGACGACGACGACGCCTGCGACGACCGGAGCATGTCCGAGGAGTCCGGGGCTACT
AAGGATGCGCTCAACATCACGGCGCAGTCGGCCAAGCTGCAGCTGGAAACGATGTCGAGCGTCCACTCGGCTTTG
CTTGGCGAGCTCTCGCAGAGCCCCGCGACGCCCCTGTCGGACACCAAGGTGACCCAGGCCCTGTCGACCTACGAC
GCCTCCATCCGCAGCCTGACCGGCCTCGTCGGGGACCTCCTCCGCATCTCGAGAGATCGCGATGCCTACTGGCAG
TATCGCCTGGACCGCGAGTCGAACATGCGGCGGATGTGGGAGGAGAGCATGCAGCAGGTGGCGCGCGAGCAGGAG
GAGCTGGAGGCCCGCGTCGGCGAGGCCGAGTCGAAACGGCGCCTGACCAAGAAGGCGCTGCGGGAGATGATGGAG
GGCGGCGCCGGCGGGGCCGCCGCCGCCGTGACGTCGAGCAACACACCGACAACGGAAAAGCTGCAGGCCGAGGTG
GAGGCGGAAGCCAAGCCGCCGTCGCGGAACCTGGAACGCAAGGCGACGGCGCTCGACCAGCTCGGGGAGCTCTCG
GAGAGCGACTCGGACGACGGCGATGAGTTTTTCGACGCCGTGGACGCCGGCCAAGTCGAGGTGGCCGAGATCCCG
ACGGGCGAGAGCCAGCGGGAGACGGAGGGCGTCGTCGTTTCGGGCGTCGACATCAGCTCGTCGTTCAAAGGATAC
GAGAACGGCATCAGACACCGGCTCAAGATGGACGCCGACGACCGCCCGAAGGTGTCCCTATGGGGCATCTTGAAA
TCCATGATCGGCAAGGACATGACCAAGATGACGCTGCCCGTGTCCTTCAACGAGCCGACGTCGCTGCTGTACCGC
TGCGGCGAGGACATGGAGTACGCGGACCTGCTGGACCTGGCCGTGGAGCGGGCCGACCCGATCGAGCGGCTCATC
TACGTGGCGGCGTTTGCGGCGAGCGAGTACGCGTCGACGATCGGGCGCGTGGCCAAGCCCTTCAACCCGCTGCTG
GGCGAGACGTTCGAGTACGTGCGGCCGGACAAGAACTACCGCTTCTTCATCGAGCAGGTCAGCCACCACCCGCCG
GTGGGCGCGGCCTGGGCCGAGTCGCCGCACTGGACGTACTGGGGCGAGTCGGCGGTGCGGTCCAAGTTTTACGGC
AAGTCGTTCGACATCAACCCGCTCGGCACCTGGTTCCTCAAGCTCAGGCCCAAGGCGGGCGGGCGGGAGGACCTG
TACACGTGGAAGAAGGTGACGTCGTCGGTCATCGGCATCATCACGGGCAGCCCGACGGTGGACAACTACGGGCCG
ATGGAGATCAAGAACTGGACGACGGGCGAGGTGGCGCTGCTCGAGTTCAAGCCGCGGGGCTGGAAGGCGTCGAGC
GCGTACCACCTGTCGGGCAAGATCCTGGACGCGCAGGGCAACGTGCGCTTCAGCCTGGGCGGGCGGTGGAACTCG
AAGCTGTACGCGCGGCTGACGCCCGGGTACGAGGCCAACGTGGAGGAGCCCAAGGAGAGCCGGCCGGTGGAGCGG
GGCGGGGGCCTGACGGACCCGAGCCGGGCGTACCTGGTGTGGGAGGCCAACGAGCGGCCGGCGGGGATCCCGTTC
AACCTGACGCCCTTTGTGCTGACCTTTAACCACATCGACGACCAGCTGCGGCCGTGGCTGGCGCCGACGGACTCG
CGGCTGCGGCCGGACCAGCGGGCCATGGAGGACGGCGAGTACGACTTCGCGGCCGAGGAGAAGAACCGGCTGGAG
GAGAGCCAGCGGGCGCGGCGGAGGGAGCGGGAGGCGCGAGGCGAGGACTTTTCGCCGGCCTGGTTCAGCAAGACG
AGGTGCGAGGTGACGGGCGAGGAGTACTGGAAGTTCAACGGCAAGTACTGGGAGCAGCGGGAGCGGGCGGGGCCG
AGCGGAGACGACCGTGCATGGGCCGGACTGGAGCCCATCTTCTCGTGA
Gene >Hirsu2|2277
ATGTCGGATGCTGCCGACAGGTACGTCGCTGAAACGAGGCGGTGCGGCAGGCCTTTGTTTAATGCACCGCCTTTG
CCCGGTCCACCCAACTGCTACTGCGGCGGCTGCTGCTGCTGCCGCCGCTGCTGCTGCTGCTGCTTTTCCCCCTCC
CATCGCCAGTCGACGAGCCACGCTGACCAGCCCTCGTCCGCCCCCTCAGCCCGCACAGGCGGTCCATGTCCGCCG
CCGCCCTCTCGCTGCTCCGCCGCAAAGACACGCGCGAGGAGGAATCCGGCTCCGAAGACGGCCGGGTCGCGTCCG
CGCCGCCGCCGCTGCCCACGCCCCGCCATCCCGCCAGCTCCAGCGCCAGCGTGGCCTCCCAGCAGGGCCTCGCCC
GCAGCCACGGCCACGGCCACGGCCACGGCCACACCTCGAAGCACTCGACAGCCTCCAACATGCTCGGCCGCACCC
CGTCCAACCCGTCCCCGGCCACGCCCACCAAGCCGTCCGCCGTCCAGGAGAGGACGGCCAGCCTGGAGCAGTCGG
TCCGCAAGTTCAGGGCCGTCGAGGCCCTGCGCAGCGGCGACACCGCCTCCATCTCCAGGGCCATCCGCGAGAGCG
CCGACAACGGCCGCCGCTTCAGCACCTCGTCCGCCTCCACCCTCGGCCTCGGCACCGGCCCCGGCCCGCTAGACG
ACACCACCATCCTGCACCTGGCCATCCAGTGCGCCGAGTTCGCCGTCATCGAATACGTCCTGTCCGACGGCATCG
GCCTCATCGACATCAACGGCCGCGACAAGGACGGCAACACGCCCCTGCACCTTGCCGCCACCCACGGCCGCACCC
ACGCCGTCAAGCTCCTCCTCGAGCAAAAGGACATCAACGACGCCATCGCCAACCAGCACGGCCAGCTGCCCATCG
ACCTGGCCCGCAACCCCGAAATCTTCCAGCTCCTGCAGCTGTCCCGCTCCCTGTTCGCCGAGGCCAAGGTCAAGC
AGGTCCAGGATCTCATCGCCAGGAAAGACTACGACACCCTCGCCCACGTCCTGGAGGAGCCCCGCCTCAAGACGG
TGCTCGACATCAACAGCCCCGAGTTCGCGTCCGAGCCGGCCACCGTCCAGGCCGGCGGCACCCTGCTCCACGAGG
CCGCCCGCAAGAAGAACACGCAGCTCATCCAGGTCCTGCTCCTGCACGGCGCCGACCCCTTCCGTCGCGACCGAA
AGGGGAAGCTCCCCCAGGCCGTCACCGGCGATGACGGCGTCAAGGCCATCCTTAAGAAGTCGCCCGCCGCCGTCG
CGGCCCAGAGGGGCATCCAGGAGAAGGCCGTCCTCGGACACGCCGCCGCGCAGGGCAGCTCCTCGGCCGCGCCCG
GCGACCTCATGGCCGGCAGGGAGGCGCGCGAGATCAAGGGCTACCTCAAGAAGTGGACAAACTACCGCAAGGGAT
ACCAGCTGCGCTGGTTCGTGCTCGAGGACGGCGTCCTGAGCTACTACAAGCACCAGGACGACGCCGGCTCGGCCT
GTCGAGGCGCCATCAACATGAAGATTGCCAAGCTGCACATGAGCGCCGACGAGAAGACAAAGTTTGAGATCATCG
GCAAGTCGTCCGTCAAGTACACCCTCAAGGCCAACCACGAGGTCGAGGCCAAGCGCTGGTTCTGGGCCCTCAACA
ACTCCATCCAGTGGACCAAGGACCAGGCCAAGGAGGAGGAGCGCCAGGCCGCCCGCAGCGCCGAGCTGCTCAAGC
AGGCCAAGGCGGAACAGGGCAGCTCGCTGTCCGTCCACGAGTCGCACAGCGAGAGCACCAGCCTGTCCGACCTCC
CGAGGAGCCCGTCGCAGGCGCCGAGCCGCTCCCTGTCGACGTCAAATGCCCGTCCGCACAGGCGCGCCAGCACCG
TGGGCAGCATCGACGACGACGACATGGTCGACGGCGCCACCGAGGCCGGGGCCTCTTCCAGGGCACCGGCGCACC
ACCACCACCACCACCGCGGGCAGCACATGTCGGCGGACCACGACGACGACGACGACGACGACGCCTGCGACGACC
GGAGCATGTCCGAGGAGTCCGGGGCTACTAAGGATGCGCTCAACATCACGGCGCAGTCGGCCAAGCTGCAGCTGG
AAACGATGTCGAGCGTCCACTCGGCTTTGCTTGGCGAGCTCTCGCAGAGCCCCGCGACGCCCCTGTCGGACACCA
AGGTGACCCAGGCCCTGTCGACCTACGACGCCTCCATCCGCAGCCTGACCGGCCTCGTCGGGGACCTCCTCCGCA
TCTCGAGAGATCGCGATGCCTACTGGCAGTATCGCCTGGACCGCGAGTCGAACATGCGGCGGATGTGGGAGGAGA
GCATGCAGCAGGTGGCGCGCGAGCAGGAGGAGCTGGAGGCCCGCGTCGGCGAGGCCGAGTCGAAACGGCGCCTGA
CCAAGAAGGCGCTGCGGGAGATGATGGAGGGCGGCGCCGGCGGGGCCGCCGCCGCCGTGACGTCGAGCAACACAC
CGACAACGGAAAAGCTGCAGGCCGAGGTGGAGGCGGAAGCCAAGCCGCCGTCGCGGAACCTGGAACGCAAGGCGA
CGGCGCTCGACCAGCTCGGGGAGCTCTCGGAGAGCGACTCGGACGACGGCGATGAGTTTTTCGACGCCGTGGACG
CCGGCCAAGTCGAGGTGGCCGAGATCCCGACGGGCGAGAGCCAGCGGGAGACGGAGGGCGTCGTCGTTTCGGGCG
TCGACATCAGCTCGTCGTTCAAAGGATACGAGAACGGCATCAGACACCGGCTCAAGATGGACGCCGACGACCGCC
CGAAGGTGTCCCTATGGGTAGGCCACGTTGCCCCGTCCCGAGCCCCGCTTCGCTGCTAACGACCGGACTGGCAGG
GCATCTTGAAATCCATGATCGGCAAGGACATGACCAAGATGACGCTGCCCGTGTCCTTCAACGAGCCGACGTCGC
TGCTGTACCGCTGCGGCGAGGACATGGAGTACGCGGACCTGCTGGACCTGGCCGTGGAGCGGGCCGACCCGATCG
AGCGGCTCATCTACGTGGCGGCGTTTGCGGCGAGCGAGTACGCGTCGACGATCGGGCGCGTGGCCAAGCCCTTCA
ACCCGCTGCTGGGCGAGACGTTCGAGTACGTGCGGCCGGACAAGAACTACCGCTTCTTCATCGAGCAGGTCAGCC
ACCACCCGCCGGTGGGCGCGGCCTGGGCCGAGTCGCCGCACTGGACGTACTGGGGCGAGTCGGCGGTGCGGTCCA
AGTTTTACGGCAAGTCGTTCGACATCAACCCGCTCGGCACCTGGTTCCTCAAGCTCAGGCCCAAGGCGGGCGGGC
GGGAGGACCTGTACACGTGGAAGAAGGTGACGTCGTCGGTCATCGGCATCATCACGGGCAGCCCGACGGTGGACA
ACTACGGGCCGATGGAGATCAAGAACTGGACGACGGGCGAGGTGGCGCTGCTCGAGTTCAAGCCGCGGGGCTGGA
AGGCGTCGAGCGCGTACCACCTGTCGGGCAAGATCCTGGACGCGCAGGGCAACGTGCGCTTCAGCCTGGGCGGGC
GGTGGAACTCGAAGCTGTACGCGCGGCTGACGCCCGGGTACGAGGCCAACGTGGAGGAGCCCAAGGAGAGCCGGC
CGGTGGAGCGGGGCGGGGGCCTGACGGACCCGAGCCGGGCGTACCTGGTGTGGGAGGCCAACGAGCGGCCGGCGG
GGATCCCGTTCAACCTGACGCCCTTTGTGCTGACCTTTAACCACATCGACGACCAGCTGCGGCCGTGGCTGGCGC
CGACGGACTCGCGGCTGCGGCCGGACCAGCGGGCCATGGAGGACGGCGAGTACGACTTCGCGGCCGAGGAGAAGA
ACCGGCTGGAGGAGAGCCAGCGGGCGCGGCGGAGGGAGCGGGAGGCGCGAGGCGAGGACTTTTCGCCGGCCTGGT
TCAGCAAGACGAGGTGCGAGGTGACGGGCGAGGAGTACTGGAAGTTCAACGGCAAGTACTGGGAGCAGCGGGAGC
GGGCGGGGCCGAGCGGAGACGACCGTGCATGGGCCGGACTGGAGCCCATCTTCTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail