Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2260
Gene name
LocationContig_1529:4418..6036
Strand+
Gene length (bp)1618
Transcript length (bp)1569
Coding sequence length (bp)1569
Protein length (aa) 523

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04855 SNF5 SNF5 / SMARCB1 / INI1 1.5E-65 152 378

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09699|SNF5_SCHPO SWI/SNF chromatin-remodeling complex subunit snf5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf5 PE=1 SV=1 102 413 7.0E-57
sp|P18480|SNF5_YEAST SWI/SNF chromatin-remodeling complex subunit SNF5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF5 PE=1 SV=3 149 415 7.0E-44
sp|Q6DFM1|SNF5_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Xenopus tropicalis GN=smarcb1 PE=2 SV=1 121 385 7.0E-32
sp|Q6GQ82|SNF5_XENLA SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Xenopus laevis GN=smarcb1 PE=2 SV=1 121 385 1.0E-31
sp|Q5U379|SNF5_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1-A OS=Danio rerio GN=smarcb1a PE=2 SV=1 121 385 3.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09699|SNF5_SCHPO SWI/SNF chromatin-remodeling complex subunit snf5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf5 PE=1 SV=1 102 413 7.0E-57
sp|P18480|SNF5_YEAST SWI/SNF chromatin-remodeling complex subunit SNF5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF5 PE=1 SV=3 149 415 7.0E-44
sp|Q6DFM1|SNF5_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Xenopus tropicalis GN=smarcb1 PE=2 SV=1 121 385 7.0E-32
sp|Q6GQ82|SNF5_XENLA SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Xenopus laevis GN=smarcb1 PE=2 SV=1 121 385 1.0E-31
sp|Q5U379|SNF5_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1-A OS=Danio rerio GN=smarcb1a PE=2 SV=1 121 385 3.0E-31
sp|Q5BIN2|SNF5_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Bos taurus GN=SMARCB1 PE=2 SV=1 121 385 7.0E-31
sp|Q9Z0H3|SNF5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Mus musculus GN=Smarcb1 PE=1 SV=1 121 385 8.0E-31
sp|Q12824|SNF5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Homo sapiens GN=SMARCB1 PE=1 SV=2 121 385 8.0E-31
sp|Q5ZK40|SNF5_CHICK SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Gallus gallus GN=SMARCB1 PE=2 SV=1 121 385 1.0E-30
sp|O42467|SNF5_TETFL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Tetraodon fluviatilis GN=smarcb1 PE=3 SV=1 121 386 2.0E-30
sp|Q9USM3|SFH1_SCHPO Chromatin structure-remodeling complex subunit sfh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sfh1 PE=1 SV=1 144 344 3.0E-17
sp|P93045|BSH_ARATH Chromatin structure-remodeling complex protein BSH OS=Arabidopsis thaliana GN=BSH PE=1 SV=2 157 319 5.0E-16
sp|Q6C9N2|SFH1_YARLI Chromatin structure-remodeling complex subunit SFH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SFH1 PE=3 SV=1 147 386 3.0E-15
sp|Q6CSR7|SFH1_KLULA Chromatin structure-remodeling complex subunit SFH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SFH1 PE=3 SV=1 142 306 6.0E-15
sp|Q6FTV3|SFH1_CANGA Chromatin structure-remodeling complex subunit SFH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SFH1 PE=3 SV=1 150 382 2.0E-14
sp|Q754R8|SFH1_ASHGO Chromatin structure-remodeling complex subunit SFH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SFH1 PE=3 SV=1 159 320 3.0E-13
sp|Q06168|SFH1_YEAST Chromatin structure-remodeling complex subunit SFH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFH1 PE=1 SV=1 115 382 7.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0000228 nuclear chromosome Yes
GO:0006338 chromatin remodeling Yes
GO:0006325 chromatin organization No
GO:0071840 cellular component organization or biogenesis No
GO:0016043 cellular component organization No
GO:0044422 organelle part No
GO:0005694 chromosome No
GO:0044424 intracellular part No
GO:0044428 nuclear part No
GO:0043228 non-membrane-bounded organelle No
GO:0044446 intracellular organelle part No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043226 organelle No
GO:0044464 cell part No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2260
MASQPSASAPETGPAMAAATPADDKDATPASASPADMPVRTKESFNRLMVERYTTRDALAAAALGQQLQQTRKTS
QEMRDKIQEYRLLRNEYKAWFPPARLYGEGYNGFANGHTENQMQPPSSRIVYPSQRPRPGRRTTPLLKYSRKDML
KQAEQHEELVPLRLEVEWDKIRLRDTFTWNLHERILHVELFAAQLVEDMGLKPPAANHVYDQIVHQMREQLNDFY
PFAFSEEDALDPELPYSAYKNDEMRILIKLNITIGQHTLVDQFEWEINNPSNSPEEFAANMARDLSLSGEFTTAI
AHCIREQTQLFTKSLYSVGHPFDGRPIEDSDLVSAFLQTPLTSVFRPQQQAKEYAPYMYEMSEADLERNEMVFSR
EQRRQKRSINRRGGPQLPDLRERQRTIRTLIVSSVLPGAAANVDDSRLYKRVAGAARKRMARDGDLSESDESEDS
APESPAPSQLAVGTARTRGMRGAASAAQQRMANLGRSETPEVSAALHHHETRTSRRFREETEEPAHLATTAT*
Coding >Hirsu2|2260
ATGGCCTCCCAGCCGTCCGCGTCGGCGCCTGAGACGGGGCCCGCCATGGCGGCCGCGACGCCGGCCGACGACAAG
GACGCGACGCCGGCGTCGGCCTCGCCGGCCGACATGCCCGTCCGCACCAAGGAGTCCTTCAACCGGCTGATGGTG
GAGCGCTACACGACGCGCGACGCCCTGGCCGCCGCCGCCCTCGGCCAGCAGCTGCAGCAGACGCGCAAGACGTCG
CAGGAGATGCGGGACAAGATCCAGGAGTACCGCCTGCTTCGCAACGAGTACAAGGCCTGGTTCCCGCCGGCCAGG
CTCTACGGCGAGGGCTACAACGGCTTCGCCAACGGCCACACCGAGAACCAGATGCAGCCGCCGTCGTCGCGCATC
GTCTACCCGTCCCAGCGGCCGCGTCCCGGCCGGCGGACGACCCCCCTGCTCAAGTACAGCCGCAAGGACATGCTC
AAGCAGGCCGAGCAGCACGAGGAGCTGGTCCCGCTGCGGCTCGAGGTCGAGTGGGACAAGATCCGGCTGCGCGAC
ACCTTCACCTGGAACCTGCACGAGCGCATCCTCCACGTCGAGCTCTTCGCCGCCCAGCTGGTCGAGGACATGGGG
CTCAAGCCGCCGGCCGCCAACCACGTCTACGACCAGATCGTCCACCAGATGCGCGAGCAGCTCAACGACTTCTAC
CCCTTTGCCTTCTCCGAGGAGGACGCGCTCGACCCCGAACTCCCCTACTCCGCCTACAAGAACGACGAGATGCGG
ATCCTCATCAAGCTCAACATCACCATCGGCCAGCACACCCTCGTCGACCAGTTCGAGTGGGAGATCAACAACCCG
TCCAACTCGCCCGAGGAGTTCGCCGCCAACATGGCCCGCGACCTGTCGCTGAGCGGCGAGTTCACGACGGCCATC
GCCCACTGCATCCGCGAGCAGACCCAGCTCTTCACCAAGAGCCTCTACAGCGTCGGCCACCCCTTCGACGGCCGG
CCCATCGAGGACTCGGACCTGGTGTCCGCCTTCCTGCAGACCCCCCTGACCTCCGTCTTCCGACCGCAGCAGCAG
GCCAAGGAGTACGCGCCCTACATGTACGAGATGAGCGAGGCCGACCTGGAGCGGAACGAGATGGTCTTCTCGCGC
GAGCAGCGGCGCCAAAAACGGTCCATCAACCGCCGCGGCGGGCCGCAGCTGCCCGACCTGAGGGAGAGGCAACGC
ACCATCCGCACCCTCATCGTCTCGTCCGTCCTGCCCGGCGCCGCCGCCAACGTCGACGACAGCCGGCTGTACAAG
AGGGTCGCCGGCGCGGCGCGCAAGCGCATGGCCCGCGACGGCGACCTGTCCGAGTCGGACGAGAGCGAGGACTCG
GCCCCCGAGTCGCCCGCCCCGTCGCAGCTGGCCGTCGGCACCGCCCGCACGAGGGGGATGCGCGGCGCCGCCTCG
GCCGCCCAGCAGAGGATGGCCAACCTGGGCCGCTCCGAGACGCCCGAGGTCAGCGCCGCCCTGCACCACCACGAG
ACGAGGACGTCCCGCCGCTTCCGGGAGGAGACGGAGGAGCCGGCCCACCTGGCGACTACCGCGACCTGA
Transcript >Hirsu2|2260
ATGGCCTCCCAGCCGTCCGCGTCGGCGCCTGAGACGGGGCCCGCCATGGCGGCCGCGACGCCGGCCGACGACAAG
GACGCGACGCCGGCGTCGGCCTCGCCGGCCGACATGCCCGTCCGCACCAAGGAGTCCTTCAACCGGCTGATGGTG
GAGCGCTACACGACGCGCGACGCCCTGGCCGCCGCCGCCCTCGGCCAGCAGCTGCAGCAGACGCGCAAGACGTCG
CAGGAGATGCGGGACAAGATCCAGGAGTACCGCCTGCTTCGCAACGAGTACAAGGCCTGGTTCCCGCCGGCCAGG
CTCTACGGCGAGGGCTACAACGGCTTCGCCAACGGCCACACCGAGAACCAGATGCAGCCGCCGTCGTCGCGCATC
GTCTACCCGTCCCAGCGGCCGCGTCCCGGCCGGCGGACGACCCCCCTGCTCAAGTACAGCCGCAAGGACATGCTC
AAGCAGGCCGAGCAGCACGAGGAGCTGGTCCCGCTGCGGCTCGAGGTCGAGTGGGACAAGATCCGGCTGCGCGAC
ACCTTCACCTGGAACCTGCACGAGCGCATCCTCCACGTCGAGCTCTTCGCCGCCCAGCTGGTCGAGGACATGGGG
CTCAAGCCGCCGGCCGCCAACCACGTCTACGACCAGATCGTCCACCAGATGCGCGAGCAGCTCAACGACTTCTAC
CCCTTTGCCTTCTCCGAGGAGGACGCGCTCGACCCCGAACTCCCCTACTCCGCCTACAAGAACGACGAGATGCGG
ATCCTCATCAAGCTCAACATCACCATCGGCCAGCACACCCTCGTCGACCAGTTCGAGTGGGAGATCAACAACCCG
TCCAACTCGCCCGAGGAGTTCGCCGCCAACATGGCCCGCGACCTGTCGCTGAGCGGCGAGTTCACGACGGCCATC
GCCCACTGCATCCGCGAGCAGACCCAGCTCTTCACCAAGAGCCTCTACAGCGTCGGCCACCCCTTCGACGGCCGG
CCCATCGAGGACTCGGACCTGGTGTCCGCCTTCCTGCAGACCCCCCTGACCTCCGTCTTCCGACCGCAGCAGCAG
GCCAAGGAGTACGCGCCCTACATGTACGAGATGAGCGAGGCCGACCTGGAGCGGAACGAGATGGTCTTCTCGCGC
GAGCAGCGGCGCCAAAAACGGTCCATCAACCGCCGCGGCGGGCCGCAGCTGCCCGACCTGAGGGAGAGGCAACGC
ACCATCCGCACCCTCATCGTCTCGTCCGTCCTGCCCGGCGCCGCCGCCAACGTCGACGACAGCCGGCTGTACAAG
AGGGTCGCCGGCGCGGCGCGCAAGCGCATGGCCCGCGACGGCGACCTGTCCGAGTCGGACGAGAGCGAGGACTCG
GCCCCCGAGTCGCCCGCCCCGTCGCAGCTGGCCGTCGGCACCGCCCGCACGAGGGGGATGCGCGGCGCCGCCTCG
GCCGCCCAGCAGAGGATGGCCAACCTGGGCCGCTCCGAGACGCCCGAGGTCAGCGCCGCCCTGCACCACCACGAG
ACGAGGACGTCCCGCCGCTTCCGGGAGGAGACGGAGGAGCCGGCCCACCTGGCGACTACCGCGACCTGA
Gene >Hirsu2|2260
ATGGCCTCCCAGCCGTCCGCGTCGGCGCCTGAGACGGGGCCCGCCATGGCGGCCGCGACGCCGGCCGACGACAAG
GACGCGACGCCGGCGTCGGCCTCGCCGGCCGACATGCCCGTCCGCACCAAGGAGTCCTTCAACCGGCTGATGGTG
GAGCGCTACACGACGCGCGACGCCCTGGCCGCCGCCGCCCTCGGCCAGCAGCTGCAGCAGACGCGCAAGACGTCG
CAGGAGATGCGGGACAAGATCCAGGAGTACCGCCTGCTTCGCAACGAGTACAAGGCCTGGTTCCCGCCGGCCAGG
CTCTACGGCGAGGGCTACAACGGCTTCGCCAACGGCCACACCGAGAACCAGATGCAGCCGCCGTCGTCGCGCATC
GTCTACCCGTCCCAGCGGCCGCGTCCCGGCCGGCGGACGACCCCCCTGCTCAAGTACAGCCGCAAGGACATGCTC
AAGCAGGCCGAGCAGCACGAGGAGCTGGTCCCGCTGCGGCTCGAGGTCGAGTGGGACAAGATCCGGCTGCGCGAC
ACCTTCACCTGGAACCTGCACGAGCGCATCCTCCACGTCGAGCTCTTCGCCGCCCAGCTGGTCGAGGACATGGGG
CTCAAGCCGCCGGCCGCCAACCACGTCTACGACCAGATCGTCCACCAGATGCGCGAGCAGCTCAACGACTTCTAC
CCCTTTGCCTTCTCCGAGGAGGACGCGCTCGACCCCGAACTCCCCTACTCCGCCTACAAGAACGACGAGATGCGG
ATCCTCATCAAGCTCAACATCACCATCGGCCAGCACACCCTCGTCGACCAGTTCGAGTGGGAGATCAACAACCCG
TCCAACTCGCCCGAGGAGTTCGCCGCCAACATGGCCCGCGACCTGTCGCTGAGCGGCGAGTTCACGACGGCCATC
GCCCACTGCATCCGCGAGCAGACCCAGCTCTTCACCAAGAGCCTCTACAGCGTCGGCCACCCCTTCGACGGCCGG
CCCATCGAGGACTCGGACCTGGTGTCCGCCTTCCTGCAGACCCCCCTGACCTCCGTCTTCCGACCGCAGCAGCAG
GCCAAGGAGTACGCGCCCTACATGTACGAGATGAGCGAGGCCGACCTGGAGCGGAACGAGATGGTCTTCTCGCGC
GAGCAGCGGCGCCAAAAACGGTCCATCAACCGCCGCGGCGGGCCGCAGCTGCCCGACCTGAGGGAGAGGCAACGC
ACCATCCGCACCCTCATCGTCTCGTCCGTCCTGCCCGGCGCCGCCGCCAACGTCGACGACAGCCGGCTGTACAAG
AGGGTCGCCGGCGCGGCGCGCAAGCGCATGGCCCGCGACGGCGACCTGTCCGAGTCGGACGAGAGCGAGGACTCG
GCCCCCGAGTCGCCCGCCCCGTCGCAGCTGGCCGTCGGCACCGCCCGCACGAGGGGGATGCGCGGCGCCGCCTCG
GCCGCCCAGCAGAGGATGGCCAACCTGGGCCGCTCCGAGACGCCCGAGGTCAGCGCCGCCCTGCACCACCACGAG
ACGAGGACGTCCCGCCGCTTCCGGGAGGAGACGGAGGAGCCGGCCCACCTGTGGGTGACGCTCAAGGTCAACAAG
GACAAGCTGCGGCGGGTGATGAAGGGCGACTACCGCGACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail