Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2268
Gene name
LocationContig_153:27988..29758
Strand+
Gene length (bp)1770
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family 9.4E-101 110 540

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TGG8|GDA1_ASPFU Probable guanosine-diphosphatase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gda1 PE=3 SV=2 42 543 0.0E+00
sp|Q9HEM6|GDA1_KLULA Guanosine-diphosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GDA1 PE=3 SV=1 111 543 1.0E-160
sp|Q9UT35|GDA1_SCHPO Guanosine-diphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gdp1 PE=3 SV=1 102 542 7.0E-158
sp|P32621|GDA1_YEAST Guanosine-diphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDA1 PE=1 SV=1 111 541 6.0E-153
sp|Q8TGH6|GDA1_CANAL Guanosine-diphosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GDA1 PE=3 SV=1 110 543 8.0E-153
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TGG8|GDA1_ASPFU Probable guanosine-diphosphatase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gda1 PE=3 SV=2 42 543 0.0E+00
sp|Q9HEM6|GDA1_KLULA Guanosine-diphosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GDA1 PE=3 SV=1 111 543 1.0E-160
sp|Q9UT35|GDA1_SCHPO Guanosine-diphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gdp1 PE=3 SV=1 102 542 7.0E-158
sp|P32621|GDA1_YEAST Guanosine-diphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDA1 PE=1 SV=1 111 541 6.0E-153
sp|Q8TGH6|GDA1_CANAL Guanosine-diphosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GDA1 PE=3 SV=1 110 543 8.0E-153
sp|E1C1L6|ENTP5_CHICK Ectonucleoside triphosphate diphosphohydrolase 5 OS=Gallus gallus GN=ENTPD5 PE=3 SV=1 112 530 2.0E-55
sp|E1BPW0|ENTP5_BOVIN Ectonucleoside triphosphate diphosphohydrolase 5 OS=Bos taurus GN=ENTPD5 PE=3 SV=1 112 530 7.0E-52
sp|Q9ER31|ENTP6_RAT Ectonucleoside triphosphate diphosphohydrolase 6 OS=Rattus norvegicus GN=Entpd6 PE=1 SV=1 110 525 2.0E-51
sp|D2GZV9|ENTP5_AILME Ectonucleoside triphosphate diphosphohydrolase 5 OS=Ailuropoda melanoleuca GN=ENTPD5 PE=3 SV=1 112 530 9.0E-51
sp|Q6P6S9|ENTP5_RAT Ectonucleoside triphosphate diphosphohydrolase 5 OS=Rattus norvegicus GN=Entpd5 PE=2 SV=1 112 530 4.0E-49
sp|O75354|ENTP6_HUMAN Ectonucleoside triphosphate diphosphohydrolase 6 OS=Homo sapiens GN=ENTPD6 PE=1 SV=3 110 525 4.0E-47
sp|Q9WUZ9|ENTP5_MOUSE Ectonucleoside triphosphate diphosphohydrolase 5 OS=Mus musculus GN=Entpd5 PE=1 SV=1 112 530 4.0E-47
sp|Q8H7L6|APY1_ORYSJ Probable apyrase 1 OS=Oryza sativa subsp. japonica GN=APY1 PE=3 SV=1 111 527 6.0E-46
sp|O75356|ENTP5_HUMAN Ectonucleoside triphosphate diphosphohydrolase 5 OS=Homo sapiens GN=ENTPD5 PE=1 SV=1 112 530 7.0E-46
sp|P80595|APY_SOLTU Apyrase OS=Solanum tuberosum GN=RROP1 PE=1 SV=2 111 529 3.0E-45
sp|Q9QYC8|ENTP5_MESAU Ectonucleoside triphosphate diphosphohydrolase 5 OS=Mesocricetus auratus GN=ENTPD5 PE=2 SV=1 112 521 1.0E-44
sp|Q9SQG2|APY1_ARATH Apyrase 1 OS=Arabidopsis thaliana GN=APY1 PE=1 SV=1 111 527 1.0E-43
sp|Q6Z4P2|APY2_ORYSJ Probable apyrase 2 OS=Oryza sativa subsp. japonica GN=APY2 PE=2 SV=1 111 527 2.0E-43
sp|Q2QYE1|APY3_ORYSJ Probable apyrase 3 OS=Oryza sativa subsp. japonica GN=APY3 PE=2 SV=2 111 544 4.0E-43
sp|Q9SPM5|APY2_ARATH Apyrase 2 OS=Arabidopsis thaliana GN=APY2 PE=1 SV=1 111 527 7.0E-43
sp|P52914|NTPA_PEA Nucleoside-triphosphatase OS=Pisum sativum PE=2 SV=1 100 527 6.0E-39
sp|O55026|ENTP2_MOUSE Ectonucleoside triphosphate diphosphohydrolase 2 OS=Mus musculus GN=Entpd2 PE=1 SV=2 105 529 9.0E-39
sp|Q9XU84|UDA1_CAEEL Nucleoside-diphosphatase uda-1 OS=Caenorhabditis elegans GN=uda-1 PE=1 SV=1 112 527 3.0E-38
sp|Q9Y5L3|ENTP2_HUMAN Ectonucleoside triphosphate diphosphohydrolase 2 OS=Homo sapiens GN=ENTPD2 PE=1 SV=1 105 529 8.0E-37
sp|O35795|ENTP2_RAT Ectonucleoside triphosphate diphosphohydrolase 2 OS=Rattus norvegicus GN=Entpd2 PE=1 SV=1 105 529 2.0E-36
sp|P97687|ENTP1_RAT Ectonucleoside triphosphate diphosphohydrolase 1 OS=Rattus norvegicus GN=Entpd1 PE=1 SV=1 106 529 5.0E-35
sp|Q8H1D8|APY4_ARATH Probable apyrase 4 OS=Arabidopsis thaliana GN=APY4 PE=2 SV=1 110 525 6.0E-35
sp|P55772|ENTP1_MOUSE Ectonucleoside triphosphate diphosphohydrolase 1 OS=Mus musculus GN=Entpd1 PE=1 SV=1 105 529 3.0E-34
sp|Q6NQA8|APY5_ARATH Probable apyrase 5 OS=Arabidopsis thaliana GN=APY5 PE=2 SV=1 110 525 9.0E-34
sp|P40009|YND1_YEAST Golgi apyrase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YND1 PE=1 SV=1 111 534 2.0E-33
sp|O80612|APY6_ARATH Probable apyrase 6 OS=Arabidopsis thaliana GN=APY6 PE=2 SV=2 110 525 4.0E-33
sp|Q9XI62|APY3_ARATH Probable apyrase 3 OS=Arabidopsis thaliana GN=APY3 PE=2 SV=1 84 542 4.0E-32
sp|P79784|ENTP2_CHICK Ectonucleoside triphosphate diphosphohydrolase 2 OS=Gallus gallus GN=ENTPD2 PE=1 SV=2 108 529 5.0E-32
sp|P49961|ENTP1_HUMAN Ectonucleoside triphosphate diphosphohydrolase 1 OS=Homo sapiens GN=ENTPD1 PE=1 SV=1 110 529 2.0E-31
sp|O75355|ENTP3_HUMAN Ectonucleoside triphosphate diphosphohydrolase 3 OS=Homo sapiens GN=ENTPD3 PE=1 SV=2 108 529 1.0E-30
sp|O93295|ENTP8_CHICK Ectonucleoside triphosphate diphosphohydrolase 8 OS=Gallus gallus GN=ENTPD8 PE=1 SV=1 108 529 1.0E-30
sp|Q617Y0|MIG23_CAEBR Nucleoside-diphosphatase mig-23 OS=Caenorhabditis briggsae GN=mig-23 PE=3 SV=1 112 527 6.0E-29
sp|Q18411|NTP1_CAEEL Nucleoside-triphosphatase ntp-1 OS=Caenorhabditis elegans GN=ntp-1 PE=1 SV=1 98 527 2.0E-28
sp|O18956|ENTP1_BOVIN Ectonucleoside triphosphate diphosphohydrolase 1 OS=Bos taurus GN=ENTPD1 PE=1 SV=1 110 529 2.0E-28
sp|Q9DBT4|ENTP4_MOUSE Ectonucleoside triphosphate diphosphohydrolase 4 OS=Mus musculus GN=Entpd4 PE=1 SV=1 106 527 3.0E-28
sp|Q21815|MIG23_CAEEL Nucleoside-diphosphatase mig-23 OS=Caenorhabditis elegans GN=mig-23 PE=1 SV=2 112 527 8.0E-28
sp|Q5REF6|ENTP7_PONAB Ectonucleoside triphosphate diphosphohydrolase 7 OS=Pongo abelii GN=ENTPD7 PE=2 SV=1 106 527 9.0E-28
sp|Q3TCT4|ENTP7_MOUSE Ectonucleoside triphosphate diphosphohydrolase 7 OS=Mus musculus GN=Entpd7 PE=2 SV=1 104 527 1.0E-27
sp|Q9USP2|YND1_SCHPO Golgi apyrase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ynd1 PE=3 SV=1 109 503 2.0E-27
sp|Q9Y227|ENTP4_HUMAN Ectonucleoside triphosphate diphosphohydrolase 4 OS=Homo sapiens GN=ENTPD4 PE=1 SV=1 106 527 2.0E-27
sp|Q9NQZ7|ENTP7_HUMAN Ectonucleoside triphosphate diphosphohydrolase 7 OS=Homo sapiens GN=ENTPD7 PE=2 SV=1 106 527 1.0E-25
sp|Q5DRK1|ENTP8_RAT Ectonucleoside triphosphate diphosphohydrolase 8 OS=Rattus norvegicus GN=Entpd8 PE=1 SV=1 111 529 1.0E-24
sp|Q28CF8|ENTP7_XENTR Ectonucleoside triphosphate diphosphohydrolase 7 OS=Xenopus tropicalis GN=entpd7 PE=2 SV=1 110 527 2.0E-24
sp|Q8K0L2|ENTP8_MOUSE Ectonucleoside triphosphate diphosphohydrolase 8 OS=Mus musculus GN=Entpd8 PE=1 SV=3 111 529 1.0E-23
sp|Q9MYU4|ENTP1_PIG Ectonucleoside triphosphate diphosphohydrolase 1 OS=Sus scrofa GN=ENTPD1 PE=1 SV=1 105 529 3.0E-22
sp|A0JND9|ENTP8_BOVIN Ectonucleoside triphosphate diphosphohydrolase 8 OS=Bos taurus GN=ENTPD8 PE=2 SV=1 108 536 4.0E-19
sp|Q5MY95|ENTP8_HUMAN Ectonucleoside triphosphate diphosphohydrolase 8 OS=Homo sapiens GN=ENTPD8 PE=1 SV=2 110 529 2.0E-18
sp|F4JSH1|APY7_ARATH Probable apyrase 7 OS=Arabidopsis thaliana GN=APY7 PE=2 SV=1 111 527 1.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.21 0.1497 0.2245 0.2242 0.1029 0.0113 0.5699 0.4246 0.8725 0.105

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 50 67 17

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2014
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1343
Ophiocordyceps australis map64 (Brazil) OphauB2|6018
Ophiocordyceps camponoti-floridani Ophcf2|06811
Ophiocordyceps camponoti-rufipedis Ophun1|1116
Ophiocordyceps kimflemingae Ophio5|5124
Ophiocordyceps subramaniannii Hirsu2|2268 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2268
MRRTSVSLPTKHVAHDPYEKPGRYQPDQQSQGLLATMKETWITSSQRTRWLRTAAVVFAVILLFWWLSPRGVEVY
NEVSHGKANSGQAPADSTYGTDRCQKSYHKDKPIVQYALMIDAGSTGSRIHVFKFNNCGPIPELEKEEFKMTEKT
VGGLSKHKDDPVGAAKTLDVLMQHAMEHVPDQLKSCSPVAVKATAGLRLIGPEKSQAILDEVRRHLESDYPFPVV
SAEQDGVAVMDGSLEGVYAWVTANYLLGKIGGPDKGQTAATFDLGGGSTQIVFEPTFKGAPAGGMPDKLAEGDHK
YSLDFGGQRFELYQHSHLGYGLMSARKAIHKALVADVAAKASGSAWMSKPIVHPCIAPGMSQEIEVEVDGDKDAR
TFKFVGPSQPAAAQCRSLAEKILKKDAECKLAPCSFNGVHQPSLAKTFAKEDVYIFSYFYDRTKPLGMPDSFTVR
EMQDLTQAVCTGKAGWDVFSSMPDAMEELSGRPEHCLDLNFMLALLHTGYEMPIDREVKIAKKIKGNELGWCLGA
SLPLLAPGSGWKCKIKQVY*
Coding >Hirsu2|2268
ATGCGAAGGACGTCGGTCTCGTTGCCGACCAAGCACGTTGCCCACGATCCCTACGAGAAGCCCGGCCGCTACCAG
CCGGATCAGCAGAGCCAGGGCCTCCTCGCCACCATGAAGGAGACCTGGATCACCTCCTCCCAGCGGACTCGCTGG
CTGAGGACCGCCGCCGTCGTCTTTGCCGTCATCCTCCTGTTCTGGTGGCTGTCGCCGCGCGGAGTCGAGGTCTAC
AATGAGGTCTCCCACGGCAAGGCCAACTCGGGACAGGCTCCCGCCGACTCGACCTACGGCACCGACCGATGCCAG
AAATCCTACCACAAGGACAAGCCCATCGTGCAGTACGCCCTCATGATCGATGCCGGCAGCACCGGCTCGCGCATC
CACGTCTTCAAGTTCAACAACTGCGGCCCCATCCCCGAGCTCGAAAAGGAGGAGTTCAAGATGACGGAGAAGACG
GTCGGCGGCCTGAGCAAGCACAAGGACGATCCGGTCGGCGCCGCCAAGACGCTCGACGTCTTGATGCAGCACGCC
ATGGAGCACGTCCCCGACCAGCTCAAGAGCTGCAGCCCCGTCGCCGTCAAGGCCACCGCCGGCCTGCGCCTGATT
GGGCCGGAAAAGTCCCAGGCCATCCTCGACGAGGTCCGCCGACACCTCGAGTCCGACTATCCCTTCCCCGTCGTC
TCGGCCGAACAGGACGGCGTCGCCGTCATGGACGGCTCCCTCGAGGGCGTCTACGCCTGGGTCACGGCCAACTAC
CTCCTCGGCAAGATCGGCGGGCCCGACAAGGGCCAGACGGCCGCCACCTTCGACCTCGGCGGCGGCTCCACCCAG
ATCGTCTTCGAGCCGACCTTCAAGGGCGCCCCGGCCGGCGGCATGCCCGACAAGCTGGCCGAGGGCGACCACAAG
TACTCGCTCGACTTTGGCGGCCAGCGCTTCGAGCTGTACCAGCACTCGCATCTCGGCTACGGCCTCATGTCCGCC
CGCAAGGCCATCCACAAGGCCCTCGTCGCCGACGTGGCCGCCAAGGCCTCGGGCAGCGCCTGGATGTCCAAGCCG
ATCGTGCACCCCTGCATCGCCCCCGGCATGTCCCAGGAGATCGAGGTCGAGGTGGACGGTGACAAGGACGCGCGG
ACCTTCAAGTTTGTCGGCCCCTCGCAGCCCGCCGCCGCCCAGTGCCGCAGCCTGGCGGAGAAGATCCTGAAGAAG
GATGCCGAGTGCAAGCTCGCCCCCTGCTCCTTCAACGGCGTGCACCAGCCGTCCCTGGCCAAGACGTTCGCCAAA
GAGGACGTCTACATCTTCTCCTACTTCTACGACCGCACCAAGCCCCTGGGCATGCCCGACTCCTTCACCGTCCGC
GAGATGCAGGACCTGACGCAGGCCGTCTGCACCGGCAAGGCCGGCTGGGACGTCTTCAGCAGCATGCCCGACGCC
ATGGAGGAGCTCAGCGGCCGCCCGGAGCACTGCCTCGACCTCAACTTCATGCTGGCCCTGCTCCACACCGGCTAC
GAGATGCCCATCGACCGCGAGGTCAAGATTGCCAAGAAGATTAAGGGCAACGAGCTGGGCTGGTGCCTCGGCGCC
AGCTTGCCGCTGTTGGCCCCCGGGTCTGGCTGGAAGTGCAAGATCAAGCAAGTTTACTAG
Transcript >Hirsu2|2268
ATGCGAAGGACGTCGGTCTCGTTGCCGACCAAGCACGTTGCCCACGATCCCTACGAGAAGCCCGGCCGCTACCAG
CCGGATCAGCAGAGCCAGGGCCTCCTCGCCACCATGAAGGAGACCTGGATCACCTCCTCCCAGCGGACTCGCTGG
CTGAGGACCGCCGCCGTCGTCTTTGCCGTCATCCTCCTGTTCTGGTGGCTGTCGCCGCGCGGAGTCGAGGTCTAC
AATGAGGTCTCCCACGGCAAGGCCAACTCGGGACAGGCTCCCGCCGACTCGACCTACGGCACCGACCGATGCCAG
AAATCCTACCACAAGGACAAGCCCATCGTGCAGTACGCCCTCATGATCGATGCCGGCAGCACCGGCTCGCGCATC
CACGTCTTCAAGTTCAACAACTGCGGCCCCATCCCCGAGCTCGAAAAGGAGGAGTTCAAGATGACGGAGAAGACG
GTCGGCGGCCTGAGCAAGCACAAGGACGATCCGGTCGGCGCCGCCAAGACGCTCGACGTCTTGATGCAGCACGCC
ATGGAGCACGTCCCCGACCAGCTCAAGAGCTGCAGCCCCGTCGCCGTCAAGGCCACCGCCGGCCTGCGCCTGATT
GGGCCGGAAAAGTCCCAGGCCATCCTCGACGAGGTCCGCCGACACCTCGAGTCCGACTATCCCTTCCCCGTCGTC
TCGGCCGAACAGGACGGCGTCGCCGTCATGGACGGCTCCCTCGAGGGCGTCTACGCCTGGGTCACGGCCAACTAC
CTCCTCGGCAAGATCGGCGGGCCCGACAAGGGCCAGACGGCCGCCACCTTCGACCTCGGCGGCGGCTCCACCCAG
ATCGTCTTCGAGCCGACCTTCAAGGGCGCCCCGGCCGGCGGCATGCCCGACAAGCTGGCCGAGGGCGACCACAAG
TACTCGCTCGACTTTGGCGGCCAGCGCTTCGAGCTGTACCAGCACTCGCATCTCGGCTACGGCCTCATGTCCGCC
CGCAAGGCCATCCACAAGGCCCTCGTCGCCGACGTGGCCGCCAAGGCCTCGGGCAGCGCCTGGATGTCCAAGCCG
ATCGTGCACCCCTGCATCGCCCCCGGCATGTCCCAGGAGATCGAGGTCGAGGTGGACGGTGACAAGGACGCGCGG
ACCTTCAAGTTTGTCGGCCCCTCGCAGCCCGCCGCCGCCCAGTGCCGCAGCCTGGCGGAGAAGATCCTGAAGAAG
GATGCCGAGTGCAAGCTCGCCCCCTGCTCCTTCAACGGCGTGCACCAGCCGTCCCTGGCCAAGACGTTCGCCAAA
GAGGACGTCTACATCTTCTCCTACTTCTACGACCGCACCAAGCCCCTGGGCATGCCCGACTCCTTCACCGTCCGC
GAGATGCAGGACCTGACGCAGGCCGTCTGCACCGGCAAGGCCGGCTGGGACGTCTTCAGCAGCATGCCCGACGCC
ATGGAGGAGCTCAGCGGCCGCCCGGAGCACTGCCTCGACCTCAACTTCATGCTGGCCCTGCTCCACACCGGCTAC
GAGATGCCCATCGACCGCGAGGTCAAGATTGCCAAGAAGATTAAGGGCAACGAGCTGGGCTGGTGCCTCGGCGCC
AGCTTGCCGCTGTTGGCCCCCGGGTCTGGCTGGAAGTGCAAGATCAAGCAAGTTTACTAG
Gene >Hirsu2|2268
ATGCGAAGGACGTCGGTCTCGTTGCCGACCAAGCACGTTGCCCACGATCCCTACGAGAAGCCCGGCCGCTACCAG
CCGGATCAGCAGAGCCAGGGCCTCCTCGCCACCATGAAGGAGACCTGGATCACCTCCTCCCAGCGGACTCGCTGG
CTGAGGACCGCCGCCGTCGTCTTTGCCGTCATCCTCCTGTTCTGGTGGCTGTCGCCGCGCGGAGTCGAGGTCTAC
AATGAGGGTGAGACAGCGCTTCGTCGCTCGCCCAATCCGCCCTCTTCGCTGACCGACCCCGAGCAGTCTCCCACG
GCAAGGCCAACTCGGGACAGGCTCCCGCCGACTCGACCTACGGCACCGACCGATGCCAGAAATCCTACCACAAGG
ACAAGCCCATCGTGCAGTACGCCCTCATGATCGATGCCGGCAGCACCGGCTCGCGCATCCACGTCTTCAAGTTCA
ACAACTGCGGCCCCATCCCCGAGCTCGAAAAGGAGGAGTTCAAGATGACGGAGAAGACGGTCGGCGGCCTGAGCA
AGCACAAGGACGATCCGGTCGGCGCCGCCAAGACGCTCGACGTCTTGATGCAGCACGCCATGGAGCACGTCCCCG
ACCAGCTCAAGAGCTGCAGCCCCGTCGCCGTCAAGGCCACCGCCGGCCTGCGCCTGATTGGGCCGGAAAAGTCCC
AGGCCATCCTCGACGAGGTCCGCCGACACCTCGAGTCCGACTATCCCTTCCCCGTCGTCTCGGCCGAACAGGACG
GCGTCGCCGTCATGGACGGCTCCCTCGAGGGCGTCTACGCCTGGGTCACGGCCAACTACCTCCTCGGCAAGATCG
GCGGGCCCGACAAGGGCCAGACGGCCGCCACCTTCGACCTCGGCGGCGGCTCCACCCAGATCGTCTTCGAGCCGA
CCTTCAAGGGCGCCCCGGCCGGCGGCATGCCCGACAAGCTGGCCGAGGGCGACCACAAGTACTCGCTCGACTTTG
GCGGCCAGCGCTTCGAGCTGTACCAGCACTCGCATCTCGGCTACGGCCTCATGTCCGCCCGCAAGGCCATCCACA
AGGCCCTCGTCGCCGACGTGGCCGCCAAGGCCTCGGGCAGCGCCTGGATGTCCAAGCCGATCGTGCACCCCTGCA
TCGCCCCCGGCATGTCCCAGGAGATCGAGGTCGAGGTGGACGGTGACAAGGACGCGCGGACCTTCAAGTTTGTCG
GCCCCTCGCAGCCCGCCGCCGCCCAGTGCCGCAGCCTGGCGGAGAAGATCCTGAAGAAGGATGCCGAGTGCAAGC
TCGCCCCCTGCTCCTTCAACGGCGTGCACCAGCCGTCCCTGGCCAAGACGTTCGCCAAAGAGGACGTCTACATCT
TCTCCTACTTCTACGACCGCACCAAGCCCCTGGGCATGCCCGACTCCTTCACCGTCCGCGAGATGCAGGACCTGA
CGCAGGCCGTCTGCACCGGCAAGGCCGGCTGGGACGTCTTCAGCAGCATGCCCGACGCCATGGAGGAGCTCAGCG
GCCGCCCGGAGCACTGCCTCGACCTCAACTTCATGCTGGCCCTGCTCCACACCGGCTACGAGATGCCCATCGACC
GCGAGGTCAAGATTGCCAAGAAGATTAAGGGCAACGAGCTGGGCTGGTGCCTCGGCGCCAGGTGAGTTTTCATCC
CCCGCATCCCTTATCCCTCCTCCGCCTTTGACCACACCCGTGCTGACTCATTTTGTCGTCAGCTTGCCGCTGTTG
GCCCCCGGGTCTGGCTGGAAGTGCAAGATCAAGCAAGTTTACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail