Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2252
Gene name
LocationContig_1526:68..1244
Strand-
Gene length (bp)1176
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10290 DUF2403 Glycine-rich protein domain (DUF2403) 6.6E-21 40 101
PF10287 DUF2401 Putative TOS1-like glycosyl hydrolase (DUF2401) 2.5E-15 277 337

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AQ83|PGA52_ARTBC PGA52-like protein ARB_06390 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_06390 PE=3 SV=1 7 160 2.0E-20
sp|Q9P7X4|YH6B_SCHPO Uncharacterized serine-rich protein P23A10.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP23A10.11c PE=2 SV=1 5 336 2.0E-13
sp|P38288|TOS1_YEAST Protein TOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOS1 PE=1 SV=1 6 142 1.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2252
MGPDSLLLLASAGWAAALTQQCSGTAVKDGGNWYCGRVGRILYQGLNGRGGSYKDVTAMDSNGRCDFEDKPYSGP
LAPLDEGLSIHFRGPCHIDEVAVYTPSRRRRPGAAAARRARAQRRAKRAPEKEPDMVTAVINGVTVSWRNNWFGP
PAATTAPDPPPAVEAPPPSDAPAPVAQGPPRADETPEAPPTDALERYLRHAAFRPAPSPAEATRAREEPWASALS
ASDSSPASHTSSPSRPPSEYVPDTSNDVGAGEDWPAEEQGPDEESSSSNGDQWERIAQYNASGQVAENMVFMANY
GGGRWPGVFDHSWGNSLTYLNADGTDGTDSPQILNDRGAVRR*
Coding >Hirsu2|2252
ATGGGCCCCGACTCCCTGCTGCTGCTCGCCTCGGCGGGCTGGGCAGCGGCCCTGACACAGCAGTGCTCCGGCACG
GCCGTCAAGGACGGCGGGAACTGGTACTGCGGCCGGGTCGGCCGCATCCTCTACCAGGGGCTGAACGGCCGCGGC
GGGAGCTACAAGGACGTCACGGCCATGGACTCGAACGGCCGTTGCGACTTCGAGGACAAGCCCTACTCCGGCCCG
CTCGCTCCGCTGGACGAGGGTCTCTCGATCCATTTCCGCGGGCCCTGCCACATCGACGAAGTCGCCGTCTACACC
CCCTCGCGCAGGAGACGGCCCGGCGCGGCTGCGGCCCGGCGCGCCCGCGCCCAGCGACGCGCGAAGCGGGCGCCC
GAGAAGGAGCCGGACATGGTGACGGCCGTCATCAACGGCGTCACCGTCTCGTGGAGGAACAACTGGTTCGGCCCG
CCCGCCGCCACCACCGCCCCGGACCCGCCCCCGGCTGTCGAAGCCCCTCCTCCGTCCGATGCTCCCGCGCCTGTT
GCCCAGGGCCCGCCTCGCGCCGACGAGACCCCCGAGGCTCCTCCGACTGACGCCCTCGAGCGGTATCTTCGTCAC
GCCGCCTTCCGTCCTGCGCCCAGCCCGGCCGAGGCCACTCGCGCTCGTGAAGAACCTTGGGCGAGCGCACTTTCA
GCTTCAGACTCTTCTCCCGCCTCTCACACGTCGTCTCCCTCGCGTCCGCCGTCCGAATATGTCCCCGACACGTCC
AACGACGTCGGCGCGGGAGAGGACTGGCCTGCCGAGGAGCAAGGGCCGGACGAGGAGTCTTCGTCGTCCAACGGC
GACCAATGGGAACGCATCGCGCAGTACAACGCCTCGGGGCAGGTCGCGGAGAACATGGTATTCATGGCCAACTAC
GGCGGCGGCCGGTGGCCCGGCGTCTTCGACCACTCGTGGGGAAACTCTTTGACCTACCTCAACGCCGACGGCACC
GACGGCACCGACTCGCCTCAGATCCTGAACGACCGCGGAGCCGTGCGACGATGA
Transcript >Hirsu2|2252
ATGGGCCCCGACTCCCTGCTGCTGCTCGCCTCGGCGGGCTGGGCAGCGGCCCTGACACAGCAGTGCTCCGGCACG
GCCGTCAAGGACGGCGGGAACTGGTACTGCGGCCGGGTCGGCCGCATCCTCTACCAGGGGCTGAACGGCCGCGGC
GGGAGCTACAAGGACGTCACGGCCATGGACTCGAACGGCCGTTGCGACTTCGAGGACAAGCCCTACTCCGGCCCG
CTCGCTCCGCTGGACGAGGGTCTCTCGATCCATTTCCGCGGGCCCTGCCACATCGACGAAGTCGCCGTCTACACC
CCCTCGCGCAGGAGACGGCCCGGCGCGGCTGCGGCCCGGCGCGCCCGCGCCCAGCGACGCGCGAAGCGGGCGCCC
GAGAAGGAGCCGGACATGGTGACGGCCGTCATCAACGGCGTCACCGTCTCGTGGAGGAACAACTGGTTCGGCCCG
CCCGCCGCCACCACCGCCCCGGACCCGCCCCCGGCTGTCGAAGCCCCTCCTCCGTCCGATGCTCCCGCGCCTGTT
GCCCAGGGCCCGCCTCGCGCCGACGAGACCCCCGAGGCTCCTCCGACTGACGCCCTCGAGCGGTATCTTCGTCAC
GCCGCCTTCCGTCCTGCGCCCAGCCCGGCCGAGGCCACTCGCGCTCGTGAAGAACCTTGGGCGAGCGCACTTTCA
GCTTCAGACTCTTCTCCCGCCTCTCACACGTCGTCTCCCTCGCGTCCGCCGTCCGAATATGTCCCCGACACGTCC
AACGACGTCGGCGCGGGAGAGGACTGGCCTGCCGAGGAGCAAGGGCCGGACGAGGAGTCTTCGTCGTCCAACGGC
GACCAATGGGAACGCATCGCGCAGTACAACGCCTCGGGGCAGGTCGCGGAGAACATGGTATTCATGGCCAACTAC
GGCGGCGGCCGGTGGCCCGGCGTCTTCGACCACTCGTGGGGAAACTCTTTGACCTACCTCAACGCCGACGGCACC
GACGGCACCGACTCGCCTCAGATCCTGAACGACCGCGGAGCCGTGCGACGATGA
Gene >Hirsu2|2252
ATGGGCCCCGACTCCCTGCTGCTGCTCGCCTCGGCGGGCTGGGCAGCGGCCCTGACACAGCAGTGCTCCGGCACG
GCCGTCAAGGACGGCGGGAACTGGTACTGCGGCCGGGTCGGCCGCATCCTCTACCAGGGGCTGAACGGCCGCGGC
GGGAGCTACAAGGACGTCACGGCCATGGACTCGAACGGCCGTTGCGACTTCGAGGACAAGCCCTACTCCGGCCCG
CTCGCTCCGCTGGACGAGGGTGTAAGAGAAGCCCTCCTCCGGCGTGGCCCCGTCGTCTGACACGCCGCAGCTCTC
GATCCATTTCCGCGGGCCCTGCCACATCGACGAAGTCGCCGTCTACACCCCCTCGCGCAGGAGACGGCCCGGCGC
GGCTGCGGCCCGGCGCGCCCGCGCCCAGCGACGCGCGAAGCGGGCGCCCGAGAAGGAGCCGGACATGGTGACGGC
CGTCATCAACGGCGTCACCGTCTCGTGGAGGAACAACTGGTTCGGCCCGCCCGCCGCCACCACCGCCCCGGACCC
GCCCCCGGCTGTCGAAGCCCCTCCTCCGTCCGATGCTCCCGCGCCTGTTGCCCAGGGCCCGCCTCGCGCCGACGA
GACCCCCGAGGCTCCTCCGACTGACGCCCTCGAGCGGTATCTTCGTCACGCCGCCTTCCGTCCTGCGCCCAGCCC
GGCCGAGGCCACTCGCGCTCGTGAAGAACCTTGGGCGAGCGCACTTTCAGCTTCAGACTCTTCTCCCGCCTCTCA
CACGTCGTCTCCCTCGCGTCCGCCGTCCGAATATGTCCCCGACACGTCCAACGACGTCGGCGCGGGAGAGGACTG
GCCTGCCGAGGAGCAAGGGCCGGACGAGGAGTCTTCGTCGTCCAACGGCGACCAATGGGAACGCATCGCGCAGTA
CAACGCCTCGGGGCAGGTCGCGGAGAACATGGTATTCATGGCCAACTACGGCGGCGGCCGGTGGCCCGGCGTCTT
CGACCAGTAAGGCCCCGTCCCGTCACTCTCGGCCTCCTCCGTATACTGACGGCACGGCGGCGGCAGCTCGTGGGG
AAACTCTTTGACCTACCTCAACGCCGACGGCACCGACGGCACCGACTCGCCTCAGATCCTGAACGACGTCTTCAT
CCCGTCCGGCAAGGAGTTGTCCATCTTCAGCGCGGAGCCGTGCGACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail