Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2268
Gene name
LocationContig_153:27988..29758
Strand+
Gene length (bp)1770
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family 8.6E-101 110 540

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TGG8|GDA1_ASPFU Probable guanosine-diphosphatase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gda1 PE=3 SV=2 42 543 0.0E+00
sp|Q9HEM6|GDA1_KLULA Guanosine-diphosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GDA1 PE=3 SV=1 111 543 1.0E-160
sp|Q9UT35|GDA1_SCHPO Guanosine-diphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gdp1 PE=3 SV=1 102 542 7.0E-158
sp|P32621|GDA1_YEAST Guanosine-diphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDA1 PE=1 SV=1 111 541 6.0E-153
sp|Q8TGH6|GDA1_CANAL Guanosine-diphosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GDA1 PE=3 SV=1 110 543 8.0E-153
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TGG8|GDA1_ASPFU Probable guanosine-diphosphatase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gda1 PE=3 SV=2 42 543 0.0E+00
sp|Q9HEM6|GDA1_KLULA Guanosine-diphosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GDA1 PE=3 SV=1 111 543 1.0E-160
sp|Q9UT35|GDA1_SCHPO Guanosine-diphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gdp1 PE=3 SV=1 102 542 7.0E-158
sp|P32621|GDA1_YEAST Guanosine-diphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDA1 PE=1 SV=1 111 541 6.0E-153
sp|Q8TGH6|GDA1_CANAL Guanosine-diphosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GDA1 PE=3 SV=1 110 543 8.0E-153
sp|E1C1L6|ENTP5_CHICK Ectonucleoside triphosphate diphosphohydrolase 5 OS=Gallus gallus GN=ENTPD5 PE=3 SV=1 112 530 2.0E-55
sp|E1BPW0|ENTP5_BOVIN Ectonucleoside triphosphate diphosphohydrolase 5 OS=Bos taurus GN=ENTPD5 PE=3 SV=1 112 530 7.0E-52
sp|Q9ER31|ENTP6_RAT Ectonucleoside triphosphate diphosphohydrolase 6 OS=Rattus norvegicus GN=Entpd6 PE=1 SV=1 110 525 2.0E-51
sp|D2GZV9|ENTP5_AILME Ectonucleoside triphosphate diphosphohydrolase 5 OS=Ailuropoda melanoleuca GN=ENTPD5 PE=3 SV=1 112 530 9.0E-51
sp|Q6P6S9|ENTP5_RAT Ectonucleoside triphosphate diphosphohydrolase 5 OS=Rattus norvegicus GN=Entpd5 PE=2 SV=1 112 530 4.0E-49
sp|O75354|ENTP6_HUMAN Ectonucleoside triphosphate diphosphohydrolase 6 OS=Homo sapiens GN=ENTPD6 PE=1 SV=3 110 525 4.0E-47
sp|Q9WUZ9|ENTP5_MOUSE Ectonucleoside triphosphate diphosphohydrolase 5 OS=Mus musculus GN=Entpd5 PE=1 SV=1 112 530 4.0E-47
sp|Q8H7L6|APY1_ORYSJ Probable apyrase 1 OS=Oryza sativa subsp. japonica GN=APY1 PE=3 SV=1 111 527 6.0E-46
sp|O75356|ENTP5_HUMAN Ectonucleoside triphosphate diphosphohydrolase 5 OS=Homo sapiens GN=ENTPD5 PE=1 SV=1 112 530 7.0E-46
sp|P80595|APY_SOLTU Apyrase OS=Solanum tuberosum GN=RROP1 PE=1 SV=2 111 529 3.0E-45
sp|Q9QYC8|ENTP5_MESAU Ectonucleoside triphosphate diphosphohydrolase 5 OS=Mesocricetus auratus GN=ENTPD5 PE=2 SV=1 112 521 1.0E-44
sp|Q9SQG2|APY1_ARATH Apyrase 1 OS=Arabidopsis thaliana GN=APY1 PE=1 SV=1 111 527 1.0E-43
sp|Q6Z4P2|APY2_ORYSJ Probable apyrase 2 OS=Oryza sativa subsp. japonica GN=APY2 PE=2 SV=1 111 527 2.0E-43
sp|Q2QYE1|APY3_ORYSJ Probable apyrase 3 OS=Oryza sativa subsp. japonica GN=APY3 PE=2 SV=2 111 544 4.0E-43
sp|Q9SPM5|APY2_ARATH Apyrase 2 OS=Arabidopsis thaliana GN=APY2 PE=1 SV=1 111 527 7.0E-43
sp|P52914|NTPA_PEA Nucleoside-triphosphatase OS=Pisum sativum PE=2 SV=1 100 527 6.0E-39
sp|O55026|ENTP2_MOUSE Ectonucleoside triphosphate diphosphohydrolase 2 OS=Mus musculus GN=Entpd2 PE=1 SV=2 105 529 9.0E-39
sp|Q9XU84|UDA1_CAEEL Nucleoside-diphosphatase uda-1 OS=Caenorhabditis elegans GN=uda-1 PE=1 SV=1 112 527 3.0E-38
sp|Q9Y5L3|ENTP2_HUMAN Ectonucleoside triphosphate diphosphohydrolase 2 OS=Homo sapiens GN=ENTPD2 PE=1 SV=1 105 529 8.0E-37
sp|O35795|ENTP2_RAT Ectonucleoside triphosphate diphosphohydrolase 2 OS=Rattus norvegicus GN=Entpd2 PE=1 SV=1 105 529 2.0E-36
sp|P97687|ENTP1_RAT Ectonucleoside triphosphate diphosphohydrolase 1 OS=Rattus norvegicus GN=Entpd1 PE=1 SV=1 106 529 5.0E-35
sp|Q8H1D8|APY4_ARATH Probable apyrase 4 OS=Arabidopsis thaliana GN=APY4 PE=2 SV=1 110 525 6.0E-35
sp|P55772|ENTP1_MOUSE Ectonucleoside triphosphate diphosphohydrolase 1 OS=Mus musculus GN=Entpd1 PE=1 SV=1 105 529 3.0E-34
sp|Q6NQA8|APY5_ARATH Probable apyrase 5 OS=Arabidopsis thaliana GN=APY5 PE=2 SV=1 110 525 9.0E-34
sp|P40009|YND1_YEAST Golgi apyrase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YND1 PE=1 SV=1 111 534 2.0E-33
sp|O80612|APY6_ARATH Probable apyrase 6 OS=Arabidopsis thaliana GN=APY6 PE=2 SV=2 110 525 4.0E-33
sp|Q9XI62|APY3_ARATH Probable apyrase 3 OS=Arabidopsis thaliana GN=APY3 PE=2 SV=1 84 542 4.0E-32
sp|P79784|ENTP2_CHICK Ectonucleoside triphosphate diphosphohydrolase 2 OS=Gallus gallus GN=ENTPD2 PE=1 SV=2 108 529 5.0E-32
sp|P49961|ENTP1_HUMAN Ectonucleoside triphosphate diphosphohydrolase 1 OS=Homo sapiens GN=ENTPD1 PE=1 SV=1 110 529 2.0E-31
sp|O75355|ENTP3_HUMAN Ectonucleoside triphosphate diphosphohydrolase 3 OS=Homo sapiens GN=ENTPD3 PE=1 SV=2 108 529 1.0E-30
sp|O93295|ENTP8_CHICK Ectonucleoside triphosphate diphosphohydrolase 8 OS=Gallus gallus GN=ENTPD8 PE=1 SV=1 108 529 1.0E-30
sp|Q617Y0|MIG23_CAEBR Nucleoside-diphosphatase mig-23 OS=Caenorhabditis briggsae GN=mig-23 PE=3 SV=1 112 527 6.0E-29
sp|Q18411|NTP1_CAEEL Nucleoside-triphosphatase ntp-1 OS=Caenorhabditis elegans GN=ntp-1 PE=1 SV=1 98 527 2.0E-28
sp|O18956|ENTP1_BOVIN Ectonucleoside triphosphate diphosphohydrolase 1 OS=Bos taurus GN=ENTPD1 PE=1 SV=1 110 529 2.0E-28
sp|Q9DBT4|ENTP4_MOUSE Ectonucleoside triphosphate diphosphohydrolase 4 OS=Mus musculus GN=Entpd4 PE=1 SV=1 106 527 3.0E-28
sp|Q21815|MIG23_CAEEL Nucleoside-diphosphatase mig-23 OS=Caenorhabditis elegans GN=mig-23 PE=1 SV=2 112 527 8.0E-28
sp|Q5REF6|ENTP7_PONAB Ectonucleoside triphosphate diphosphohydrolase 7 OS=Pongo abelii GN=ENTPD7 PE=2 SV=1 106 527 9.0E-28
sp|Q3TCT4|ENTP7_MOUSE Ectonucleoside triphosphate diphosphohydrolase 7 OS=Mus musculus GN=Entpd7 PE=2 SV=1 104 527 1.0E-27
sp|Q9USP2|YND1_SCHPO Golgi apyrase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ynd1 PE=3 SV=1 109 503 2.0E-27
sp|Q9Y227|ENTP4_HUMAN Ectonucleoside triphosphate diphosphohydrolase 4 OS=Homo sapiens GN=ENTPD4 PE=1 SV=1 106 527 2.0E-27
sp|Q9NQZ7|ENTP7_HUMAN Ectonucleoside triphosphate diphosphohydrolase 7 OS=Homo sapiens GN=ENTPD7 PE=2 SV=1 106 527 1.0E-25
sp|Q5DRK1|ENTP8_RAT Ectonucleoside triphosphate diphosphohydrolase 8 OS=Rattus norvegicus GN=Entpd8 PE=1 SV=1 111 529 1.0E-24
sp|Q28CF8|ENTP7_XENTR Ectonucleoside triphosphate diphosphohydrolase 7 OS=Xenopus tropicalis GN=entpd7 PE=2 SV=1 110 527 2.0E-24
sp|Q8K0L2|ENTP8_MOUSE Ectonucleoside triphosphate diphosphohydrolase 8 OS=Mus musculus GN=Entpd8 PE=1 SV=3 111 529 1.0E-23
sp|Q9MYU4|ENTP1_PIG Ectonucleoside triphosphate diphosphohydrolase 1 OS=Sus scrofa GN=ENTPD1 PE=1 SV=1 105 529 3.0E-22
sp|A0JND9|ENTP8_BOVIN Ectonucleoside triphosphate diphosphohydrolase 8 OS=Bos taurus GN=ENTPD8 PE=2 SV=1 108 536 4.0E-19
sp|Q5MY95|ENTP8_HUMAN Ectonucleoside triphosphate diphosphohydrolase 8 OS=Homo sapiens GN=ENTPD8 PE=1 SV=2 110 529 2.0E-18
sp|F4JSH1|APY7_ARATH Probable apyrase 7 OS=Arabidopsis thaliana GN=APY7 PE=2 SV=1 111 527 1.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 50 67 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2268
MRRTSVSLPTKHVAHDPYEKPGRYQPDQQSQGLLATMKETWITSSQRTRWLRTAAVVFAVILLFWWLSPRGVEVY
NEVSHGKANSGQAPADSTYGTDRCQKSYHKDKPIVQYALMIDAGSTGSRIHVFKFNNCGPIPELEKEEFKMTEKT
VGGLSKHKDDPVGAAKTLDVLMQHAMEHVPDQLKSCSPVAVKATAGLRLIGPEKSQAILDEVRRHLESDYPFPVV
SAEQDGVAVMDGSLEGVYAWVTANYLLGKIGGPDKGQTAATFDLGGGSTQIVFEPTFKGAPAGGMPDKLAEGDHK
YSLDFGGQRFELYQHSHLGYGLMSARKAIHKALVADVAAKASGSAWMSKPIVHPCIAPGMSQEIEVEVDGDKDAR
TFKFVGPSQPAAAQCRSLAEKILKKDAECKLAPCSFNGVHQPSLAKTFAKEDVYIFSYFYDRTKPLGMPDSFTVR
EMQDLTQAVCTGKAGWDVFSSMPDAMEELSGRPEHCLDLNFMLALLHTGYEMPIDREVKIAKKIKGNELGWCLGA
SLPLLAPGSGWKCKIKQVY*
Coding >Hirsu2|2268
ATGCGAAGGACGTCGGTCTCGTTGCCGACCAAGCACGTTGCCCACGATCCCTACGAGAAGCCCGGCCGCTACCAG
CCGGATCAGCAGAGCCAGGGCCTCCTCGCCACCATGAAGGAGACCTGGATCACCTCCTCCCAGCGGACTCGCTGG
CTGAGGACCGCCGCCGTCGTCTTTGCCGTCATCCTCCTGTTCTGGTGGCTGTCGCCGCGCGGAGTCGAGGTCTAC
AATGAGGTCTCCCACGGCAAGGCCAACTCGGGACAGGCTCCCGCCGACTCGACCTACGGCACCGACCGATGCCAG
AAATCCTACCACAAGGACAAGCCCATCGTGCAGTACGCCCTCATGATCGATGCCGGCAGCACCGGCTCGCGCATC
CACGTCTTCAAGTTCAACAACTGCGGCCCCATCCCCGAGCTCGAAAAGGAGGAGTTCAAGATGACGGAGAAGACG
GTCGGCGGCCTGAGCAAGCACAAGGACGATCCGGTCGGCGCCGCCAAGACGCTCGACGTCTTGATGCAGCACGCC
ATGGAGCACGTCCCCGACCAGCTCAAGAGCTGCAGCCCCGTCGCCGTCAAGGCCACCGCCGGCCTGCGCCTGATT
GGGCCGGAAAAGTCCCAGGCCATCCTCGACGAGGTCCGCCGACACCTCGAGTCCGACTATCCCTTCCCCGTCGTC
TCGGCCGAACAGGACGGCGTCGCCGTCATGGACGGCTCCCTCGAGGGCGTCTACGCCTGGGTCACGGCCAACTAC
CTCCTCGGCAAGATCGGCGGGCCCGACAAGGGCCAGACGGCCGCCACCTTCGACCTCGGCGGCGGCTCCACCCAG
ATCGTCTTCGAGCCGACCTTCAAGGGCGCCCCGGCCGGCGGCATGCCCGACAAGCTGGCCGAGGGCGACCACAAG
TACTCGCTCGACTTTGGCGGCCAGCGCTTCGAGCTGTACCAGCACTCGCATCTCGGCTACGGCCTCATGTCCGCC
CGCAAGGCCATCCACAAGGCCCTCGTCGCCGACGTGGCCGCCAAGGCCTCGGGCAGCGCCTGGATGTCCAAGCCG
ATCGTGCACCCCTGCATCGCCCCCGGCATGTCCCAGGAGATCGAGGTCGAGGTGGACGGTGACAAGGACGCGCGG
ACCTTCAAGTTTGTCGGCCCCTCGCAGCCCGCCGCCGCCCAGTGCCGCAGCCTGGCGGAGAAGATCCTGAAGAAG
GATGCCGAGTGCAAGCTCGCCCCCTGCTCCTTCAACGGCGTGCACCAGCCGTCCCTGGCCAAGACGTTCGCCAAA
GAGGACGTCTACATCTTCTCCTACTTCTACGACCGCACCAAGCCCCTGGGCATGCCCGACTCCTTCACCGTCCGC
GAGATGCAGGACCTGACGCAGGCCGTCTGCACCGGCAAGGCCGGCTGGGACGTCTTCAGCAGCATGCCCGACGCC
ATGGAGGAGCTCAGCGGCCGCCCGGAGCACTGCCTCGACCTCAACTTCATGCTGGCCCTGCTCCACACCGGCTAC
GAGATGCCCATCGACCGCGAGGTCAAGATTGCCAAGAAGATTAAGGGCAACGAGCTGGGCTGGTGCCTCGGCGCC
AGCTTGCCGCTGTTGGCCCCCGGGTCTGGCTGGAAGTGCAAGATCAAGCAAGTTTACTAG
Transcript >Hirsu2|2268
ATGCGAAGGACGTCGGTCTCGTTGCCGACCAAGCACGTTGCCCACGATCCCTACGAGAAGCCCGGCCGCTACCAG
CCGGATCAGCAGAGCCAGGGCCTCCTCGCCACCATGAAGGAGACCTGGATCACCTCCTCCCAGCGGACTCGCTGG
CTGAGGACCGCCGCCGTCGTCTTTGCCGTCATCCTCCTGTTCTGGTGGCTGTCGCCGCGCGGAGTCGAGGTCTAC
AATGAGGTCTCCCACGGCAAGGCCAACTCGGGACAGGCTCCCGCCGACTCGACCTACGGCACCGACCGATGCCAG
AAATCCTACCACAAGGACAAGCCCATCGTGCAGTACGCCCTCATGATCGATGCCGGCAGCACCGGCTCGCGCATC
CACGTCTTCAAGTTCAACAACTGCGGCCCCATCCCCGAGCTCGAAAAGGAGGAGTTCAAGATGACGGAGAAGACG
GTCGGCGGCCTGAGCAAGCACAAGGACGATCCGGTCGGCGCCGCCAAGACGCTCGACGTCTTGATGCAGCACGCC
ATGGAGCACGTCCCCGACCAGCTCAAGAGCTGCAGCCCCGTCGCCGTCAAGGCCACCGCCGGCCTGCGCCTGATT
GGGCCGGAAAAGTCCCAGGCCATCCTCGACGAGGTCCGCCGACACCTCGAGTCCGACTATCCCTTCCCCGTCGTC
TCGGCCGAACAGGACGGCGTCGCCGTCATGGACGGCTCCCTCGAGGGCGTCTACGCCTGGGTCACGGCCAACTAC
CTCCTCGGCAAGATCGGCGGGCCCGACAAGGGCCAGACGGCCGCCACCTTCGACCTCGGCGGCGGCTCCACCCAG
ATCGTCTTCGAGCCGACCTTCAAGGGCGCCCCGGCCGGCGGCATGCCCGACAAGCTGGCCGAGGGCGACCACAAG
TACTCGCTCGACTTTGGCGGCCAGCGCTTCGAGCTGTACCAGCACTCGCATCTCGGCTACGGCCTCATGTCCGCC
CGCAAGGCCATCCACAAGGCCCTCGTCGCCGACGTGGCCGCCAAGGCCTCGGGCAGCGCCTGGATGTCCAAGCCG
ATCGTGCACCCCTGCATCGCCCCCGGCATGTCCCAGGAGATCGAGGTCGAGGTGGACGGTGACAAGGACGCGCGG
ACCTTCAAGTTTGTCGGCCCCTCGCAGCCCGCCGCCGCCCAGTGCCGCAGCCTGGCGGAGAAGATCCTGAAGAAG
GATGCCGAGTGCAAGCTCGCCCCCTGCTCCTTCAACGGCGTGCACCAGCCGTCCCTGGCCAAGACGTTCGCCAAA
GAGGACGTCTACATCTTCTCCTACTTCTACGACCGCACCAAGCCCCTGGGCATGCCCGACTCCTTCACCGTCCGC
GAGATGCAGGACCTGACGCAGGCCGTCTGCACCGGCAAGGCCGGCTGGGACGTCTTCAGCAGCATGCCCGACGCC
ATGGAGGAGCTCAGCGGCCGCCCGGAGCACTGCCTCGACCTCAACTTCATGCTGGCCCTGCTCCACACCGGCTAC
GAGATGCCCATCGACCGCGAGGTCAAGATTGCCAAGAAGATTAAGGGCAACGAGCTGGGCTGGTGCCTCGGCGCC
AGCTTGCCGCTGTTGGCCCCCGGGTCTGGCTGGAAGTGCAAGATCAAGCAAGTTTACTAG
Gene >Hirsu2|2268
ATGCGAAGGACGTCGGTCTCGTTGCCGACCAAGCACGTTGCCCACGATCCCTACGAGAAGCCCGGCCGCTACCAG
CCGGATCAGCAGAGCCAGGGCCTCCTCGCCACCATGAAGGAGACCTGGATCACCTCCTCCCAGCGGACTCGCTGG
CTGAGGACCGCCGCCGTCGTCTTTGCCGTCATCCTCCTGTTCTGGTGGCTGTCGCCGCGCGGAGTCGAGGTCTAC
AATGAGGGTGAGACAGCGCTTCGTCGCTCGCCCAATCCGCCCTCTTCGCTGACCGACCCCGAGCAGTCTCCCACG
GCAAGGCCAACTCGGGACAGGCTCCCGCCGACTCGACCTACGGCACCGACCGATGCCAGAAATCCTACCACAAGG
ACAAGCCCATCGTGCAGTACGCCCTCATGATCGATGCCGGCAGCACCGGCTCGCGCATCCACGTCTTCAAGTTCA
ACAACTGCGGCCCCATCCCCGAGCTCGAAAAGGAGGAGTTCAAGATGACGGAGAAGACGGTCGGCGGCCTGAGCA
AGCACAAGGACGATCCGGTCGGCGCCGCCAAGACGCTCGACGTCTTGATGCAGCACGCCATGGAGCACGTCCCCG
ACCAGCTCAAGAGCTGCAGCCCCGTCGCCGTCAAGGCCACCGCCGGCCTGCGCCTGATTGGGCCGGAAAAGTCCC
AGGCCATCCTCGACGAGGTCCGCCGACACCTCGAGTCCGACTATCCCTTCCCCGTCGTCTCGGCCGAACAGGACG
GCGTCGCCGTCATGGACGGCTCCCTCGAGGGCGTCTACGCCTGGGTCACGGCCAACTACCTCCTCGGCAAGATCG
GCGGGCCCGACAAGGGCCAGACGGCCGCCACCTTCGACCTCGGCGGCGGCTCCACCCAGATCGTCTTCGAGCCGA
CCTTCAAGGGCGCCCCGGCCGGCGGCATGCCCGACAAGCTGGCCGAGGGCGACCACAAGTACTCGCTCGACTTTG
GCGGCCAGCGCTTCGAGCTGTACCAGCACTCGCATCTCGGCTACGGCCTCATGTCCGCCCGCAAGGCCATCCACA
AGGCCCTCGTCGCCGACGTGGCCGCCAAGGCCTCGGGCAGCGCCTGGATGTCCAAGCCGATCGTGCACCCCTGCA
TCGCCCCCGGCATGTCCCAGGAGATCGAGGTCGAGGTGGACGGTGACAAGGACGCGCGGACCTTCAAGTTTGTCG
GCCCCTCGCAGCCCGCCGCCGCCCAGTGCCGCAGCCTGGCGGAGAAGATCCTGAAGAAGGATGCCGAGTGCAAGC
TCGCCCCCTGCTCCTTCAACGGCGTGCACCAGCCGTCCCTGGCCAAGACGTTCGCCAAAGAGGACGTCTACATCT
TCTCCTACTTCTACGACCGCACCAAGCCCCTGGGCATGCCCGACTCCTTCACCGTCCGCGAGATGCAGGACCTGA
CGCAGGCCGTCTGCACCGGCAAGGCCGGCTGGGACGTCTTCAGCAGCATGCCCGACGCCATGGAGGAGCTCAGCG
GCCGCCCGGAGCACTGCCTCGACCTCAACTTCATGCTGGCCCTGCTCCACACCGGCTACGAGATGCCCATCGACC
GCGAGGTCAAGATTGCCAAGAAGATTAAGGGCAACGAGCTGGGCTGGTGCCTCGGCGCCAGGTGAGTTTTCATCC
CCCGCATCCCTTATCCCTCCTCCGCCTTTGACCACACCCGTGCTGACTCATTTTGTCGTCAGCTTGCCGCTGTTG
GCCCCCGGGTCTGGCTGGAAGTGCAAGATCAAGCAAGTTTACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail