Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2257
Gene name
LocationContig_1528:1143..2182
Strand-
Gene length (bp)1039
Transcript length (bp)837
Coding sequence length (bp)837
Protein length (aa) 279

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09597 IGR IGR protein motif 3.0E-23 67 122

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q75EY2|FYV4_ASHGO Protein FYV4, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FYV4 PE=3 SV=1 56 136 2.0E-10
sp|Q6FW13|FYV4_CANGA Protein FYV4, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FYV4 PE=3 SV=1 56 123 1.0E-08
sp|Q6C3R3|FYV4_YARLI Protein FYV4, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FYV4 PE=3 SV=2 67 123 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2257
MDKDGTSRSAMRAEQLRPCLRLLLARGGVGGGAGQTTTTTTTTTRGLHKTRPPPTVPAPRPFVPDVQTFLTLIGR
GMNKHTAKFPTWESLFSLTSPELKALGVEPARSRRYLLQWLDRYRAGDLGPGGDFQHVRDGLALLKVALPPASVP
SSARWVVNVPLERGEAAAATATAETAAAAAAETTTTAAAGTTAATPLPPKVVRPGGYVVRGLRTIVGPYATQLPG
SGGATVKVREGMWEFRRGRKIDGGERRRTEIRFKRRSAERREEREAEAGFGAV*
Coding >Hirsu2|2257
ATGGATAAGGACGGCACCTCTAGATCAGCCATGAGAGCAGAACAGCTGCGGCCGTGCCTGCGACTGCTGCTGGCA
CGGGGGGGCGTCGGCGGCGGCGCGGGCCAGACGACGACGACGACGACGACGACGACGAGAGGGCTTCACAAGACG
CGACCGCCCCCGACGGTGCCGGCGCCGCGGCCGTTCGTGCCCGATGTGCAGACCTTCCTCACGCTCATCGGGCGG
GGCATGAACAAGCACACGGCCAAGTTCCCGACGTGGGAGTCGCTCTTCTCCCTCACGTCGCCCGAGCTCAAGGCG
CTCGGGGTCGAGCCGGCGCGGAGCCGGCGGTACCTGCTGCAGTGGCTGGACCGGTACCGGGCCGGCGACTTGGGC
CCCGGCGGCGACTTCCAGCACGTCAGGGACGGGCTGGCCTTGCTCAAGGTGGCGTTGCCGCCGGCGTCGGTGCCC
AGCAGCGCCAGGTGGGTGGTCAATGTGCCGCTCGAGCGGGGCGAGGCGGCGGCGGCTACGGCGACGGCGGAGACG
GCGGCGGCGGCTGCGGCGGAGACGACGACGACGGCTGCGGCGGGGACGACGGCCGCGACGCCGCTGCCGCCCAAG
GTCGTGCGGCCGGGCGGGTACGTCGTCAGGGGCCTCAGGACCATCGTCGGGCCGTACGCGACGCAGCTGCCGGGC
TCGGGCGGCGCCACCGTCAAGGTCAGAGAGGGCATGTGGGAGTTCCGACGCGGACGCAAGATCGATGGCGGCGAG
CGGCGCCGCACCGAGATCCGGTTCAAGAGGCGCTCTGCCGAGCGCAGGGAGGAGCGCGAGGCCGAGGCGGGGTTC
GGCGCCGTGTAA
Transcript >Hirsu2|2257
ATGGATAAGGACGGCACCTCTAGATCAGCCATGAGAGCAGAACAGCTGCGGCCGTGCCTGCGACTGCTGCTGGCA
CGGGGGGGCGTCGGCGGCGGCGCGGGCCAGACGACGACGACGACGACGACGACGACGAGAGGGCTTCACAAGACG
CGACCGCCCCCGACGGTGCCGGCGCCGCGGCCGTTCGTGCCCGATGTGCAGACCTTCCTCACGCTCATCGGGCGG
GGCATGAACAAGCACACGGCCAAGTTCCCGACGTGGGAGTCGCTCTTCTCCCTCACGTCGCCCGAGCTCAAGGCG
CTCGGGGTCGAGCCGGCGCGGAGCCGGCGGTACCTGCTGCAGTGGCTGGACCGGTACCGGGCCGGCGACTTGGGC
CCCGGCGGCGACTTCCAGCACGTCAGGGACGGGCTGGCCTTGCTCAAGGTGGCGTTGCCGCCGGCGTCGGTGCCC
AGCAGCGCCAGGTGGGTGGTCAATGTGCCGCTCGAGCGGGGCGAGGCGGCGGCGGCTACGGCGACGGCGGAGACG
GCGGCGGCGGCTGCGGCGGAGACGACGACGACGGCTGCGGCGGGGACGACGGCCGCGACGCCGCTGCCGCCCAAG
GTCGTGCGGCCGGGCGGGTACGTCGTCAGGGGCCTCAGGACCATCGTCGGGCCGTACGCGACGCAGCTGCCGGGC
TCGGGCGGCGCCACCGTCAAGGTCAGAGAGGGCATGTGGGAGTTCCGACGCGGACGCAAGATCGATGGCGGCGAG
CGGCGCCGCACCGAGATCCGGTTCAAGAGGCGCTCTGCCGAGCGCAGGGAGGAGCGCGAGGCCGAGGCGGGGTTC
GGCGCCGTGTAA
Gene >Hirsu2|2257
ATGGATAAGGACGGGTAGGGTGGGGCCGAAGAAGCGCCACAGCCTCGCTTACTAACGCCACTAAGACGTCGAAAA
TTCGCGACTCTGCTGCTGCTACATCGCGCAACGGCCTCGTCAGAAGGTCATGTTGGCAGCTGTGCCGGCCCAGCA
CCTCTAGATCAGGTAAGCTTCGAACCAATGGCGACGAGACTCCACGCGCAAAGAGCACACCTTACTGACGGCGGG
ATAAGCCATGAGAGCAGAACAGCTGCGGCCGTGCCTGCGACTGCTGCTGGCACGGGGGGGCGTCGGCGGCGGCGC
GGGCCAGACGACGACGACGACGACGACGACGACGAGAGGGCTTCACAAGACGCGACCGCCCCCGACGGTGCCGGC
GCCGCGGCCGTTCGTGCCCGATGTGCAGACCTTCCTCACGCTCATCGGGCGGGGCATGAACAAGCACACGGCCAA
GTTCCCGACGTGGGAGTCGCTCTTCTCCCTCACGTCGCCCGAGCTCAAGGCGCTCGGGGTCGAGCCGGCGCGGAG
CCGGCGGTACCTGCTGCAGTGGCTGGACCGGTACCGGGCCGGCGACTTGGGCCCCGGCGGCGACTTCCAGCACGT
CAGGGACGGGCTGGCCTTGCTCAAGGTGGCGTTGCCGCCGGCGTCGGTGCCCAGCAGCGCCAGGTGGGTGGTCAA
TGTGCCGCTCGAGCGGGGCGAGGCGGCGGCGGCTACGGCGACGGCGGAGACGGCGGCGGCGGCTGCGGCGGAGAC
GACGACGACGGCTGCGGCGGGGACGACGGCCGCGACGCCGCTGCCGCCCAAGGTCGTGCGGCCGGGCGGGTACGT
CGTCAGGGGCCTCAGGACCATCGTCGGGCCGTACGCGACGCAGCTGCCGGGCTCGGGCGGCGCCACCGTCAAGGT
CAGAGAGGGCATGTGGGAGTTCCGACGCGGACGCAAGATCGATGGCGGCGAGCGGCGCCGCACCGAGATCCGGTT
CAAGAGGCGCTCTGCCGAGCGCAGGGAGGAGCGCGAGGCCGAGGCGGGGTTCGGCGCCGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail