Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2267
Gene name
LocationContig_153:24567..26354
Strand-
Gene length (bp)1787
Transcript length (bp)1731
Coding sequence length (bp)1731
Protein length (aa) 577

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08324 PUL PUL domain 3.8E-56 298 567
PF05903 Peptidase_C97 PPPDE putative peptidase domain 1.3E-31 2 138
PF00085 Thioredoxin Thioredoxin 6.4E-12 193 269
PF13728 TraF F plasmid transfer operon protein 2.1E-05 164 258

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6ICB0|DESI1_HUMAN Desumoylating isopeptidase 1 OS=Homo sapiens GN=DESI1 PE=1 SV=1 3 151 2.0E-28
sp|Q4KM30|DESI1_RAT Desumoylating isopeptidase 1 OS=Rattus norvegicus GN=Desi1 PE=2 SV=1 3 151 1.0E-27
sp|Q9CQT7|DESI1_MOUSE Desumoylating isopeptidase 1 OS=Mus musculus GN=Desi1 PE=1 SV=1 3 151 1.0E-27
sp|Q6GLM5|DESI1_XENLA Desumoylating isopeptidase 1 OS=Xenopus laevis GN=desi1 PE=2 SV=1 3 136 1.0E-26
sp|Q39239|TRXH4_ARATH Thioredoxin H4 OS=Arabidopsis thaliana GN=TRX4 PE=3 SV=2 194 274 4.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6ICB0|DESI1_HUMAN Desumoylating isopeptidase 1 OS=Homo sapiens GN=DESI1 PE=1 SV=1 3 151 2.0E-28
sp|Q4KM30|DESI1_RAT Desumoylating isopeptidase 1 OS=Rattus norvegicus GN=Desi1 PE=2 SV=1 3 151 1.0E-27
sp|Q9CQT7|DESI1_MOUSE Desumoylating isopeptidase 1 OS=Mus musculus GN=Desi1 PE=1 SV=1 3 151 1.0E-27
sp|Q6GLM5|DESI1_XENLA Desumoylating isopeptidase 1 OS=Xenopus laevis GN=desi1 PE=2 SV=1 3 136 1.0E-26
sp|Q39239|TRXH4_ARATH Thioredoxin H4 OS=Arabidopsis thaliana GN=TRX4 PE=3 SV=2 194 274 4.0E-11
sp|Q5ZIV7|DESI2_CHICK Desumoylating isopeptidase 2 OS=Gallus gallus GN=DESI2 PE=2 SV=1 3 123 4.0E-10
sp|Q9D291|DESI2_MOUSE Desumoylating isopeptidase 2 OS=Mus musculus GN=Desi2 PE=1 SV=1 3 123 8.0E-10
sp|Q5R456|DESI2_PONAB Desumoylating isopeptidase 2 OS=Pongo abelii GN=DESI2 PE=2 SV=1 3 123 8.0E-10
sp|Q9BSY9|DESI2_HUMAN Desumoylating isopeptidase 2 OS=Homo sapiens GN=DESI2 PE=1 SV=1 3 123 8.0E-10
sp|A3QRX8|DESI2_PIG Desumoylating isopeptidase 2 OS=Sus scrofa GN=DESI2 PE=2 SV=1 3 123 9.0E-10
sp|Q5XIT6|DESI2_RAT Desumoylating isopeptidase 2 OS=Rattus norvegicus GN=Desi2 PE=2 SV=1 3 123 2.0E-09
sp|O64394|TRXH_WHEAT Thioredoxin H-type OS=Triticum aestivum PE=2 SV=3 187 276 2.0E-09
sp|P29447|THIO3_DICDI Thioredoxin-3 OS=Dictyostelium discoideum GN=trxC PE=3 SV=2 194 275 3.0E-09
sp|Q39362|TRXH2_BRANA Thioredoxin H-type 2 OS=Brassica napus GN=THL-2 PE=2 SV=1 194 274 3.0E-09
sp|Q54KN7|THIO5_DICDI Putative thioredoxin-5 OS=Dictyostelium discoideum GN=trxE PE=3 SV=1 193 278 7.0E-09
sp|Q39241|TRXH5_ARATH Thioredoxin H5 OS=Arabidopsis thaliana GN=TRX5 PE=1 SV=1 194 265 1.0E-08
sp|Q6DC39|DESI2_DANRE Desumoylating isopeptidase 2 OS=Danio rerio GN=desi2 PE=2 SV=1 3 123 1.0E-08
sp|O14463|TRX1_SCHPO Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx1 PE=3 SV=3 194 275 2.0E-08
sp|Q5PQ09|DESI2_XENLA Desumoylating isopeptidase 2 OS=Xenopus laevis GN=desi2 PE=2 SV=1 29 117 2.0E-08
sp|Q6Z4I3|TRH21_ORYSJ Thioredoxin H2-1 OS=Oryza sativa subsp. japonica GN=Os07g0190800 PE=2 SV=1 194 274 2.0E-08
sp|P22217|TRX1_YEAST Thioredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX1 PE=1 SV=3 188 271 4.0E-08
sp|A2YIW7|TRXH_ORYSI Thioredoxin H-type OS=Oryza sativa subsp. indica GN=TRXH PE=1 SV=1 190 274 6.0E-08
sp|Q0D840|TRXH1_ORYSJ Thioredoxin H1 OS=Oryza sativa subsp. japonica GN=TRXH PE=1 SV=1 190 274 6.0E-08
sp|P29451|THIO_MACMU Thioredoxin OS=Macaca mulatta GN=TXN PE=3 SV=2 184 278 7.0E-08
sp|Q9AS75|TRH41_ORYSJ Thioredoxin H4-1 OS=Oryza sativa subsp. japonica GN=Os01g0168200 PE=2 SV=1 151 281 1.0E-07
sp|Q9USR1|TXL1_SCHPO Thioredoxin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=txl1 PE=3 SV=1 202 281 2.0E-07
sp|P34723|THIO_PENCH Thioredoxin OS=Penicillium chrysogenum GN=TRXA PE=1 SV=1 187 279 2.0E-07
sp|P22803|TRX2_YEAST Thioredoxin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX2 PE=1 SV=3 186 271 3.0E-07
sp|Q9SEU6|TRXM4_ARATH Thioredoxin M4, chloroplastic OS=Arabidopsis thaliana GN=At3g15360 PE=2 SV=2 197 267 3.0E-07
sp|Q49WR2|THIO_STAS1 Thioredoxin OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=trxA PE=3 SV=1 186 267 3.0E-07
sp|P08628|THIO_RABIT Thioredoxin OS=Oryctolagus cuniculus GN=TXN PE=1 SV=2 185 278 4.0E-07
sp|Q9XGS0|TRXM_BRANA Thioredoxin M-type, chloroplastic OS=Brassica napus PE=1 SV=1 144 269 4.0E-07
sp|P08629|THIO_CHICK Thioredoxin OS=Gallus gallus GN=TXN PE=3 SV=2 172 278 4.0E-07
sp|Q5HQ29|THIO_STAEQ Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trxA PE=3 SV=1 197 267 4.0E-07
sp|Q8CPL5|THIO_STAES Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trxA PE=3 SV=1 197 267 4.0E-07
sp|P29445|THIO1_DICDI Thioredoxin-1 OS=Dictyostelium discoideum GN=trxA PE=1 SV=1 171 275 5.0E-07
sp|P47370|THIO_MYCGE Thioredoxin OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=trxA PE=3 SV=1 194 269 7.0E-07
sp|O43396|TXNL1_HUMAN Thioredoxin-like protein 1 OS=Homo sapiens GN=TXNL1 PE=1 SV=3 172 275 1.0E-06
sp|Q8GXV2|CXXS2_ARATH Thioredoxin-like protein CXXS2 OS=Arabidopsis thaliana GN=CXXS2 PE=2 SV=1 169 271 1.0E-06
sp|Q9UW02|THIO_COPCM Thioredoxin OS=Coprinus comatus PE=1 SV=1 172 275 1.0E-06
sp|Q920J4|TXNL1_RAT Thioredoxin-like protein 1 OS=Rattus norvegicus GN=Txnl1 PE=1 SV=3 172 275 1.0E-06
sp|Q8CDN6|TXNL1_MOUSE Thioredoxin-like protein 1 OS=Mus musculus GN=Txnl1 PE=1 SV=3 172 275 1.0E-06
sp|P68177|TRXH1_BRANA Thioredoxin H-type 1 OS=Brassica napus GN=THL-1 PE=2 SV=1 194 259 1.0E-06
sp|Q4L5F0|THIO_STAHJ Thioredoxin OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trxA PE=3 SV=1 197 267 1.0E-06
sp|Q9LXZ8|TRH10_ARATH Putative thioredoxin H10 OS=Arabidopsis thaliana GN=At3g56420 PE=3 SV=2 169 271 1.0E-06
sp|P10599|THIO_HUMAN Thioredoxin OS=Homo sapiens GN=TXN PE=1 SV=3 184 278 1.0E-06
sp|P68176|TRXH_BRAOL Thioredoxin H-type OS=Brassica oleracea GN=BOPC17 PE=2 SV=1 194 259 1.0E-06
sp|Q96419|TRXH_FAGES Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV=1 190 265 2.0E-06
sp|O17486|THIO_ECHGR Thioredoxin OS=Echinococcus granulosus GN=TRX PE=3 SV=2 197 275 2.0E-06
sp|Q851R5|TRH22_ORYSJ Thioredoxin H2-2 OS=Oryza sativa subsp. japonica GN=Os03g0800700 PE=2 SV=1 194 278 2.0E-06
sp|Q9V429|THIO2_DROME Thioredoxin-2 OS=Drosophila melanogaster GN=Trx-2 PE=1 SV=2 180 270 2.0E-06
sp|P07887|THIO2_CORNE Thioredoxin C-2 OS=Corynebacterium nephridii PE=1 SV=3 197 269 2.0E-06
sp|Q38879|TRXH2_ARATH Thioredoxin H2 OS=Arabidopsis thaliana GN=TRX2 PE=2 SV=2 194 277 2.0E-06
sp|P07591|TRXM_SPIOL Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 197 269 2.0E-06
sp|Q9BDJ3|THIO_CALJA Thioredoxin OS=Callithrix jacchus GN=TXN PE=3 SV=3 184 278 2.0E-06
sp|O48737|TRXM1_ARATH Thioredoxin M1, chloroplastic OS=Arabidopsis thaliana GN=At1g03680 PE=2 SV=1 165 265 2.0E-06
sp|Q5UR29|TR548_MIMIV Thioredoxin-like protein R548 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R548 PE=3 SV=1 169 274 2.0E-06
sp|O97508|THIO_HORSE Thioredoxin OS=Equus caballus GN=TXN PE=3 SV=3 184 278 2.0E-06
sp|O96952|THIO_GEOCY Thioredoxin OS=Geodia cydonium GN=THIO PE=3 SV=1 172 275 3.0E-06
sp|Q42403|TRXH3_ARATH Thioredoxin H3 OS=Arabidopsis thaliana GN=TRX3 PE=1 SV=1 194 275 3.0E-06
sp|Q6XHI1|THIO2_DROYA Thioredoxin-2 OS=Drosophila yakuba GN=Trx-2 PE=3 SV=1 180 270 3.0E-06
sp|P50413|THIO_SHEEP Thioredoxin OS=Ovis aries GN=TXN PE=3 SV=2 184 278 4.0E-06
sp|O64432|TRXH_BRACM Thioredoxin H-type OS=Brassica campestris GN=PEC-2 PE=2 SV=1 194 259 4.0E-06
sp|P82460|THIO_PIG Thioredoxin OS=Sus scrofa GN=TXN PE=1 SV=3 184 278 4.0E-06
sp|Q8TFM8|THIO_FUSCU Thioredoxin-like protein OS=Fusarium culmorum PE=1 SV=1 194 282 4.0E-06
sp|Q6GA69|THIO_STAAS Thioredoxin OS=Staphylococcus aureus (strain MSSA476) GN=trxA PE=3 SV=1 197 267 5.0E-06
sp|Q2FHT6|THIO_STAA3 Thioredoxin OS=Staphylococcus aureus (strain USA300) GN=trxA PE=3 SV=1 197 267 5.0E-06
sp|Q2FZD2|THIO_STAA8 Thioredoxin OS=Staphylococcus aureus (strain NCTC 8325) GN=trxA PE=2 SV=1 197 267 5.0E-06
sp|Q2YXD0|THIO_STAAB Thioredoxin OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=trxA PE=3 SV=1 197 267 5.0E-06
sp|Q5HGT9|THIO_STAAC Thioredoxin OS=Staphylococcus aureus (strain COL) GN=trxA PE=3 SV=1 197 267 5.0E-06
sp|P0A0K4|THIO_STAAM Thioredoxin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trxA PE=3 SV=1 197 267 5.0E-06
sp|P99122|THIO_STAAN Thioredoxin OS=Staphylococcus aureus (strain N315) GN=trxA PE=1 SV=1 197 267 5.0E-06
sp|Q6GHU0|THIO_STAAR Thioredoxin OS=Staphylococcus aureus (strain MRSA252) GN=trxA PE=3 SV=1 197 267 5.0E-06
sp|P0A0K6|THIO_STAAU Thioredoxin OS=Staphylococcus aureus GN=trxA PE=1 SV=1 197 267 5.0E-06
sp|P0A0K5|THIO_STAAW Thioredoxin OS=Staphylococcus aureus (strain MW2) GN=trxA PE=3 SV=1 197 267 5.0E-06
sp|O97680|THIO_BOVIN Thioredoxin OS=Bos taurus GN=TXN PE=3 SV=3 184 278 5.0E-06
sp|Q9ZPH2|GRS17_ARATH Monothiol glutaredoxin-S17 OS=Arabidopsis thaliana GN=GRXS17 PE=1 SV=1 190 286 6.0E-06
sp|P10639|THIO_MOUSE Thioredoxin OS=Mus musculus GN=Txn PE=1 SV=3 172 274 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0045454 cell redox homeostasis Yes
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0042592 homeostatic process No
GO:0019725 cellular homeostasis No
GO:0065008 regulation of biological quality No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2267
MDVHLLIYDLSHGLARQMSMGLLGFQLDALYHTSIELNGREYVYDGGIIAIVPGSSHLGQPMQKLRLGTTHLPID
VIEEYLDSLRPIFTLEAYDIFRHNCNNFTDAFSNFLVGKGIPTDISTMPQAVLDSPMGKMLFAQLTQGVSSGRPN
GSILGLEQSAQACPSQVPKERVQVVSRPEDLIPALDDAMGSCAVIFFTSATCPPCKALYPIFDQLADEFDGQASF
IKIDVAQPEAGPIAQAYSVSATPTFVTFLKGEQENRWTGADPASLRGNVQLLVQMAHPAHPHERLPLPSFSNPGA
KPVLFPKVPPVAKLLAKMGEETAEKPEVQSLTAFIETRSREGAPNAVLPDMGRLSGLMHDSVARLAPDVLFAVVD
VFRCVLVDARVSGYFAEEQAHKTVRLVLDHVNERDSPYALRLVTLQMACNLFSTPLFPDQILGHAALRKSIIQLI
LFSFLDYDHTSIRVAASSLLFNLALSNRRARDKRSNARLPAEDEVELAAWAVEAIDQEKSSAEALHGMLLALGHL
AYGADLDGELVDLLRALDAEGTISSKSRAFPDEKLVREVADEMLGKGLARP*
Coding >Hirsu2|2267
ATGGACGTCCATCTGCTCATCTACGACCTCTCCCACGGCCTCGCCCGGCAAATGTCCATGGGTTTGTTGGGCTTC
CAGCTCGACGCCCTCTACCACACTTCCATCGAGCTCAACGGGCGTGAGTACGTGTACGATGGCGGCATCATCGCC
ATCGTCCCCGGCTCCTCCCATCTCGGCCAGCCAATGCAAAAGTTGCGCCTTGGCACGACGCACCTACCCATCGAC
GTTATCGAGGAGTACTTGGACTCGTTACGACCCATATTCACCCTCGAGGCATACGACATCTTCCGTCACAACTGT
AACAACTTTACCGATGCCTTTTCCAACTTCCTGGTCGGCAAGGGCATCCCGACCGACATCTCAACCATGCCTCAG
GCCGTTCTAGACTCCCCCATGGGCAAGATGCTGTTCGCCCAGCTCACGCAGGGCGTCAGCTCAGGCCGACCCAAC
GGCTCCATACTCGGACTCGAGCAAAGCGCGCAGGCCTGTCCGAGCCAGGTGCCCAAGGAGAGGGTTCAAGTCGTG
TCCCGGCCGGAGGATCTGATCCCCGCCCTAGACGACGCCATGGGATCGTGCGCCGTCATCTTTTTCACGTCGGCG
ACCTGTCCGCCGTGCAAGGCTCTGTATCCCATCTTCGACCAACTGGCCGACGAGTTCGACGGCCAGGCATCCTTC
ATCAAGATCGACGTGGCCCAGCCCGAGGCAGGACCGATTGCCCAAGCCTACTCCGTCAGCGCGACGCCGACATTC
GTCACCTTCCTGAAGGGCGAGCAGGAGAACCGGTGGACCGGCGCTGATCCAGCAAGCCTCCGGGGCAACGTCCAG
CTCCTGGTGCAGATGGCGCATCCGGCTCATCCTCACGAGAGGCTGCCTTTACCGAGCTTCTCCAATCCCGGAGCC
AAACCGGTTCTGTTCCCCAAAGTACCGCCGGTGGCCAAGCTGCTGGCCAAGATGGGGGAGGAAACGGCAGAGAAG
CCCGAGGTCCAGAGCTTGACGGCCTTCATCGAGACGCGGAGCCGCGAGGGGGCGCCGAACGCAGTCTTGCCAGAC
ATGGGCCGGCTGTCCGGCTTGATGCACGACTCGGTCGCGCGGCTGGCGCCCGACGTCCTGTTCGCCGTCGTCGAC
GTCTTCCGCTGCGTCCTCGTCGACGCCCGCGTCAGCGGCTACTTCGCCGAGGAGCAGGCACACAAGACGGTGCGC
CTCGTTCTGGATCACGTCAACGAGCGAGACAGCCCTTATGCGCTTCGGCTCGTCACGCTACAGATGGCCTGCAAC
TTGTTTTCCACGCCGCTGTTCCCGGACCAGATACTCGGGCACGCCGCTCTCCGCAAGTCCATCATCCAGCTGATC
TTGTTCAGCTTTCTCGACTATGACCACACCAGCATCCGCGTGGCGGCATCCTCGCTGCTATTCAACCTGGCGCTG
TCGAACCGTCGCGCGCGAGACAAGCGGTCCAACGCGAGGCTACCGGCGGAGGACGAGGTCGAACTGGCCGCGTGG
GCGGTCGAGGCCATCGACCAGGAGAAGAGCTCGGCTGAGGCGTTGCACGGCATGTTGCTGGCGCTCGGCCACCTC
GCGTACGGCGCCGACCTCGACGGCGAGCTGGTCGACCTGCTCAGGGCGCTGGACGCCGAGGGAACCATATCCTCC
AAGAGCAGGGCCTTCCCGGACGAGAAGCTGGTGCGCGAGGTGGCCGACGAGATGCTGGGCAAGGGCCTAGCGAGG
CCATAG
Transcript >Hirsu2|2267
ATGGACGTCCATCTGCTCATCTACGACCTCTCCCACGGCCTCGCCCGGCAAATGTCCATGGGTTTGTTGGGCTTC
CAGCTCGACGCCCTCTACCACACTTCCATCGAGCTCAACGGGCGTGAGTACGTGTACGATGGCGGCATCATCGCC
ATCGTCCCCGGCTCCTCCCATCTCGGCCAGCCAATGCAAAAGTTGCGCCTTGGCACGACGCACCTACCCATCGAC
GTTATCGAGGAGTACTTGGACTCGTTACGACCCATATTCACCCTCGAGGCATACGACATCTTCCGTCACAACTGT
AACAACTTTACCGATGCCTTTTCCAACTTCCTGGTCGGCAAGGGCATCCCGACCGACATCTCAACCATGCCTCAG
GCCGTTCTAGACTCCCCCATGGGCAAGATGCTGTTCGCCCAGCTCACGCAGGGCGTCAGCTCAGGCCGACCCAAC
GGCTCCATACTCGGACTCGAGCAAAGCGCGCAGGCCTGTCCGAGCCAGGTGCCCAAGGAGAGGGTTCAAGTCGTG
TCCCGGCCGGAGGATCTGATCCCCGCCCTAGACGACGCCATGGGATCGTGCGCCGTCATCTTTTTCACGTCGGCG
ACCTGTCCGCCGTGCAAGGCTCTGTATCCCATCTTCGACCAACTGGCCGACGAGTTCGACGGCCAGGCATCCTTC
ATCAAGATCGACGTGGCCCAGCCCGAGGCAGGACCGATTGCCCAAGCCTACTCCGTCAGCGCGACGCCGACATTC
GTCACCTTCCTGAAGGGCGAGCAGGAGAACCGGTGGACCGGCGCTGATCCAGCAAGCCTCCGGGGCAACGTCCAG
CTCCTGGTGCAGATGGCGCATCCGGCTCATCCTCACGAGAGGCTGCCTTTACCGAGCTTCTCCAATCCCGGAGCC
AAACCGGTTCTGTTCCCCAAAGTACCGCCGGTGGCCAAGCTGCTGGCCAAGATGGGGGAGGAAACGGCAGAGAAG
CCCGAGGTCCAGAGCTTGACGGCCTTCATCGAGACGCGGAGCCGCGAGGGGGCGCCGAACGCAGTCTTGCCAGAC
ATGGGCCGGCTGTCCGGCTTGATGCACGACTCGGTCGCGCGGCTGGCGCCCGACGTCCTGTTCGCCGTCGTCGAC
GTCTTCCGCTGCGTCCTCGTCGACGCCCGCGTCAGCGGCTACTTCGCCGAGGAGCAGGCACACAAGACGGTGCGC
CTCGTTCTGGATCACGTCAACGAGCGAGACAGCCCTTATGCGCTTCGGCTCGTCACGCTACAGATGGCCTGCAAC
TTGTTTTCCACGCCGCTGTTCCCGGACCAGATACTCGGGCACGCCGCTCTCCGCAAGTCCATCATCCAGCTGATC
TTGTTCAGCTTTCTCGACTATGACCACACCAGCATCCGCGTGGCGGCATCCTCGCTGCTATTCAACCTGGCGCTG
TCGAACCGTCGCGCGCGAGACAAGCGGTCCAACGCGAGGCTACCGGCGGAGGACGAGGTCGAACTGGCCGCGTGG
GCGGTCGAGGCCATCGACCAGGAGAAGAGCTCGGCTGAGGCGTTGCACGGCATGTTGCTGGCGCTCGGCCACCTC
GCGTACGGCGCCGACCTCGACGGCGAGCTGGTCGACCTGCTCAGGGCGCTGGACGCCGAGGGAACCATATCCTCC
AAGAGCAGGGCCTTCCCGGACGAGAAGCTGGTGCGCGAGGTGGCCGACGAGATGCTGGGCAAGGGCCTAGCGAGG
CCATAG
Gene >Hirsu2|2267
ATGGACGTCCATCTGCTCATCTACGACCTCTCCCACGGCCTCGCCCGGCAAATGTCCATGGGTTTGTTGGGCTTC
CAGCTCGACGCCCTCTACCACACTTCCATCGAGCTCAACGGGCGTGAGTACGTGTACGATGGCGGCATCATCGCC
ATCGTCCCCGGCTCCTCCCATCTCGGCCAGCCAATGCAAAAGTTGCGCCTTGGCACGACGCACCTACCCATCGAC
GTTATCGAGGAGTACTTGGACTCGTTACGACCCATATTCACCCTCGAGGTAATGACCCCGTGTGCTTGATGTCCT
GCCAGCCACTGATGCGGTTACGCCCCCAGGCATACGACATCTTCCGTCACAACTGTAACAACTTTACCGATGCCT
TTTCCAACTTCCTGGTCGGCAAGGGCATCCCGACCGACATCTCAACCATGCCTCAGGCCGTTCTAGACTCCCCCA
TGGGCAAGATGCTGTTCGCCCAGCTCACGCAGGGCGTCAGCTCAGGCCGACCCAACGGCTCCATACTCGGACTCG
AGCAAAGCGCGCAGGCCTGTCCGAGCCAGGTGCCCAAGGAGAGGGTTCAAGTCGTGTCCCGGCCGGAGGATCTGA
TCCCCGCCCTAGACGACGCCATGGGATCGTGCGCCGTCATCTTTTTCACGTCGGCGACCTGTCCGCCGTGCAAGG
CTCTGTATCCCATCTTCGACCAACTGGCCGACGAGTTCGACGGCCAGGCATCCTTCATCAAGATCGACGTGGCCC
AGCCCGAGGCAGGACCGATTGCCCAAGCCTACTCCGTCAGCGCGACGCCGACATTCGTCACCTTCCTGAAGGGCG
AGCAGGAGAACCGGTGGACCGGCGCTGATCCAGCAAGCCTCCGGGGCAACGTCCAGCTCCTGGTGCAGATGGCGC
ATCCGGCTCATCCTCACGAGAGGCTGCCTTTACCGAGCTTCTCCAATCCCGGAGCCAAACCGGTTCTGTTCCCCA
AAGTACCGCCGGTGGCCAAGCTGCTGGCCAAGATGGGGGAGGAAACGGCAGAGAAGCCCGAGGTCCAGAGCTTGA
CGGCCTTCATCGAGACGCGGAGCCGCGAGGGGGCGCCGAACGCAGTCTTGCCAGACATGGGCCGGCTGTCCGGCT
TGATGCACGACTCGGTCGCGCGGCTGGCGCCCGACGTCCTGTTCGCCGTCGTCGACGTCTTCCGCTGCGTCCTCG
TCGACGCCCGCGTCAGCGGCTACTTCGCCGAGGAGCAGGCACACAAGACGGTGCGCCTCGTTCTGGATCACGTCA
ACGAGCGAGACAGCCCTTATGCGCTTCGGCTCGTCACGCTACAGATGGCCTGCAACTTGTTTTCCACGCCGCTGT
TCCCGGACCAGATACTCGGGCACGCCGCTCTCCGCAAGTCCATCATCCAGCTGATCTTGTTCAGCTTTCTCGACT
ATGACCACACCAGCATCCGCGTGGCGGCATCCTCGCTGCTATTCAACCTGGCGCTGTCGAACCGTCGCGCGCGAG
ACAAGCGGTCCAACGCGAGGCTACCGGCGGAGGACGAGGTCGAACTGGCCGCGTGGGCGGTCGAGGCCATCGACC
AGGAGAAGAGCTCGGCTGAGGCGTTGCACGGCATGTTGCTGGCGCTCGGCCACCTCGCGTACGGCGCCGACCTCG
ACGGCGAGCTGGTCGACCTGCTCAGGGCGCTGGACGCCGAGGGAACCATATCCTCCAAGAGCAGGGCCTTCCCGG
ACGAGAAGCTGGTGCGCGAGGTGGCCGACGAGATGCTGGGCAAGGGCCTAGCGAGGCCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail