© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|2243 |
| Gene name | |
| Location | Contig_1521:267..3694 |
| Strand | + |
| Gene length (bp) | 3427 |
| Transcript length (bp) | 3363 |
| Coding sequence length (bp) | 3363 |
| Protein length (aa) | 1121 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 1.5E-06 | 664 | 727 |
| PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 3.1E-09 | 731 | 794 |
| PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 1.9E-08 | 796 | 860 |
| PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 1.2E-07 | 829 | 891 |
| PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 1.3E-13 | 867 | 959 |
| PF00023 | Ank | Ankyrin repeat | 3.0E-03 | 696 | 727 |
| PF00023 | Ank | Ankyrin repeat | 8.0E-05 | 733 | 761 |
| PF00023 | Ank | Ankyrin repeat | 1.9E-03 | 763 | 794 |
| PF00023 | Ank | Ankyrin repeat | 8.7E-03 | 798 | 827 |
| PF00023 | Ank | Ankyrin repeat | 2.1E-03 | 829 | 860 |
| PF00023 | Ank | Ankyrin repeat | 7.5E-04 | 862 | 889 |
| PF00023 | Ank | Ankyrin repeat | 2.1E-04 | 896 | 926 |
| PF13637 | Ank_4 | Ankyrin repeats (many copies) | 9.8E-07 | 699 | 751 |
| PF13637 | Ank_4 | Ankyrin repeats (many copies) | 2.1E-07 | 733 | 783 |
| PF13637 | Ank_4 | Ankyrin repeats (many copies) | 3.6E-06 | 864 | 916 |
| PF13637 | Ank_4 | Ankyrin repeats (many copies) | 9.5E-07 | 930 | 982 |
| PF13857 | Ank_5 | Ankyrin repeats (many copies) | 2.6E-06 | 849 | 903 |
| PF13857 | Ank_5 | Ankyrin repeats (many copies) | 1.9E-06 | 920 | 969 |
| PF05729 | NACHT | NACHT domain | 2.2E-09 | 226 | 396 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 667 | 1004 | 5.0E-42 |
| sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 678 | 1025 | 4.0E-41 |
| sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 620 | 1001 | 9.0E-41 |
| sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 667 | 970 | 2.0E-40 |
| sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 632 | 1007 | 3.0E-40 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 667 | 1004 | 5.0E-42 |
| sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 678 | 1025 | 4.0E-41 |
| sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 620 | 1001 | 9.0E-41 |
| sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 667 | 970 | 2.0E-40 |
| sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 632 | 1007 | 3.0E-40 |
| sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 667 | 1004 | 4.0E-40 |
| sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 667 | 970 | 6.0E-40 |
| sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 620 | 1001 | 7.0E-40 |
| sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 678 | 1025 | 6.0E-39 |
| sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 678 | 1025 | 1.0E-38 |
| sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 667 | 1004 | 1.0E-38 |
| sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 669 | 1016 | 2.0E-38 |
| sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 669 | 1010 | 4.0E-37 |
| sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 694 | 1007 | 5.0E-37 |
| sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 669 | 981 | 7.0E-37 |
| sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 694 | 1007 | 9.0E-36 |
| sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 669 | 1010 | 1.0E-35 |
| sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 678 | 1009 | 2.0E-35 |
| sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 667 | 1004 | 2.0E-35 |
| sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 669 | 969 | 3.0E-35 |
| sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 667 | 1004 | 4.0E-35 |
| sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 678 | 1009 | 6.0E-35 |
| sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 669 | 970 | 7.0E-35 |
| sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 678 | 1009 | 1.0E-34 |
| sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 667 | 1031 | 2.0E-34 |
| sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 666 | 982 | 3.0E-34 |
| sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 694 | 1025 | 4.0E-34 |
| sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 667 | 982 | 4.0E-34 |
| sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 678 | 1001 | 5.0E-34 |
| sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 667 | 1004 | 7.0E-34 |
| sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 669 | 1033 | 8.0E-34 |
| sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 678 | 1007 | 9.0E-34 |
| sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 667 | 1031 | 1.0E-33 |
| sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 667 | 1018 | 1.0E-33 |
| sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 655 | 981 | 1.0E-33 |
| sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 666 | 1024 | 1.0E-33 |
| sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 666 | 982 | 2.0E-33 |
| sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 667 | 982 | 2.0E-33 |
| sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 667 | 982 | 2.0E-33 |
| sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 666 | 1024 | 2.0E-33 |
| sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 698 | 1001 | 4.0E-33 |
| sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 666 | 1024 | 6.0E-33 |
| sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 694 | 1025 | 7.0E-33 |
| sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 666 | 1007 | 1.0E-32 |
| sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 694 | 1025 | 1.0E-32 |
| sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 698 | 1016 | 3.0E-32 |
| sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 668 | 970 | 3.0E-32 |
| sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 698 | 1016 | 9.0E-32 |
| sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 698 | 1016 | 1.0E-31 |
| sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 667 | 987 | 2.0E-31 |
| sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 669 | 1009 | 2.0E-31 |
| sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 659 | 983 | 2.0E-31 |
| sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 694 | 1031 | 2.0E-31 |
| sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 681 | 1009 | 2.0E-31 |
| sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 659 | 983 | 3.0E-31 |
| sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 667 | 1001 | 3.0E-31 |
| sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 665 | 1009 | 3.0E-31 |
| sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 655 | 974 | 3.0E-31 |
| sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 669 | 1009 | 4.0E-31 |
| sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 622 | 1031 | 5.0E-31 |
| sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 667 | 981 | 5.0E-31 |
| sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 666 | 1009 | 5.0E-31 |
| sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 667 | 987 | 7.0E-31 |
| sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 667 | 1001 | 1.0E-30 |
| sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 664 | 983 | 2.0E-30 |
| sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 667 | 1011 | 2.0E-30 |
| sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 667 | 1001 | 2.0E-30 |
| sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 667 | 981 | 3.0E-30 |
| sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 667 | 981 | 5.0E-30 |
| sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 666 | 996 | 6.0E-30 |
| sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 666 | 1009 | 7.0E-30 |
| sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 669 | 1009 | 9.0E-30 |
| sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 669 | 1031 | 9.0E-30 |
| sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 665 | 1027 | 1.0E-29 |
| sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 667 | 981 | 1.0E-29 |
| sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 667 | 981 | 1.0E-29 |
| sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 640 | 1031 | 2.0E-29 |
| sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 666 | 1009 | 2.0E-29 |
| sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 667 | 982 | 2.0E-29 |
| sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 667 | 1010 | 2.0E-29 |
| sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 667 | 981 | 2.0E-29 |
| sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 681 | 1009 | 4.0E-29 |
| sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 646 | 1026 | 5.0E-29 |
| sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 667 | 981 | 7.0E-29 |
| sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 659 | 1031 | 8.0E-29 |
| sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 701 | 1026 | 9.0E-29 |
| sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 645 | 1010 | 1.0E-28 |
| sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 667 | 960 | 1.0E-28 |
| sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 645 | 1010 | 2.0E-28 |
| sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 666 | 982 | 3.0E-28 |
| sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 666 | 1014 | 3.0E-28 |
| sp|Q9XZC0|LCTA_LATTR | Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 | 669 | 982 | 3.0E-28 |
| sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 669 | 1058 | 5.0E-28 |
| sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 695 | 1010 | 5.0E-28 |
| sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 695 | 1010 | 5.0E-28 |
| sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 667 | 1025 | 8.0E-28 |
| sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 667 | 982 | 8.0E-28 |
| sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 701 | 1026 | 8.0E-28 |
| sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 665 | 1027 | 1.0E-27 |
| sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 666 | 996 | 1.0E-27 |
| sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 667 | 982 | 2.0E-27 |
| sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 669 | 1010 | 2.0E-27 |
| sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 665 | 1020 | 2.0E-27 |
| sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 640 | 1005 | 5.0E-27 |
| sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 666 | 996 | 5.0E-27 |
| sp|Q9J569|V162_FOWPN | Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 | 698 | 1051 | 5.0E-27 |
| sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 678 | 1009 | 6.0E-27 |
| sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 742 | 994 | 6.0E-27 |
| sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 667 | 982 | 7.0E-27 |
| sp|Q25338|LITD_LATTR | Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 | 667 | 982 | 7.0E-27 |
| sp|Q9J569|V162_FOWPN | Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 | 687 | 992 | 1.0E-26 |
| sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 667 | 1048 | 2.0E-26 |
| sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 665 | 1020 | 2.0E-26 |
| sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 667 | 1048 | 2.0E-26 |
| sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 730 | 1010 | 2.0E-26 |
| sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 640 | 1058 | 4.0E-26 |
| sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 704 | 1006 | 4.0E-26 |
| sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 680 | 1010 | 1.0E-25 |
| sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 694 | 1010 | 1.0E-25 |
| sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 669 | 996 | 1.0E-25 |
| sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 669 | 1041 | 2.0E-25 |
| sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 664 | 982 | 2.0E-25 |
| sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 667 | 982 | 2.0E-25 |
| sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 666 | 982 | 2.0E-25 |
| sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 694 | 996 | 2.0E-25 |
| sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 694 | 1008 | 2.0E-25 |
| sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 694 | 1010 | 3.0E-25 |
| sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 656 | 1001 | 3.0E-25 |
| sp|P20749|BCL3_HUMAN | B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 | 694 | 903 | 3.0E-25 |
| sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 722 | 1010 | 3.0E-25 |
| sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 726 | 1011 | 3.0E-25 |
| sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 733 | 1009 | 4.0E-25 |
| sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 701 | 1001 | 4.0E-25 |
| sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 732 | 1004 | 5.0E-25 |
| sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 666 | 982 | 5.0E-25 |
| sp|Q7TQP6|TNI3K_RAT | Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 | 735 | 982 | 5.0E-25 |
| sp|O75762|TRPA1_HUMAN | Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 | 659 | 982 | 5.0E-25 |
| sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 660 | 1009 | 5.0E-25 |
| sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 667 | 1009 | 9.0E-25 |
| sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 696 | 981 | 1.0E-24 |
| sp|Q5GIG6|TNI3K_MOUSE | Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 | 735 | 982 | 1.0E-24 |
| sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 593 | 1021 | 2.0E-24 |
| sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 666 | 923 | 3.0E-24 |
| sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 697 | 981 | 3.0E-24 |
| sp|A6QPE7|ANR65_BOVIN | Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 | 699 | 982 | 3.0E-24 |
| sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 697 | 981 | 4.0E-24 |
| sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 551 | 1016 | 4.0E-24 |
| sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 694 | 981 | 5.0E-24 |
| sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 660 | 1009 | 5.0E-24 |
| sp|P53355|DAPK1_HUMAN | Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 | 697 | 981 | 5.0E-24 |
| sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 694 | 974 | 7.0E-24 |
| sp|Q14DN9|AKD1B_MOUSE | Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 | 670 | 982 | 9.0E-24 |
| sp|Q25338|LITD_LATTR | Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 | 664 | 1002 | 1.0E-23 |
| sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 732 | 982 | 1.0E-23 |
| sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 660 | 1009 | 1.0E-23 |
| sp|Q6RI86|TRPA1_RAT | Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 | 694 | 982 | 1.0E-23 |
| sp|Q69ZU8|ANKR6_MOUSE | Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 | 742 | 988 | 1.0E-23 |
| sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 712 | 982 | 2.0E-23 |
| sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 693 | 1011 | 2.0E-23 |
| sp|Q6RI86|TRPA1_RAT | Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 | 659 | 995 | 2.0E-23 |
| sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 669 | 1009 | 2.0E-23 |
| sp|Q02989|LITA_LATTR | Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 | 668 | 1048 | 2.0E-23 |
| sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 680 | 1010 | 3.0E-23 |
| sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 667 | 982 | 4.0E-23 |
| sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 680 | 1010 | 5.0E-23 |
| sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 693 | 982 | 5.0E-23 |
| sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 682 | 982 | 6.0E-23 |
| sp|Q9J4Z6|V244_FOWPN | Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 | 689 | 889 | 8.0E-23 |
| sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 693 | 950 | 1.0E-22 |
| sp|A6QPE7|ANR65_BOVIN | Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 | 675 | 1013 | 1.0E-22 |
| sp|Q8BLA8|TRPA1_MOUSE | Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 | 659 | 995 | 1.0E-22 |
| sp|Q71S21|INVSB_XENLA | Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 | 693 | 982 | 1.0E-22 |
| sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 717 | 1011 | 2.0E-22 |
| sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 666 | 982 | 2.0E-22 |
| sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 694 | 1010 | 2.0E-22 |
| sp|Q810B6|ANFY1_MOUSE | Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 | 658 | 1078 | 2.0E-22 |
| sp|Q9GKW8|AND1A_MACFA | Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 | 672 | 949 | 2.0E-22 |
| sp|Q9J4Z5|V245_FOWPN | Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 | 680 | 956 | 2.0E-22 |
| sp|Q9Y2G4|ANKR6_HUMAN | Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 | 742 | 988 | 2.0E-22 |
| sp|Q9W0T5|PYX_DROME | Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 | 668 | 981 | 3.0E-22 |
| sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 732 | 977 | 4.0E-22 |
| sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 693 | 982 | 4.0E-22 |
| sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 672 | 949 | 4.0E-22 |
| sp|Q59H18|TNI3K_HUMAN | Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 | 705 | 982 | 5.0E-22 |
| sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 692 | 987 | 6.0E-22 |
| sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 693 | 982 | 6.0E-22 |
| sp|Q02989|LITA_LATTR | Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 | 667 | 982 | 6.0E-22 |
| sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 732 | 977 | 7.0E-22 |
| sp|Q5RF15|TNI3K_PONAB | Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 | 705 | 1014 | 9.0E-22 |
| sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 664 | 950 | 1.0E-21 |
| sp|Q8BLA8|TRPA1_MOUSE | Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 | 694 | 982 | 1.0E-21 |
| sp|P98150|NFKB2_CHICK | Nuclear factor NF-kappa-B p100 subunit OS=Gallus gallus GN=NFKB2 PE=1 SV=1 | 678 | 892 | 1.0E-21 |
| sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 676 | 1010 | 1.0E-21 |
| sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 692 | 987 | 2.0E-21 |
| sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 693 | 982 | 2.0E-21 |
| sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 669 | 982 | 2.0E-21 |
| sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 667 | 1019 | 3.0E-21 |
| sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 676 | 1010 | 3.0E-21 |
| sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 661 | 1012 | 4.0E-21 |
| sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 669 | 1009 | 4.0E-21 |
| sp|Q9J4Z4|V246_FOWPN | Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 | 713 | 983 | 5.0E-21 |
| sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 798 | 1069 | 6.0E-21 |
| sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 666 | 982 | 6.0E-21 |
| sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 693 | 1011 | 7.0E-21 |
| sp|Q6S5H4|POTEB_HUMAN | POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 | 669 | 865 | 7.0E-21 |
| sp|A0JP26|POTB3_HUMAN | POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 | 669 | 865 | 7.0E-21 |
| sp|B2RU33|POTEC_HUMAN | POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 | 669 | 865 | 7.0E-21 |
| sp|Q9P2R3|ANFY1_HUMAN | Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 | 667 | 1078 | 8.0E-21 |
| sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 659 | 970 | 9.0E-21 |
| sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 735 | 1016 | 1.0E-20 |
| sp|Q810B6|ANFY1_MOUSE | Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 | 682 | 1012 | 1.0E-20 |
| sp|H3BUK9|POTB2_HUMAN | POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 | 669 | 865 | 1.0E-20 |
| sp|O73630|NFKB2_XENLA | Nuclear factor NF-kappa-B p100 subunit OS=Xenopus laevis GN=nfkb2 PE=2 SV=1 | 693 | 892 | 1.0E-20 |
| sp|Q8K0L0|ASB2_MOUSE | Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 | 700 | 956 | 1.0E-20 |
| sp|Q18297|TRPA1_CAEEL | Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 | 669 | 1020 | 1.0E-20 |
| sp|Q3V096|ANR42_MOUSE | Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 | 699 | 981 | 1.0E-20 |
| sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 717 | 1011 | 2.0E-20 |
| sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 667 | 1016 | 2.0E-20 |
| sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 664 | 950 | 2.0E-20 |
| sp|O75762|TRPA1_HUMAN | Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 | 669 | 982 | 2.0E-20 |
| sp|Q02989|LITA_LATTR | Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 | 653 | 978 | 2.0E-20 |
| sp|Q5U2S6|ASB2_RAT | Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 | 700 | 956 | 2.0E-20 |
| sp|Q96Q27|ASB2_HUMAN | Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 | 684 | 956 | 2.0E-20 |
| sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 694 | 970 | 2.0E-20 |
| sp|Q7T163|KDIS_DANRE | Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 | 693 | 982 | 2.0E-20 |
| sp|Q86YR6|POTED_HUMAN | POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 | 669 | 865 | 2.0E-20 |
| sp|Q9WTK5|NFKB2_MOUSE | Nuclear factor NF-kappa-B p100 subunit OS=Mus musculus GN=Nfkb2 PE=1 SV=1 | 693 | 933 | 2.0E-20 |
| sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 669 | 957 | 2.0E-20 |
| sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 667 | 982 | 3.0E-20 |
| sp|Q9XZC0|LCTA_LATTR | Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 | 620 | 945 | 3.0E-20 |
| sp|A6QPE7|ANR65_BOVIN | Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 | 672 | 968 | 3.0E-20 |
| sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 732 | 1016 | 3.0E-20 |
| sp|Q3SX45|ASB2_BOVIN | Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 | 669 | 982 | 3.0E-20 |
| sp|O44997|DAPK_CAEEL | Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 | 659 | 938 | 3.0E-20 |
| sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 693 | 982 | 3.0E-20 |
| sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 667 | 982 | 4.0E-20 |
| sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 735 | 1016 | 4.0E-20 |
| sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 735 | 1016 | 4.0E-20 |
| sp|Q9W0T5|PYX_DROME | Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 | 665 | 889 | 4.0E-20 |
| sp|E5RJM6|ANR65_HUMAN | Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 | 701 | 982 | 4.0E-20 |
| sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 733 | 969 | 4.0E-20 |
| sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 733 | 969 | 4.0E-20 |
| sp|A6NHY2|AKD1B_HUMAN | Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 | 671 | 982 | 4.0E-20 |
| sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 779 | 982 | 5.0E-20 |
| sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 732 | 1004 | 5.0E-20 |
| sp|Q6S545|POTEH_HUMAN | POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 | 669 | 884 | 5.0E-20 |
| sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 662 | 982 | 6.0E-20 |
| sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 693 | 982 | 6.0E-20 |
| sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 684 | 969 | 6.0E-20 |
| sp|A6NI47|POTEM_HUMAN | Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 | 669 | 884 | 6.0E-20 |
| sp|Q71S21|INVSB_XENLA | Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 | 653 | 1012 | 7.0E-20 |
| sp|Q71S21|INVSB_XENLA | Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 | 706 | 1004 | 7.0E-20 |
| sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 667 | 1001 | 8.0E-20 |
| sp|Q6S5H5|POTEG_HUMAN | POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 | 669 | 884 | 8.0E-20 |
| sp|Q9VUX2|MIB_DROME | E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 | 736 | 972 | 8.0E-20 |
| sp|Q8VBX0|ASB13_MOUSE | Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 | 659 | 833 | 8.0E-20 |
| sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 667 | 1001 | 9.0E-20 |
| sp|Q5UPG5|YL093_MIMIV | Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 | 697 | 1012 | 9.0E-20 |
| sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 781 | 982 | 1.0E-19 |
| sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 667 | 982 | 1.0E-19 |
| sp|Q9Z2F6|BCL3_MOUSE | B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 | 694 | 903 | 1.0E-19 |
| sp|Q08DV6|ASB3_BOVIN | Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 | 704 | 982 | 1.0E-19 |
| sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 693 | 926 | 2.0E-19 |
| sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 693 | 982 | 2.0E-19 |
| sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 754 | 1010 | 2.0E-19 |
| sp|Q9J4Z6|V244_FOWPN | Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 | 680 | 982 | 2.0E-19 |
| sp|Q8WXK3|ASB13_HUMAN | Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 | 659 | 833 | 2.0E-19 |
| sp|P0CG38|POTEI_HUMAN | POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 | 669 | 865 | 2.0E-19 |
| sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 667 | 996 | 3.0E-19 |
| sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 666 | 982 | 3.0E-19 |
| sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 695 | 982 | 3.0E-19 |
| sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 754 | 1010 | 3.0E-19 |
| sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 551 | 1016 | 3.0E-19 |
| sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 693 | 982 | 3.0E-19 |
| sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 667 | 1012 | 3.0E-19 |
| sp|P0CG39|POTEJ_HUMAN | POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 | 669 | 865 | 3.0E-19 |
| sp|Q6S8J3|POTEE_HUMAN | POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 | 669 | 865 | 3.0E-19 |
| sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 734 | 1011 | 4.0E-19 |
| sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 667 | 1012 | 4.0E-19 |
| sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 659 | 969 | 4.0E-19 |
| sp|Q00653|NFKB2_HUMAN | Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens GN=NFKB2 PE=1 SV=4 | 693 | 900 | 4.0E-19 |
| sp|A5A3E0|POTEF_HUMAN | POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 | 669 | 865 | 4.0E-19 |
| sp|Q804S5|MIB1_DANRE | E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 | 764 | 1029 | 4.0E-19 |
| sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 669 | 1012 | 5.0E-19 |
| sp|Q804S5|MIB1_DANRE | E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 | 732 | 972 | 5.0E-19 |
| sp|Q6C520|AKR1_YARLI | Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 | 696 | 880 | 5.0E-19 |
| sp|Q8N9B4|ANR42_HUMAN | Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 | 716 | 981 | 5.0E-19 |
| sp|Q8WXK3|ASB13_HUMAN | Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 | 732 | 971 | 6.0E-19 |
| sp|Q9J517|V218_FOWPN | Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 | 680 | 933 | 6.0E-19 |
| sp|Q80SY4|MIB1_MOUSE | E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 | 732 | 972 | 6.0E-19 |
| sp|Q86YT6|MIB1_HUMAN | E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 | 732 | 972 | 7.0E-19 |
| sp|Q00653|NFKB2_HUMAN | Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens GN=NFKB2 PE=1 SV=4 | 757 | 959 | 8.0E-19 |
| sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 661 | 1012 | 9.0E-19 |
| sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 666 | 982 | 1.0E-18 |
| sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 661 | 1012 | 1.0E-18 |
| sp|Q4R3S3|ANKR7_MACFA | Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 | 634 | 865 | 1.0E-18 |
| sp|Q5ZIJ9|MIB2_CHICK | E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 | 667 | 903 | 1.0E-18 |
| sp|Q9D504|ANKR7_MOUSE | Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 | 669 | 874 | 1.0E-18 |
| sp|Q9D504|ANKR7_MOUSE | Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 | 735 | 932 | 1.0E-18 |
| sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 671 | 926 | 2.0E-18 |
| sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 671 | 948 | 2.0E-18 |
| sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 667 | 915 | 2.0E-18 |
| sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 677 | 982 | 2.0E-18 |
| sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 671 | 898 | 2.0E-18 |
| sp|Q8K0L0|ASB2_MOUSE | Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 | 715 | 1009 | 2.0E-18 |
| sp|Q5U2S6|ASB2_RAT | Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 | 715 | 1009 | 2.0E-18 |
| sp|Q96Q27|ASB2_HUMAN | Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 | 734 | 1009 | 2.0E-18 |
| sp|Q5UPG5|YL093_MIMIV | Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 | 679 | 923 | 2.0E-18 |
| sp|Q5UPF8|YL088_MIMIV | Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 | 712 | 1012 | 2.0E-18 |
| sp|Q25338|LITD_LATTR | Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 | 662 | 934 | 3.0E-18 |
| sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 656 | 1012 | 3.0E-18 |
| sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 643 | 1005 | 3.0E-18 |
| sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 667 | 918 | 3.0E-18 |
| sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 639 | 982 | 3.0E-18 |
| sp|P53355|DAPK1_HUMAN | Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 | 734 | 1045 | 4.0E-18 |
| sp|Q5RF15|TNI3K_PONAB | Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 | 735 | 1010 | 4.0E-18 |
| sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 742 | 1010 | 4.0E-18 |
| sp|Q9P2R3|ANFY1_HUMAN | Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 | 682 | 1001 | 4.0E-18 |
| sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 665 | 936 | 4.0E-18 |
| sp|Q4R3S3|ANKR7_MACFA | Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 | 667 | 841 | 4.0E-18 |
| sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 678 | 982 | 4.0E-18 |
| sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 759 | 903 | 4.0E-18 |
| sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 665 | 900 | 5.0E-18 |
| sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 643 | 1005 | 5.0E-18 |
| sp|Q8VBX0|ASB13_MOUSE | Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 | 732 | 971 | 5.0E-18 |
| sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 659 | 969 | 5.0E-18 |
| sp|Q91ZT9|ASB8_MOUSE | Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 | 716 | 946 | 5.0E-18 |
| sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 623 | 926 | 6.0E-18 |
| sp|Q69ZU8|ANKR6_MOUSE | Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 | 672 | 922 | 6.0E-18 |
| sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 667 | 937 | 7.0E-18 |
| sp|Q3KP44|ANR55_HUMAN | Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 | 733 | 981 | 7.0E-18 |
| sp|Q59H18|TNI3K_HUMAN | Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 | 735 | 1010 | 8.0E-18 |
| sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 742 | 1010 | 8.0E-18 |
| sp|E5RJM6|ANR65_HUMAN | Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 | 672 | 965 | 9.0E-18 |
| sp|Q9WV72|ASB3_MOUSE | Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 | 747 | 982 | 9.0E-18 |
| sp|P0CS66|AKR1_CRYNJ | Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 | 693 | 866 | 9.0E-18 |
| sp|P0CS67|AKR1_CRYNB | Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 | 693 | 866 | 9.0E-18 |
| sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 666 | 982 | 1.0E-17 |
| sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 677 | 982 | 1.0E-17 |
| sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 667 | 982 | 1.0E-17 |
| sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 663 | 982 | 1.0E-17 |
| sp|Q8WXK3|ASB13_HUMAN | Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 | 691 | 899 | 1.0E-17 |
| sp|Q804S5|MIB1_DANRE | E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 | 697 | 948 | 1.0E-17 |
| sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 669 | 982 | 1.0E-17 |
| sp|Q9WV72|ASB3_MOUSE | Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 | 704 | 949 | 1.0E-17 |
| sp|Q978J0|Y1425_THEVO | Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 | 826 | 981 | 1.0E-17 |
| sp|Q92527|ANKR7_HUMAN | Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 | 669 | 856 | 1.0E-17 |
| sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 677 | 982 | 2.0E-17 |
| sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 666 | 1012 | 2.0E-17 |
| sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 646 | 982 | 2.0E-17 |
| sp|Q5U2S6|ASB2_RAT | Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 | 640 | 982 | 2.0E-17 |
| sp|Q3SX45|ASB2_BOVIN | Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 | 734 | 1001 | 2.0E-17 |
| sp|Q8VBX0|ASB13_MOUSE | Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 | 691 | 899 | 2.0E-17 |
| sp|Q9Y575|ASB3_HUMAN | Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 | 704 | 982 | 2.0E-17 |
| sp|Q08E43|ASB8_BOVIN | Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 | 716 | 946 | 2.0E-17 |
| sp|Q6GNY1|MIB1_XENLA | E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 | 715 | 972 | 2.0E-17 |
| sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 667 | 937 | 3.0E-17 |
| sp|P53355|DAPK1_HUMAN | Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 | 671 | 898 | 3.0E-17 |
| sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 677 | 915 | 3.0E-17 |
| sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 683 | 982 | 3.0E-17 |
| sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 667 | 938 | 3.0E-17 |
| sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 667 | 938 | 3.0E-17 |
| sp|Q4R3S3|ANKR7_MACFA | Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 | 711 | 932 | 3.0E-17 |
| sp|Q6GNY1|MIB1_XENLA | E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 | 764 | 1029 | 3.0E-17 |
| sp|Q54HW1|PSD10_DICDI | 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 | 689 | 904 | 3.0E-17 |
| sp|Q5U312|RAI14_RAT | Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 | 816 | 1004 | 3.0E-17 |
| sp|Q4X251|AKR1_ASPFU | Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 | 682 | 917 | 3.0E-17 |
| sp|Q9Y2G4|ANKR6_HUMAN | Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 | 672 | 931 | 4.0E-17 |
| sp|Q80SY4|MIB1_MOUSE | E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 | 764 | 1011 | 4.0E-17 |
| sp|Q86YT6|MIB1_HUMAN | E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 | 764 | 1011 | 4.0E-17 |
| sp|Q7T163|KDIS_DANRE | Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 | 676 | 1010 | 5.0E-17 |
| sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 618 | 1005 | 5.0E-17 |
| sp|Q8VHS5|ASB16_MOUSE | Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 | 699 | 903 | 5.0E-17 |
| sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 667 | 982 | 6.0E-17 |
| sp|Q5R6D7|ASB8_PONAB | Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 | 716 | 946 | 6.0E-17 |
| sp|Q80SY4|MIB1_MOUSE | E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 | 667 | 968 | 7.0E-17 |
| sp|Q9H765|ASB8_HUMAN | Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 | 716 | 946 | 7.0E-17 |
| sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 759 | 903 | 7.0E-17 |
| sp|Q7S3M5|AKR1_NEUCR | Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 | 682 | 874 | 7.0E-17 |
| sp|B2RU33|POTEC_HUMAN | POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 | 782 | 981 | 8.0E-17 |
| sp|Q86YT6|MIB1_HUMAN | E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 | 667 | 968 | 8.0E-17 |
| sp|Q6S8J7|POTEA_HUMAN | POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 | 669 | 865 | 8.0E-17 |
| sp|Q4R544|ASB8_MACFA | Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 | 716 | 946 | 8.0E-17 |
| sp|P97570|PLPL9_RAT | 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 | 716 | 1012 | 8.0E-17 |
| sp|Q08353|IKBA_PIG | NF-kappa-B inhibitor alpha OS=Sus scrofa GN=NFKBIA PE=2 SV=1 | 764 | 929 | 9.0E-17 |
| sp|H3BUK9|POTB2_HUMAN | POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 | 782 | 981 | 1.0E-16 |
| sp|Q80SY4|MIB1_MOUSE | E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 | 697 | 948 | 1.0E-16 |
| sp|Q91974|IKBA_CHICK | NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 | 764 | 929 | 1.0E-16 |
| sp|Q63746|IKBA_RAT | NF-kappa-B inhibitor alpha OS=Rattus norvegicus GN=Nfkbia PE=2 SV=1 | 764 | 929 | 1.0E-16 |
| sp|P25963|IKBA_HUMAN | NF-kappa-B inhibitor alpha OS=Homo sapiens GN=NFKBIA PE=1 SV=1 | 764 | 929 | 1.0E-16 |
| sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 759 | 903 | 1.0E-16 |
| sp|Q6S5H4|POTEB_HUMAN | POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 | 790 | 981 | 2.0E-16 |
| sp|A0JP26|POTB3_HUMAN | POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 | 790 | 981 | 2.0E-16 |
| sp|Q86YT6|MIB1_HUMAN | E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 | 697 | 948 | 2.0E-16 |
| sp|Q9H560|ANR19_HUMAN | Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 | 730 | 949 | 2.0E-16 |
| sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 731 | 903 | 2.0E-16 |
| sp|Q7TQP6|TNI3K_RAT | Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 | 696 | 981 | 3.0E-16 |
| sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 697 | 948 | 3.0E-16 |
| sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 758 | 1016 | 3.0E-16 |
| sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 667 | 1054 | 3.0E-16 |
| sp|Q6GNY1|MIB1_XENLA | E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 | 697 | 948 | 3.0E-16 |
| sp|P97819|PLPL9_MOUSE | 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 | 710 | 1012 | 3.0E-16 |
| sp|Q9VUX2|MIB_DROME | E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 | 667 | 905 | 4.0E-16 |
| sp|Q7Z8U2|AKR1_ASPOR | Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 | 682 | 900 | 4.0E-16 |
| sp|Q9DBR7|MYPT1_MOUSE | Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 | 716 | 903 | 4.0E-16 |
| sp|Q10728|MYPT1_RAT | Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 | 716 | 903 | 4.0E-16 |
| sp|Q94A76|GORK_ARATH | Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 | 813 | 981 | 4.0E-16 |
| sp|Q05823|RN5A_HUMAN | 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 | 771 | 1001 | 4.0E-16 |
| sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 666 | 1012 | 5.0E-16 |
| sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 747 | 982 | 5.0E-16 |
| sp|Q804S5|MIB1_DANRE | E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 | 667 | 968 | 5.0E-16 |
| sp|Q6ZW76|ANKS3_HUMAN | Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 | 786 | 981 | 5.0E-16 |
| sp|Q9BXX3|AN30A_HUMAN | Ankyrin repeat domain-containing protein 30A OS=Homo sapiens GN=ANKRD30A PE=2 SV=3 | 693 | 870 | 5.0E-16 |
| sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 747 | 982 | 6.0E-16 |
| sp|Q9Z1E3|IKBA_MOUSE | NF-kappa-B inhibitor alpha OS=Mus musculus GN=Nfkbia PE=1 SV=2 | 764 | 932 | 6.0E-16 |
| sp|Q8ZWC4|Y1861_PYRAE | Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 | 672 | 887 | 6.0E-16 |
| sp|Q9BXX2|AN30B_HUMAN | Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 | 669 | 871 | 6.0E-16 |
| sp|Q05921|RN5A_MOUSE | 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 | 698 | 985 | 6.0E-16 |
| sp|P20749|BCL3_HUMAN | B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 | 733 | 907 | 7.0E-16 |
| sp|Q5GIG6|TNI3K_MOUSE | Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 | 696 | 981 | 7.0E-16 |
| sp|Q86YR6|POTED_HUMAN | POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 | 782 | 981 | 7.0E-16 |
| sp|Q8N283|ANR35_HUMAN | Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 | 817 | 982 | 7.0E-16 |
| sp|Q3ZBX7|ANKR1_BOVIN | Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 | 761 | 900 | 8.0E-16 |
| sp|Q8ZWC4|Y1861_PYRAE | Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 | 661 | 837 | 9.0E-16 |
| sp|Q9EP71|RAI14_MOUSE | Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 | 816 | 1004 | 9.0E-16 |
| sp|Q8R516|MIB2_MOUSE | E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 | 731 | 969 | 9.0E-16 |
| sp|Q9P0K7|RAI14_HUMAN | Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 | 816 | 1004 | 9.0E-16 |
| sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 669 | 985 | 1.0E-15 |
| sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 787 | 1013 | 1.0E-15 |
| sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 787 | 1013 | 1.0E-15 |
| sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 667 | 982 | 1.0E-15 |
| sp|O75762|TRPA1_HUMAN | Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 | 730 | 1009 | 1.0E-15 |
| sp|Q14DN9|AKD1B_MOUSE | Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 | 666 | 1028 | 1.0E-15 |
| sp|Q96Q27|ASB2_HUMAN | Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 | 677 | 956 | 1.0E-15 |
| sp|E5RJM6|ANR65_HUMAN | Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 | 771 | 1013 | 1.0E-15 |
| sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 667 | 1054 | 1.0E-15 |
| sp|A6NHY2|AKD1B_HUMAN | Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 | 667 | 951 | 1.0E-15 |
| sp|Q8ZWC4|Y1861_PYRAE | Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 | 750 | 963 | 1.0E-15 |
| sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 731 | 903 | 1.0E-15 |
| sp|O60733|PLPL9_HUMAN | 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 | 716 | 1012 | 1.0E-15 |
| sp|Q641X1|ANR61_RAT | Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 | 734 | 1022 | 1.0E-15 |
| sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 794 | 1010 | 2.0E-15 |
| sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 667 | 982 | 2.0E-15 |
| sp|Q7T163|KDIS_DANRE | Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 | 736 | 1010 | 2.0E-15 |
| sp|Q5UPF8|YL088_MIMIV | Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 | 679 | 934 | 2.0E-15 |
| sp|O14974|MYPT1_HUMAN | Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 | 716 | 903 | 2.0E-15 |
| sp|Q9BGT9|ASB7_MACFA | Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 | 693 | 906 | 2.0E-15 |
| sp|Q9J5G9|V034_FOWPN | Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 | 704 | 979 | 2.0E-15 |
| sp|Q5M9H0|ANKS3_RAT | Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 | 786 | 988 | 2.0E-15 |
| sp|Q9CZK6|ANKS3_MOUSE | Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 | 834 | 997 | 2.0E-15 |
| sp|A6NGH8|ANR61_HUMAN | Ankyrin repeat domain-containing protein 61 OS=Homo sapiens GN=ANKRD61 PE=3 SV=2 | 712 | 1008 | 2.0E-15 |
| sp|Q5B0V6|AKR1_EMENI | Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 | 682 | 874 | 2.0E-15 |
| sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 822 | 1025 | 2.0E-15 |
| sp|Q5DW34|EHMT1_MOUSE | Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 | 822 | 1047 | 2.0E-15 |
| sp|Q9WTK5|NFKB2_MOUSE | Nuclear factor NF-kappa-B p100 subunit OS=Mus musculus GN=Nfkb2 PE=1 SV=1 | 757 | 959 | 3.0E-15 |
| sp|Q5ZIJ9|MIB2_CHICK | E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 | 747 | 982 | 3.0E-15 |
| sp|Q92527|ANKR7_HUMAN | Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 | 756 | 904 | 3.0E-15 |
| sp|Q6S8J7|POTEA_HUMAN | POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 | 754 | 950 | 3.0E-15 |
| sp|Q91ZU0|ASB7_MOUSE | Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 | 693 | 906 | 3.0E-15 |
| sp|Q5JPF3|AN36C_HUMAN | Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 | 735 | 981 | 3.0E-15 |
| sp|Q9H672|ASB7_HUMAN | Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 | 693 | 906 | 3.0E-15 |
| sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 798 | 982 | 3.0E-15 |
| sp|Q68LP1|MIB2_RAT | E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 | 667 | 903 | 3.0E-15 |
| sp|Q1RK13|Y220_RICBR | Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 | 714 | 982 | 3.0E-15 |
| sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 798 | 982 | 3.0E-15 |
| sp|Q3UYR4|ESPNL_MOUSE | Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 | 733 | 981 | 3.0E-15 |
| sp|Q5RCK5|ASB7_PONAB | Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 | 693 | 906 | 3.0E-15 |
| sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 696 | 982 | 4.0E-15 |
| sp|Q9D504|ANKR7_MOUSE | Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 | 765 | 982 | 4.0E-15 |
| sp|Q9D504|ANKR7_MOUSE | Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 | 667 | 841 | 4.0E-15 |
| sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 714 | 1000 | 4.0E-15 |
| sp|P0CS66|AKR1_CRYNJ | Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 | 756 | 931 | 4.0E-15 |
| sp|P0CS67|AKR1_CRYNB | Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 | 756 | 931 | 4.0E-15 |
| sp|Q05921|RN5A_MOUSE | 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 | 771 | 1001 | 4.0E-15 |
| sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 798 | 982 | 4.0E-15 |
| sp|Q90623|MYPT1_CHICK | Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 | 716 | 903 | 4.0E-15 |
| sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 798 | 982 | 4.0E-15 |
| sp|Q8BLD6|ANR55_MOUSE | Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 | 733 | 981 | 4.0E-15 |
| sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 686 | 1012 | 5.0E-15 |
| sp|Q9J513|V222_FOWPN | Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 | 699 | 916 | 5.0E-15 |
| sp|F8W2M1|HACE1_DANRE | E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 | 798 | 1067 | 5.0E-15 |
| sp|Q6C520|AKR1_YARLI | Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 | 689 | 930 | 6.0E-15 |
| sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 792 | 936 | 6.0E-15 |
| sp|Q9H560|ANR19_HUMAN | Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 | 691 | 875 | 6.0E-15 |
| sp|Q59H18|TNI3K_HUMAN | Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 | 821 | 1009 | 7.0E-15 |
| sp|Q9VUX2|MIB_DROME | E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 | 764 | 1019 | 7.0E-15 |
| sp|Q6GNY1|MIB1_XENLA | E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 | 667 | 968 | 7.0E-15 |
| sp|Q5M9H0|ANKS3_RAT | Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 | 834 | 997 | 7.0E-15 |
| sp|Q6S5H4|POTEB_HUMAN | POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 | 756 | 950 | 8.0E-15 |
| sp|A0JP26|POTB3_HUMAN | POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 | 756 | 950 | 8.0E-15 |
| sp|Q18297|TRPA1_CAEEL | Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 | 690 | 1046 | 8.0E-15 |
| sp|Q8N9B4|ANR42_HUMAN | Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 | 667 | 926 | 8.0E-15 |
| sp|B2RU33|POTEC_HUMAN | POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 | 756 | 950 | 9.0E-15 |
| sp|H3BUK9|POTB2_HUMAN | POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 | 756 | 950 | 9.0E-15 |
| sp|P98150|NFKB2_CHICK | Nuclear factor NF-kappa-B p100 subunit OS=Gallus gallus GN=NFKB2 PE=1 SV=1 | 713 | 923 | 1.0E-14 |
| sp|Q5U312|RAI14_RAT | Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 | 782 | 1000 | 1.0E-14 |
| sp|Q9P0K7|RAI14_HUMAN | Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 | 669 | 897 | 1.0E-14 |
| sp|Q4P6L3|AKR1_USTMA | Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 | 669 | 892 | 1.0E-14 |
| sp|E1C656|HACE1_CHICK | E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 | 798 | 982 | 1.0E-14 |
| sp|P07207|NOTCH_DROME | Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 | 724 | 986 | 1.0E-14 |
| sp|Q8C6Y6|ASB14_MOUSE | Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 | 677 | 982 | 1.0E-14 |
| sp|Q8C6Y6|ASB14_MOUSE | Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 | 678 | 982 | 1.0E-14 |
| sp|Q5BKI6|ANKR1_XENTR | Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 | 732 | 908 | 1.0E-14 |
| sp|Q80VM7|ANR24_MOUSE | Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 | 827 | 982 | 1.0E-14 |
| sp|Q6ZVH7|ESPNL_HUMAN | Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 | 733 | 981 | 1.0E-14 |
| sp|Q96AX9|MIB2_HUMAN | E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 | 695 | 981 | 1.0E-14 |
| sp|Q91ZT7|ASB10_MOUSE | Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 | 699 | 903 | 1.0E-14 |
| sp|Q9FY48|KEG_ARATH | E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 | 667 | 970 | 1.0E-14 |
| sp|Q9Y574|ASB4_HUMAN | Ankyrin repeat and SOCS box protein 4 OS=Homo sapiens GN=ASB4 PE=2 SV=1 | 733 | 966 | 1.0E-14 |
| sp|A6NC57|ANR62_HUMAN | Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 | 756 | 944 | 1.0E-14 |
| sp|Q86YR6|POTED_HUMAN | POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 | 755 | 950 | 2.0E-14 |
| sp|Q6S5H5|POTEG_HUMAN | POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 | 782 | 981 | 2.0E-14 |
| sp|Q9J517|V218_FOWPN | Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 | 701 | 971 | 2.0E-14 |
| sp|Q9D504|ANKR7_MOUSE | Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 | 731 | 889 | 2.0E-14 |
| sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 792 | 936 | 2.0E-14 |
| sp|Q6S8J7|POTEA_HUMAN | POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 | 782 | 981 | 2.0E-14 |
| sp|Q8N283|ANR35_HUMAN | Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 | 694 | 870 | 2.0E-14 |
| sp|Q68LP1|MIB2_RAT | E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 | 731 | 969 | 2.0E-14 |
| sp|O00221|IKBE_HUMAN | NF-kappa-B inhibitor epsilon OS=Homo sapiens GN=NFKBIE PE=1 SV=3 | 732 | 888 | 2.0E-14 |
| sp|O54910|IKBE_MOUSE | NF-kappa-B inhibitor epsilon OS=Mus musculus GN=Nfkbie PE=1 SV=2 | 723 | 888 | 2.0E-14 |
| sp|Q7ZT11|ANKR1_CHICK | Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 | 734 | 908 | 2.0E-14 |
| sp|A2AS55|ANR16_MOUSE | Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 | 733 | 1046 | 2.0E-14 |
| sp|Q59H18|TNI3K_HUMAN | Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 | 799 | 1045 | 3.0E-14 |
| sp|Q5RF15|TNI3K_PONAB | Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 | 799 | 1045 | 3.0E-14 |
| sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 796 | 982 | 3.0E-14 |
| sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 735 | 1026 | 3.0E-14 |
| sp|Q9Z2F6|BCL3_MOUSE | B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 | 733 | 907 | 3.0E-14 |
| sp|Q9J517|V218_FOWPN | Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 | 670 | 834 | 3.0E-14 |
| sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 646 | 982 | 3.0E-14 |
| sp|Q54HW1|PSD10_DICDI | 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 | 814 | 1005 | 3.0E-14 |
| sp|Q54HW1|PSD10_DICDI | 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 | 667 | 847 | 3.0E-14 |
| sp|Q641X1|ANR61_RAT | Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 | 663 | 902 | 3.0E-14 |
| sp|A6NGH8|ANR61_HUMAN | Ankyrin repeat domain-containing protein 61 OS=Homo sapiens GN=ANKRD61 PE=3 SV=2 | 663 | 902 | 3.0E-14 |
| sp|Q91ZU0|ASB7_MOUSE | Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 | 667 | 905 | 3.0E-14 |
| sp|Q5JPF3|AN36C_HUMAN | Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 | 666 | 860 | 3.0E-14 |
| sp|Q1RI12|Y921_RICBR | Putative ankyrin repeat protein RBE_0921 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0921 PE=3 SV=1 | 656 | 982 | 3.0E-14 |
| sp|Q9TU71|ANKR1_RABIT | Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 | 761 | 900 | 3.0E-14 |
| sp|Q5CZ79|AN20B_HUMAN | Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 | 686 | 860 | 3.0E-14 |
| sp|Q6P6B7|ANR16_HUMAN | Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 | 733 | 1035 | 3.0E-14 |
| sp|Q865U8|ANKR1_PIG | Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 | 761 | 900 | 3.0E-14 |
| sp|Q2T9W8|ANR61_BOVIN | Ankyrin repeat domain-containing protein 61 OS=Bos taurus GN=ANKRD61 PE=2 SV=1 | 671 | 909 | 3.0E-14 |
| sp|Q1RMI3|GABP1_BOVIN | GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 | 749 | 968 | 3.0E-14 |
| sp|Q7TQP6|TNI3K_RAT | Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 | 773 | 1009 | 4.0E-14 |
| sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 669 | 982 | 4.0E-14 |
| sp|Q6S545|POTEH_HUMAN | POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 | 782 | 981 | 4.0E-14 |
| sp|Q6S8J3|POTEE_HUMAN | POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 | 790 | 981 | 4.0E-14 |
| sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 697 | 1010 | 4.0E-14 |
| sp|Q91974|IKBA_CHICK | NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 | 696 | 893 | 4.0E-14 |
| sp|Q2T9W8|ANR61_BOVIN | Ankyrin repeat domain-containing protein 61 OS=Bos taurus GN=ANKRD61 PE=2 SV=1 | 734 | 973 | 4.0E-14 |
| sp|Q96NS5|ASB16_HUMAN | Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens GN=ASB16 PE=1 SV=2 | 700 | 903 | 4.0E-14 |
| sp|Q7XUW4|KOR2_ORYSJ | Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 | 666 | 851 | 4.0E-14 |
| sp|Q4KL97|ANKR1_XENLA | Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 | 754 | 908 | 4.0E-14 |
| sp|Q4I8B6|AKR1_GIBZE | Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 | 684 | 888 | 4.0E-14 |
| sp|Q923M0|PP16A_MOUSE | Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 | 666 | 924 | 4.0E-14 |
| sp|Q9QW30|NOTC2_RAT | Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 | 693 | 948 | 4.0E-14 |
| sp|Q812A3|ANR23_MOUSE | Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 | 804 | 969 | 4.0E-14 |
| sp|Q04721|NOTC2_HUMAN | Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 | 693 | 948 | 4.0E-14 |
| sp|O73630|NFKB2_XENLA | Nuclear factor NF-kappa-B p100 subunit OS=Xenopus laevis GN=nfkb2 PE=2 SV=1 | 713 | 926 | 5.0E-14 |
| sp|A6NI47|POTEM_HUMAN | Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 | 782 | 981 | 5.0E-14 |
| sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 693 | 982 | 5.0E-14 |
| sp|P97570|PLPL9_RAT | 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 | 661 | 906 | 5.0E-14 |
| sp|Q6ZW76|ANKS3_HUMAN | Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 | 834 | 1010 | 5.0E-14 |
| sp|Q9BGT9|ASB7_MACFA | Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 | 667 | 878 | 5.0E-14 |
| sp|Q28BK1|HACE1_XENTR | E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 | 798 | 1040 | 5.0E-14 |
| sp|Q6DCL5|HACE1_XENLA | E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 | 798 | 1040 | 5.0E-14 |
| sp|Q8BLA8|TRPA1_MOUSE | Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 | 700 | 1009 | 6.0E-14 |
| sp|Q8K0L0|ASB2_MOUSE | Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 | 677 | 982 | 6.0E-14 |
| sp|Q6S5H5|POTEG_HUMAN | POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 | 756 | 950 | 6.0E-14 |
| sp|P0CG39|POTEJ_HUMAN | POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 | 796 | 981 | 6.0E-14 |
| sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 797 | 969 | 6.0E-14 |
| sp|Q6ZW76|ANKS3_HUMAN | Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 | 766 | 945 | 6.0E-14 |
| sp|Q8N283|ANR35_HUMAN | Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 | 761 | 948 | 6.0E-14 |
| sp|Q9EP71|RAI14_MOUSE | Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 | 701 | 924 | 6.0E-14 |
| sp|Q9J516|V219_FOWPN | Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 | 666 | 929 | 6.0E-14 |
| sp|O35516|NOTC2_MOUSE | Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 | 693 | 948 | 6.0E-14 |
| sp|P0C927|ASB14_RAT | Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 | 681 | 982 | 6.0E-14 |
| sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 665 | 893 | 7.0E-14 |
| sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 782 | 1009 | 7.0E-14 |
| sp|O75762|TRPA1_HUMAN | Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 | 667 | 922 | 7.0E-14 |
| sp|Q6S545|POTEH_HUMAN | POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 | 756 | 950 | 7.0E-14 |
| sp|P0CG38|POTEI_HUMAN | POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 | 796 | 981 | 7.0E-14 |
| sp|P97819|PLPL9_MOUSE | 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 | 661 | 906 | 7.0E-14 |
| sp|Q05823|RN5A_HUMAN | 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 | 701 | 1009 | 7.0E-14 |
| sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 797 | 969 | 7.0E-14 |
| sp|Q9H672|ASB7_HUMAN | Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 | 667 | 878 | 7.0E-14 |
| sp|Q5RCK5|ASB7_PONAB | Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 | 667 | 878 | 7.0E-14 |
| sp|Q9CR42|ANKR1_MOUSE | Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 | 761 | 900 | 7.0E-14 |
| sp|Q15327|ANKR1_HUMAN | Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 | 761 | 900 | 7.0E-14 |
| sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 665 | 893 | 8.0E-14 |
| sp|Q5RF15|TNI3K_PONAB | Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 | 821 | 1009 | 8.0E-14 |
| sp|A6NI47|POTEM_HUMAN | Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 | 756 | 950 | 8.0E-14 |
| sp|O60237|MYPT2_HUMAN | Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens GN=PPP1R12B PE=1 SV=2 | 684 | 903 | 8.0E-14 |
| sp|Q9H9B1|EHMT1_HUMAN | Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 | 822 | 1008 | 8.0E-14 |
| sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 744 | 903 | 8.0E-14 |
| sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 796 | 982 | 9.0E-14 |
| sp|A5A3E0|POTEF_HUMAN | POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 | 796 | 981 | 9.0E-14 |
| sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 693 | 982 | 9.0E-14 |
| sp|Q9EP71|RAI14_MOUSE | Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 | 782 | 1000 | 9.0E-14 |
| sp|F8W2M1|HACE1_DANRE | E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 | 692 | 907 | 9.0E-14 |
| sp|Q5CZ79|AN20B_HUMAN | Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 | 742 | 949 | 9.0E-14 |
| sp|Q8N2N9|AN36B_HUMAN | Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 | 669 | 860 | 9.0E-14 |
| sp|Q00420|GABP1_MOUSE | GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 | 749 | 968 | 9.0E-14 |
| sp|Q755Y0|AKR1_ASHGO | Palmitoyltransferase AKR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AKR1 PE=3 SV=1 | 685 | 901 | 9.0E-14 |
| sp|Q499M5|ANR16_RAT | Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 | 729 | 1027 | 9.0E-14 |
| sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 654 | 916 | 1.0E-13 |
| sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 667 | 982 | 1.0E-13 |
| sp|Q3V096|ANR42_MOUSE | Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 | 667 | 908 | 1.0E-13 |
| sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 667 | 921 | 1.0E-13 |
| sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 790 | 1012 | 1.0E-13 |
| sp|Q6S8J3|POTEE_HUMAN | POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 | 756 | 950 | 1.0E-13 |
| sp|Q8VHS5|ASB16_MOUSE | Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 | 733 | 933 | 1.0E-13 |
| sp|Q8BLD6|ANR55_MOUSE | Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 | 694 | 965 | 1.0E-13 |
| sp|Q6P6B7|ANR16_HUMAN | Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 | 697 | 982 | 1.0E-13 |
| sp|Q653P0|KOR1_ORYSJ | Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 | 813 | 981 | 1.0E-13 |
| sp|Q5TYW2|A20A1_HUMAN | Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 | 686 | 860 | 1.0E-13 |
| sp|A2A2Z9|AN18B_HUMAN | Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 | 730 | 965 | 1.0E-13 |
| sp|Q8R560|ANKR1_RAT | Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 | 761 | 900 | 1.0E-13 |
| sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 772 | 1010 | 2.0E-13 |
| sp|Q9P2R3|ANFY1_HUMAN | Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 | 677 | 1007 | 2.0E-13 |
| sp|Q3V096|ANR42_MOUSE | Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 | 665 | 976 | 2.0E-13 |
| sp|P0CG38|POTEI_HUMAN | POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 | 756 | 950 | 2.0E-13 |
| sp|P0CG39|POTEJ_HUMAN | POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 | 756 | 950 | 2.0E-13 |
| sp|Q5ZIJ9|MIB2_CHICK | E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 | 701 | 969 | 2.0E-13 |
| sp|Q08353|IKBA_PIG | NF-kappa-B inhibitor alpha OS=Sus scrofa GN=NFKBIA PE=2 SV=1 | 735 | 902 | 2.0E-13 |
| sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 827 | 969 | 2.0E-13 |
| sp|O60733|PLPL9_HUMAN | 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 | 661 | 907 | 2.0E-13 |
| sp|Q28BK1|HACE1_XENTR | E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 | 825 | 983 | 2.0E-13 |
| sp|Q6DCL5|HACE1_XENLA | E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 | 825 | 983 | 2.0E-13 |
| sp|P0C927|ASB14_RAT | Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 | 724 | 1012 | 2.0E-13 |
| sp|Q06547|GABP1_HUMAN | GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 | 749 | 910 | 2.0E-13 |
| sp|Q9Z2X3|PSD10_RAT | 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 | 731 | 903 | 2.0E-13 |
| sp|Q4UJ75|A20A4_HUMAN | Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 | 686 | 860 | 2.0E-13 |
| sp|Q0JKV1|AKT1_ORYSJ | Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 | 696 | 866 | 2.0E-13 |
| sp|Q8BG95|MYPT2_MOUSE | Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 | 704 | 903 | 2.0E-13 |
| sp|P0C550|AKT1_ORYSI | Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 | 696 | 866 | 2.0E-13 |
| sp|Q9ET47|ESPN_MOUSE | Espin OS=Mus musculus GN=Espn PE=1 SV=2 | 734 | 996 | 2.0E-13 |
| sp|Q9ET47|ESPN_MOUSE | Espin OS=Mus musculus GN=Espn PE=1 SV=2 | 693 | 974 | 2.0E-13 |
| sp|Q5VUR7|A20A3_HUMAN | Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 | 686 | 860 | 2.0E-13 |
| sp|Q5SQ80|A20A2_HUMAN | Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 | 686 | 860 | 2.0E-13 |
| sp|A5PMU4|ANS1B_DANRE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 | 754 | 980 | 2.0E-13 |
| sp|Q8N6D5|ANR29_HUMAN | Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 | 855 | 1009 | 2.0E-13 |
| sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 209 | 559 | 2.0E-13 |
| sp|Q5GIG6|TNI3K_MOUSE | Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 | 821 | 1009 | 3.0E-13 |
| sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 654 | 887 | 3.0E-13 |
| sp|Q9VUX2|MIB_DROME | E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 | 667 | 900 | 3.0E-13 |
| sp|A5A3E0|POTEF_HUMAN | POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 | 756 | 950 | 3.0E-13 |
| sp|Q4R3S3|ANKR7_MACFA | Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 | 783 | 973 | 3.0E-13 |
| sp|Q9D504|ANKR7_MOUSE | Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 | 751 | 973 | 3.0E-13 |
| sp|Q8N283|ANR35_HUMAN | Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 | 732 | 903 | 3.0E-13 |
| sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 827 | 1001 | 3.0E-13 |
| sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 825 | 983 | 3.0E-13 |
| sp|E1C656|HACE1_CHICK | E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 | 825 | 983 | 3.0E-13 |
| sp|E1C656|HACE1_CHICK | E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 | 700 | 907 | 3.0E-13 |
| sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 667 | 804 | 3.0E-13 |
| sp|Q5TYW2|A20A1_HUMAN | Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 | 742 | 930 | 3.0E-13 |
| sp|Q9D1A4|ASB5_MOUSE | Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 | 699 | 930 | 3.0E-13 |
| sp|Q7EZ44|XB35_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS35 OS=Oryza sativa subsp. japonica GN=XBOS35 PE=2 SV=1 | 659 | 925 | 3.0E-13 |
| sp|Q9Z148|EHMT2_MOUSE | Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 | 748 | 982 | 3.0E-13 |
| sp|Q96DX5|ASB9_HUMAN | Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 | 699 | 924 | 3.0E-13 |
| sp|Q8IVF6|AN18A_HUMAN | Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 | 730 | 965 | 3.0E-13 |
| sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 654 | 887 | 4.0E-13 |
| sp|Q54HW1|PSD10_DICDI | 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 | 781 | 970 | 4.0E-13 |
| sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 825 | 969 | 4.0E-13 |
| sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 792 | 936 | 4.0E-13 |
| sp|Q5M9H0|ANKS3_RAT | Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 | 767 | 961 | 4.0E-13 |
| sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 825 | 983 | 4.0E-13 |
| sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 825 | 983 | 4.0E-13 |
| sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 825 | 983 | 4.0E-13 |
| sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 683 | 837 | 4.0E-13 |
| sp|B1AK53|ESPN_HUMAN | Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 | 734 | 1009 | 4.0E-13 |
| sp|B1AK53|ESPN_HUMAN | Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 | 661 | 865 | 4.0E-13 |
| sp|Q63618|ESPN_RAT | Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 | 693 | 974 | 4.0E-13 |
| sp|P31695|NOTC4_MOUSE | Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 | 695 | 879 | 4.0E-13 |
| sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 667 | 885 | 5.0E-13 |
| sp|Q86YR6|POTED_HUMAN | POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 | 819 | 1009 | 5.0E-13 |
| sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 667 | 982 | 5.0E-13 |
| sp|Q8ZWC4|Y1861_PYRAE | Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 | 801 | 1004 | 5.0E-13 |
| sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 790 | 986 | 5.0E-13 |
| sp|F8W2M1|HACE1_DANRE | E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 | 825 | 983 | 5.0E-13 |
| sp|Q8IVF6|AN18A_HUMAN | Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 | 787 | 999 | 5.0E-13 |
| sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 667 | 930 | 6.0E-13 |
| sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 654 | 887 | 6.0E-13 |
| sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 817 | 982 | 6.0E-13 |
| sp|H3BUK9|POTB2_HUMAN | POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 | 819 | 1009 | 6.0E-13 |
| sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 825 | 969 | 6.0E-13 |
| sp|Q9CZK6|ANKS3_MOUSE | Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 | 801 | 1000 | 6.0E-13 |
| sp|Q3UYR4|ESPNL_MOUSE | Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 | 761 | 1010 | 6.0E-13 |
| sp|Q5VUR7|A20A3_HUMAN | Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 | 742 | 930 | 6.0E-13 |
| sp|Q61982|NOTC3_MOUSE | Neurogenic locus notch homolog protein 3 OS=Mus musculus GN=Notch3 PE=1 SV=1 | 747 | 948 | 6.0E-13 |
| sp|Q9CQM6|ANR61_MOUSE | Ankyrin repeat domain-containing protein 61 OS=Mus musculus GN=Ankrd61 PE=2 SV=1 | 663 | 902 | 6.0E-13 |
| sp|Q9R172|NOTC3_RAT | Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus GN=Notch3 PE=2 SV=2 | 747 | 948 | 6.0E-13 |
| sp|P0C927|ASB14_RAT | Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 | 662 | 906 | 7.0E-13 |
| sp|Q9Z2X3|PSD10_RAT | 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 | 797 | 969 | 7.0E-13 |
| sp|Q5SQ80|A20A2_HUMAN | Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 | 742 | 930 | 7.0E-13 |
| sp|Q5GIG6|TNI3K_MOUSE | Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 | 813 | 1045 | 8.0E-13 |
| sp|Q6S5H4|POTEB_HUMAN | POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 | 819 | 1009 | 8.0E-13 |
| sp|A0JP26|POTB3_HUMAN | POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 | 819 | 1009 | 8.0E-13 |
| sp|Q812A3|ANR23_MOUSE | Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 | 744 | 903 | 8.0E-13 |
| sp|Q63618|ESPN_RAT | Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 | 734 | 996 | 8.0E-13 |
| sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 654 | 887 | 9.0E-13 |
| sp|Q8N9B4|ANR42_HUMAN | Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 | 778 | 1068 | 9.0E-13 |
| sp|Q8N6D5|ANR29_HUMAN | Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 | 756 | 982 | 9.0E-13 |
| sp|Q10311|YD58_SCHPO | Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 | 823 | 994 | 9.0E-13 |
| sp|Q6RI86|TRPA1_RAT | Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 | 757 | 1005 | 1.0E-12 |
| sp|O44997|DAPK_CAEEL | Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 | 733 | 983 | 1.0E-12 |
| sp|Q92527|ANKR7_HUMAN | Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 | 732 | 889 | 1.0E-12 |
| sp|Q9Y575|ASB3_HUMAN | Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 | 668 | 955 | 1.0E-12 |
| sp|Q8N283|ANR35_HUMAN | Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 | 798 | 969 | 1.0E-12 |
| sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 700 | 916 | 1.0E-12 |
| sp|Q91ZT7|ASB10_MOUSE | Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 | 766 | 1001 | 1.0E-12 |
| sp|Q28BK1|HACE1_XENTR | E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 | 700 | 907 | 1.0E-12 |
| sp|Q6DCL5|HACE1_XENLA | E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 | 700 | 907 | 1.0E-12 |
| sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 704 | 873 | 1.0E-12 |
| sp|Q5UPJ9|YL122_MIMIV | Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 | 679 | 1004 | 1.0E-12 |
| sp|Q09701|AKR1_SCHPO | Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 | 689 | 854 | 1.0E-12 |
| sp|Q554E7|ZDHC5_DICDI | Putative ZDHHC-type palmitoyltransferase 5 OS=Dictyostelium discoideum GN=DDB_G0275097 PE=3 SV=1 | 796 | 981 | 1.0E-12 |
| sp|Q9UM47|NOTC3_HUMAN | Neurogenic locus notch homolog protein 3 OS=Homo sapiens GN=NOTCH3 PE=1 SV=2 | 747 | 948 | 1.0E-12 |
| sp|Q9BZL4|PP12C_HUMAN | Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens GN=PPP1R12C PE=1 SV=1 | 735 | 903 | 1.0E-12 |
| sp|Q8HXA6|ASB15_BOVIN | Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 | 823 | 982 | 1.0E-12 |
| sp|Q8TC84|FANK1_HUMAN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 | 768 | 981 | 1.0E-12 |
| sp|Q96I34|PP16A_HUMAN | Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens GN=PPP1R16A PE=1 SV=1 | 733 | 916 | 1.0E-12 |
| sp|Q9JIA3|IKBB_RAT | NF-kappa-B inhibitor beta OS=Rattus norvegicus GN=Nfkbib PE=1 SV=1 | 733 | 953 | 1.0E-12 |
| sp|Q9J5I3|V018_FOWPN | Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 | 683 | 1041 | 1.0E-12 |
| sp|Q8NI38|IKBD_HUMAN | NF-kappa-B inhibitor delta OS=Homo sapiens GN=NFKBID PE=1 SV=1 | 757 | 981 | 1.0E-12 |
| sp|Q9XZC0|LCTA_LATTR | Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 | 642 | 1010 | 2.0E-12 |
| sp|Q25338|LITD_LATTR | Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 | 749 | 958 | 2.0E-12 |
| sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 801 | 1009 | 2.0E-12 |
| sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 772 | 1009 | 2.0E-12 |
| sp|B2RU33|POTEC_HUMAN | POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 | 819 | 1009 | 2.0E-12 |
| sp|Q5U312|RAI14_RAT | Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 | 701 | 924 | 2.0E-12 |
| sp|Q63746|IKBA_RAT | NF-kappa-B inhibitor alpha OS=Rattus norvegicus GN=Nfkbia PE=2 SV=1 | 735 | 902 | 2.0E-12 |
| sp|Q9EP71|RAI14_MOUSE | Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 | 669 | 897 | 2.0E-12 |
| sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 698 | 949 | 2.0E-12 |
| sp|Q5DW34|EHMT1_MOUSE | Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 | 622 | 937 | 2.0E-12 |
| sp|Q9FY48|KEG_ARATH | E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 | 757 | 982 | 2.0E-12 |
| sp|Q7ZT11|ANKR1_CHICK | Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 | 728 | 867 | 2.0E-12 |
| sp|A2AS55|ANR16_MOUSE | Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 | 693 | 968 | 2.0E-12 |
| sp|A2A2Z9|AN18B_HUMAN | Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 | 691 | 865 | 2.0E-12 |
| sp|Q9Z2X3|PSD10_RAT | 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 | 661 | 870 | 2.0E-12 |
| sp|Q4UJ75|A20A4_HUMAN | Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 | 742 | 930 | 2.0E-12 |
| sp|A5PMU4|ANS1B_DANRE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 | 733 | 933 | 2.0E-12 |
| sp|Q5ZLC6|ANR10_CHICK | Ankyrin repeat domain-containing protein 10 OS=Gallus gallus GN=ANKRD10 PE=2 SV=1 | 696 | 852 | 2.0E-12 |
| sp|Q0VGY8|TANC1_MOUSE | Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 | 670 | 952 | 2.0E-12 |
| sp|Q875S9|AKR1_LACK1 | Palmitoyltransferase AKR1 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=AKR1 PE=3 SV=1 | 685 | 890 | 2.0E-12 |
| sp|A4D7T3|ASZ1_MACEU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 | 804 | 987 | 2.0E-12 |
| sp|Q5UQV3|YL371_MIMIV | Putative ankyrin repeat protein L371 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L371 PE=3 SV=1 | 735 | 951 | 2.0E-12 |
| sp|Q8T2Q0|ZDHC6_DICDI | Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 | 694 | 866 | 2.0E-12 |
| sp|Q9SCX5|AKT5_ARATH | Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 | 796 | 987 | 2.0E-12 |
| sp|Q99466|NOTC4_HUMAN | Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 | 691 | 926 | 2.0E-12 |
| sp|Q86AT8|SPKA_DICDI | Stress-activated protein kinase alpha OS=Dictyostelium discoideum GN=spkA-1 PE=1 SV=1 | 756 | 923 | 2.0E-12 |
| sp|Q92625|ANS1A_HUMAN | Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 | 754 | 966 | 2.0E-12 |
| sp|Q9W0T5|PYX_DROME | Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 | 665 | 828 | 3.0E-12 |
| sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 732 | 1007 | 3.0E-12 |
| sp|Q9Z2F6|BCL3_MOUSE | B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 | 680 | 870 | 3.0E-12 |
| sp|Q5U312|RAI14_RAT | Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 | 669 | 897 | 3.0E-12 |
| sp|Q63746|IKBA_RAT | NF-kappa-B inhibitor alpha OS=Rattus norvegicus GN=Nfkbia PE=2 SV=1 | 696 | 866 | 3.0E-12 |
| sp|P25963|IKBA_HUMAN | NF-kappa-B inhibitor alpha OS=Homo sapiens GN=NFKBIA PE=1 SV=1 | 735 | 902 | 3.0E-12 |
| sp|Q9H560|ANR19_HUMAN | Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 | 787 | 999 | 3.0E-12 |
| sp|Q94A76|GORK_ARATH | Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 | 837 | 1001 | 3.0E-12 |
| sp|Q9Z1E3|IKBA_MOUSE | NF-kappa-B inhibitor alpha OS=Mus musculus GN=Nfkbia PE=1 SV=2 | 735 | 902 | 3.0E-12 |
| sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 700 | 916 | 3.0E-12 |
| sp|Q6ZVH7|ESPNL_HUMAN | Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 | 745 | 982 | 3.0E-12 |
| sp|A6NC57|ANR62_HUMAN | Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 | 669 | 895 | 3.0E-12 |
| sp|P31695|NOTC4_MOUSE | Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 | 764 | 926 | 3.0E-12 |
| sp|Q05753|AKRP_ARATH | Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 | 676 | 867 | 3.0E-12 |
| sp|Q96KQ7|EHMT2_HUMAN | Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 | 748 | 982 | 3.0E-12 |
| sp|Q4ULZ2|Y580_RICFE | Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 | 693 | 890 | 3.0E-12 |
| sp|Q03017|CACT_DROME | NF-kappa-B inhibitor cactus OS=Drosophila melanogaster GN=cact PE=1 SV=2 | 693 | 916 | 3.0E-12 |
| sp|Q9SQK3|EM506_ARATH | Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 | 767 | 909 | 3.0E-12 |
| sp|Q8CGB3|UACA_MOUSE | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 | 746 | 889 | 3.0E-12 |
| sp|Q15653|IKBB_HUMAN | NF-kappa-B inhibitor beta OS=Homo sapiens GN=NFKBIB PE=1 SV=2 | 733 | 952 | 3.0E-12 |
| sp|Q8TF21|ANR24_HUMAN | Ankyrin repeat domain-containing protein 24 OS=Homo sapiens GN=ANKRD24 PE=2 SV=2 | 816 | 982 | 3.0E-12 |
| sp|Q6F6B3|TANC1_RAT | Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 | 778 | 952 | 3.0E-12 |
| sp|Q3UMT1|PP12C_MOUSE | Protein phosphatase 1 regulatory subunit 12C OS=Mus musculus GN=Ppp1r12c PE=1 SV=1 | 735 | 903 | 3.0E-12 |
| sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 827 | 981 | 4.0E-12 |
| sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 660 | 889 | 4.0E-12 |
| sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 858 | 1023 | 4.0E-12 |
| sp|Q9P0K7|RAI14_HUMAN | Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 | 701 | 924 | 4.0E-12 |
| sp|Q9P0K7|RAI14_HUMAN | Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 | 782 | 1000 | 4.0E-12 |
| sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 700 | 907 | 4.0E-12 |
| sp|Q8N2N9|AN36B_HUMAN | Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 | 793 | 981 | 4.0E-12 |
| sp|Q61982|NOTC3_MOUSE | Neurogenic locus notch homolog protein 3 OS=Mus musculus GN=Notch3 PE=1 SV=1 | 813 | 982 | 4.0E-12 |
| sp|Q9J5H7|V024_FOWPN | Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 | 669 | 969 | 4.0E-12 |
| sp|Q5UPA0|YL025_MIMIV | Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 | 696 | 981 | 4.0E-12 |
| sp|Q6F3J0|NFKB1_CANLF | Nuclear factor NF-kappa-B p105 subunit OS=Canis lupus familiaris GN=NFKB1 PE=2 SV=2 | 747 | 940 | 4.0E-12 |
| sp|Q6ZVZ8|ASB18_HUMAN | Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens GN=ASB18 PE=2 SV=2 | 699 | 900 | 4.0E-12 |
| sp|Q04861|NFKB1_CHICK | Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus GN=NFKB1 PE=2 SV=2 | 693 | 892 | 4.0E-12 |
| sp|Q9J507|V228_FOWPN | Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 | 714 | 970 | 4.0E-12 |
| sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 700 | 907 | 5.0E-12 |
| sp|E1C656|HACE1_CHICK | E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 | 762 | 928 | 5.0E-12 |
| sp|Q4I8B6|AKR1_GIBZE | Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 | 733 | 918 | 5.0E-12 |
| sp|A5PMU4|ANS1B_DANRE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 | 819 | 982 | 5.0E-12 |
| sp|Q9R172|NOTC3_RAT | Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus GN=Notch3 PE=2 SV=2 | 813 | 982 | 5.0E-12 |
| sp|A7E2S9|A30BL_HUMAN | Putative ankyrin repeat domain-containing protein 30B-like OS=Homo sapiens GN=ANKRD30BL PE=2 SV=3 | 693 | 829 | 5.0E-12 |
| sp|Q9WV71|ASB4_MOUSE | Ankyrin repeat and SOCS box protein 4 OS=Mus musculus GN=Asb4 PE=1 SV=1 | 730 | 966 | 5.0E-12 |
| sp|Q60778|IKBB_MOUSE | NF-kappa-B inhibitor beta OS=Mus musculus GN=Nfkbib PE=1 SV=2 | 733 | 952 | 5.0E-12 |
| sp|Q8WXK1|ASB15_HUMAN | Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 | 747 | 1001 | 5.0E-12 |
| sp|Q9J5I7|V014_FOWPN | Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 | 707 | 949 | 5.0E-12 |
| sp|Q8R516|MIB2_MOUSE | E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 | 732 | 982 | 6.0E-12 |
| sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 759 | 928 | 6.0E-12 |
| sp|B1AK53|ESPN_HUMAN | Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 | 693 | 981 | 6.0E-12 |
| sp|Q9UM47|NOTC3_HUMAN | Neurogenic locus notch homolog protein 3 OS=Homo sapiens GN=NOTCH3 PE=1 SV=2 | 676 | 982 | 6.0E-12 |
| sp|Q6DRG7|MYPT1_DANRE | Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 | 716 | 903 | 6.0E-12 |
| sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 667 | 930 | 7.0E-12 |
| sp|Q7TQP6|TNI3K_RAT | Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 | 813 | 1045 | 7.0E-12 |
| sp|P97570|PLPL9_RAT | 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 | 694 | 949 | 7.0E-12 |
| sp|P97819|PLPL9_MOUSE | 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 | 694 | 949 | 7.0E-12 |
| sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 759 | 928 | 7.0E-12 |
| sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 759 | 928 | 7.0E-12 |
| sp|Q9Z2X3|PSD10_RAT | 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 | 827 | 1001 | 7.0E-12 |
| sp|Q6UB98|ANR12_HUMAN | Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 | 782 | 916 | 7.0E-12 |
| sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 667 | 866 | 8.0E-12 |
| sp|Q9Z1E3|IKBA_MOUSE | NF-kappa-B inhibitor alpha OS=Mus musculus GN=Nfkbia PE=1 SV=2 | 696 | 866 | 8.0E-12 |
| sp|Q9P0K7|RAI14_HUMAN | Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 | 754 | 933 | 8.0E-12 |
| sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 667 | 837 | 8.0E-12 |
| sp|Q1RI12|Y921_RICBR | Putative ankyrin repeat protein RBE_0921 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0921 PE=3 SV=1 | 715 | 966 | 8.0E-12 |
| sp|Q6F6B3|TANC1_RAT | Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 | 697 | 893 | 8.0E-12 |
| sp|P46530|NOTC1_DANRE | Neurogenic locus notch homolog protein 1 OS=Danio rerio GN=notch1a PE=2 SV=1 | 693 | 948 | 8.0E-12 |
| sp|G3I6Z6|NOTC1_CRIGR | Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus GN=NOTCH1 PE=1 SV=2 | 693 | 948 | 8.0E-12 |
| sp|P25799|NFKB1_MOUSE | Nuclear factor NF-kappa-B p105 subunit OS=Mus musculus GN=Nfkb1 PE=1 SV=2 | 693 | 871 | 8.0E-12 |
| sp|Q18297|TRPA1_CAEEL | Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 | 686 | 1013 | 9.0E-12 |
| sp|Q08DV6|ASB3_BOVIN | Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 | 668 | 886 | 9.0E-12 |
| sp|Q6S8J7|POTEA_HUMAN | POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 | 819 | 1009 | 9.0E-12 |
| sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 693 | 837 | 9.0E-12 |
| sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 759 | 928 | 9.0E-12 |
| sp|Q9CQM6|ANR61_MOUSE | Ankyrin repeat domain-containing protein 61 OS=Mus musculus GN=Ankrd61 PE=2 SV=1 | 734 | 1010 | 9.0E-12 |
| sp|Q9CQ31|ASB11_MOUSE | Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 | 765 | 969 | 9.0E-12 |
| sp|Q99LW0|ANR10_MOUSE | Ankyrin repeat domain-containing protein 10 OS=Mus musculus GN=Ankrd10 PE=2 SV=2 | 697 | 846 | 9.0E-12 |
| sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 690 | 850 | 1.0E-11 |
| sp|Q94A76|GORK_ARATH | Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 | 704 | 870 | 1.0E-11 |
| sp|Q8C6Y6|ASB14_MOUSE | Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 | 662 | 906 | 1.0E-11 |
| sp|Q9H9B1|EHMT1_HUMAN | Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 | 888 | 1010 | 1.0E-11 |
| sp|A2A2Z9|AN18B_HUMAN | Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 | 787 | 999 | 1.0E-11 |
| sp|Q8N6D5|ANR29_HUMAN | Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 | 689 | 916 | 1.0E-11 |
| sp|Q8HXA6|ASB15_BOVIN | Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 | 747 | 1001 | 1.0E-11 |
| sp|Q9J5I3|V018_FOWPN | Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 | 670 | 902 | 1.0E-11 |
| sp|Q92625|ANS1A_HUMAN | Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 | 654 | 867 | 1.0E-11 |
| sp|Q4ULZ2|Y580_RICFE | Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 | 708 | 903 | 1.0E-11 |
| sp|Q8WXK1|ASB15_HUMAN | Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 | 732 | 956 | 1.0E-11 |
| sp|Q9CQ31|ASB11_MOUSE | Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 | 730 | 964 | 1.0E-11 |
| sp|P46531|NOTC1_HUMAN | Neurogenic locus notch homolog protein 1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4 | 693 | 948 | 1.0E-11 |
| sp|Q07008|NOTC1_RAT | Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus GN=Notch1 PE=1 SV=3 | 693 | 948 | 1.0E-11 |
| sp|Q01705|NOTC1_MOUSE | Neurogenic locus notch homolog protein 1 OS=Mus musculus GN=Notch1 PE=1 SV=3 | 693 | 948 | 1.0E-11 |
| sp|P14368|V234_FOWPN | Putative ankyrin repeat protein FPV234 OS=Fowlpox virus (strain NVSL) GN=FPV234 PE=3 SV=2 | 665 | 872 | 1.0E-11 |
| sp|Q9NXR5|ANR10_HUMAN | Ankyrin repeat domain-containing protein 10 OS=Homo sapiens GN=ANKRD10 PE=1 SV=2 | 697 | 816 | 1.0E-11 |
| sp|Q9NXR5|ANR10_HUMAN | Ankyrin repeat domain-containing protein 10 OS=Homo sapiens GN=ANKRD10 PE=1 SV=2 | 700 | 852 | 1.0E-11 |
| sp|Q9Y566|SHAN1_HUMAN | SH3 and multiple ankyrin repeat domains protein 1 OS=Homo sapiens GN=SHANK1 PE=1 SV=2 | 716 | 908 | 1.0E-11 |
| sp|Q52T38|ZDH22_ARATH | Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 | 750 | 904 | 1.0E-11 |
| sp|Q9J5H5|V026_FOWPN | Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 | 764 | 952 | 1.0E-11 |
| sp|Q9BZF9|UACA_HUMAN | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 | 746 | 889 | 1.0E-11 |
| sp|Q9WV72|ASB3_MOUSE | Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 | 668 | 886 | 2.0E-11 |
| sp|Q08353|IKBA_PIG | NF-kappa-B inhibitor alpha OS=Sus scrofa GN=NFKBIA PE=2 SV=1 | 696 | 866 | 2.0E-11 |
| sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 667 | 1020 | 2.0E-11 |
| sp|Q9H560|ANR19_HUMAN | Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 | 716 | 898 | 2.0E-11 |
| sp|Q3ZBX7|ANKR1_BOVIN | Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 | 730 | 867 | 2.0E-11 |
| sp|Q3ZBX7|ANKR1_BOVIN | Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 | 667 | 805 | 2.0E-11 |
| sp|Q9CZK6|ANKS3_MOUSE | Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 | 767 | 961 | 2.0E-11 |
| sp|Q5BKI6|ANKR1_XENTR | Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 | 730 | 867 | 2.0E-11 |
| sp|Q1RMI3|GABP1_BOVIN | GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 | 867 | 982 | 2.0E-11 |
| sp|Q9QW30|NOTC2_RAT | Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 | 813 | 982 | 2.0E-11 |
| sp|Q04721|NOTC2_HUMAN | Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 | 813 | 982 | 2.0E-11 |
| sp|Q5TYW2|A20A1_HUMAN | Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 | 714 | 897 | 2.0E-11 |
| sp|Q06547|GABP1_HUMAN | GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 | 867 | 982 | 2.0E-11 |
| sp|Q0JKV1|AKT1_ORYSJ | Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 | 775 | 982 | 2.0E-11 |
| sp|P0C550|AKT1_ORYSI | Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 | 775 | 982 | 2.0E-11 |
| sp|Q86AT8|SPKA_DICDI | Stress-activated protein kinase alpha OS=Dictyostelium discoideum GN=spkA-1 PE=1 SV=1 | 729 | 915 | 2.0E-11 |
| sp|Q92625|ANS1A_HUMAN | Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 | 819 | 982 | 2.0E-11 |
| sp|Q05753|AKRP_ARATH | Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 | 767 | 916 | 2.0E-11 |
| sp|Q6F3J0|NFKB1_CANLF | Nuclear factor NF-kappa-B p105 subunit OS=Canis lupus familiaris GN=NFKB1 PE=2 SV=2 | 693 | 871 | 2.0E-11 |
| sp|Q04861|NFKB1_CHICK | Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus GN=NFKB1 PE=2 SV=2 | 714 | 907 | 2.0E-11 |
| sp|Q9J507|V228_FOWPN | Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 | 609 | 904 | 2.0E-11 |
| sp|Q9J5I7|V014_FOWPN | Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 | 655 | 902 | 2.0E-11 |
| sp|Q3V0J4|ANR53_MOUSE | Ankyrin repeat domain-containing protein 53 OS=Mus musculus GN=Ankrd53 PE=2 SV=2 | 761 | 867 | 2.0E-11 |
| sp|Q2TB02|IKBD_MOUSE | NF-kappa-B inhibitor delta OS=Mus musculus GN=Nfkbid PE=1 SV=2 | 757 | 981 | 2.0E-11 |
| sp|Q9M8S6|SKOR_ARATH | Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 | 813 | 1041 | 2.0E-11 |
| sp|Q9DAM9|FANK1_MOUSE | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 | 735 | 921 | 2.0E-11 |
| sp|Q8HYY4|UACA_BOVIN | Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 | 746 | 889 | 2.0E-11 |
| sp|Q876A6|AKR1_NAUCC | Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 | 699 | 863 | 2.0E-11 |
| sp|P19838|NFKB1_HUMAN | Nuclear factor NF-kappa-B p105 subunit OS=Homo sapiens GN=NFKB1 PE=1 SV=2 | 693 | 871 | 2.0E-11 |
| sp|Q7TQP6|TNI3K_RAT | Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 | 667 | 856 | 3.0E-11 |
| sp|Q92527|ANKR7_HUMAN | Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 | 783 | 952 | 3.0E-11 |
| sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 732 | 872 | 3.0E-11 |
| sp|Q9H560|ANR19_HUMAN | Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 | 667 | 844 | 3.0E-11 |
| sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 667 | 837 | 3.0E-11 |
| sp|Q94A76|GORK_ARATH | Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 | 747 | 918 | 3.0E-11 |
| sp|Q94A76|GORK_ARATH | Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 | 684 | 849 | 3.0E-11 |
| sp|Q3ZBX7|ANKR1_BOVIN | Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 | 799 | 969 | 3.0E-11 |
| sp|O35516|NOTC2_MOUSE | Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 | 813 | 982 | 3.0E-11 |
| sp|Q5VUR7|A20A3_HUMAN | Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 | 714 | 897 | 3.0E-11 |
| sp|Q5SQ80|A20A2_HUMAN | Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 | 714 | 897 | 3.0E-11 |
| sp|Q8HXA6|ASB15_BOVIN | Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 | 693 | 1002 | 3.0E-11 |
| sp|Q9J5H7|V024_FOWPN | Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 | 701 | 923 | 3.0E-11 |
| sp|Q9J5H7|V024_FOWPN | Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 | 667 | 892 | 3.0E-11 |
| sp|Q9CQ31|ASB11_MOUSE | Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 | 795 | 1018 | 3.0E-11 |
| sp|Q5NVB9|ZDH13_PONAB | Palmitoyltransferase ZDHHC13 OS=Pongo abelii GN=ZDHHC13 PE=2 SV=1 | 637 | 837 | 3.0E-11 |
| sp|Q38998|AKT1_ARATH | Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 | 784 | 981 | 3.0E-11 |
| sp|Q8IUH4|ZDH13_HUMAN | Palmitoyltransferase ZDHHC13 OS=Homo sapiens GN=ZDHHC13 PE=1 SV=3 | 637 | 837 | 3.0E-11 |
| sp|Q9WV48|SHAN1_RAT | SH3 and multiple ankyrin repeat domains protein 1 OS=Rattus norvegicus GN=Shank1 PE=1 SV=1 | 716 | 908 | 3.0E-11 |
| sp|P0C6S7|ANS1B_RAT | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 | 819 | 982 | 3.0E-11 |
| sp|D3YZU1|SHAN1_MOUSE | SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus GN=Shank1 PE=1 SV=1 | 716 | 908 | 3.0E-11 |
| sp|Q9J517|V218_FOWPN | Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 | 735 | 1003 | 4.0E-11 |
| sp|P25963|IKBA_HUMAN | NF-kappa-B inhibitor alpha OS=Homo sapiens GN=NFKBIA PE=1 SV=1 | 696 | 866 | 4.0E-11 |
| sp|Q3UYR4|ESPNL_MOUSE | Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 | 745 | 982 | 4.0E-11 |
| sp|Q7XUW4|KOR2_ORYSJ | Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 | 716 | 870 | 4.0E-11 |
| sp|Q8N6D5|ANR29_HUMAN | Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 | 812 | 988 | 4.0E-11 |
| sp|Q8TF21|ANR24_HUMAN | Ankyrin repeat domain-containing protein 24 OS=Homo sapiens GN=ANKRD24 PE=2 SV=2 | 794 | 981 | 4.0E-11 |
| sp|Q9J507|V228_FOWPN | Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 | 732 | 982 | 4.0E-11 |
| sp|Q6P9K8|CSKI1_MOUSE | Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 | 760 | 968 | 4.0E-11 |
| sp|Q9C0D5|TANC1_HUMAN | Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 | 763 | 952 | 4.0E-11 |
| sp|P39010|AKR1_YEAST | Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR1 PE=1 SV=1 | 694 | 888 | 4.0E-11 |
| sp|Q63369|NFKB1_RAT | Nuclear factor NF-kappa-B p105 subunit (Fragment) OS=Rattus norvegicus GN=Nfkb1 PE=1 SV=1 | 732 | 871 | 4.0E-11 |
| sp|Q7Z6G8|ANS1B_HUMAN | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 | 819 | 982 | 4.0E-11 |
| sp|Q7Z6G8|ANS1B_HUMAN | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 | 754 | 1012 | 4.0E-11 |
| sp|A6QL64|AN36A_HUMAN | Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 | 735 | 965 | 4.0E-11 |
| sp|A2A690|TANC2_MOUSE | Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 | 829 | 1001 | 4.0E-11 |
| sp|Q9HCD6|TANC2_HUMAN | Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 | 829 | 1001 | 4.0E-11 |
| sp|Q9J502|V233_FOWPN | Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 | 748 | 900 | 4.0E-11 |
| sp|Q6S8J7|POTEA_HUMAN | POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 | 653 | 876 | 5.0E-11 |
| sp|Q9J513|V222_FOWPN | Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 | 733 | 994 | 5.0E-11 |
| sp|Q9CR42|ANKR1_MOUSE | Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 | 730 | 867 | 5.0E-11 |
| sp|Q499M5|ANR16_RAT | Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 | 697 | 981 | 5.0E-11 |
| sp|Q99LW0|ANR10_MOUSE | Ankyrin repeat domain-containing protein 10 OS=Mus musculus GN=Ankrd10 PE=2 SV=2 | 721 | 852 | 5.0E-11 |
| sp|A2A690|TANC2_MOUSE | Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 | 666 | 955 | 5.0E-11 |
| sp|Q3EC11|ZDHC2_ARATH | Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 | 735 | 937 | 5.0E-11 |
| sp|Q5URB8|YR841_MIMIV | Putative ankyrin repeat protein R841 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R841 PE=3 SV=1 | 706 | 972 | 5.0E-11 |
| sp|Q54BA2|Y3800_DICDI | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 | 750 | 901 | 5.0E-11 |
| sp|Q95N27|PP16B_BOVIN | Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 | 666 | 900 | 5.0E-11 |
| sp|Q8BIZ1|ANS1B_MOUSE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 | 819 | 982 | 5.0E-11 |
| sp|Q8WXH4|ASB11_HUMAN | Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 | 765 | 970 | 5.0E-11 |
| sp|Q9J504|V231_FOWPN | Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 | 781 | 933 | 5.0E-11 |
| sp|A6NK59|ASB14_HUMAN | Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 | 696 | 982 | 5.0E-11 |
| sp|Q8VHK2|CSKI1_RAT | Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 | 760 | 968 | 5.0E-11 |
| sp|Q3SZE4|ASB11_BOVIN | Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 | 795 | 1018 | 5.0E-11 |
| sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 667 | 797 | 6.0E-11 |
| sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 839 | 983 | 6.0E-11 |
| sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 858 | 982 | 6.0E-11 |
| sp|Q80VM7|ANR24_MOUSE | Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 | 761 | 981 | 6.0E-11 |
| sp|Q00420|GABP1_MOUSE | GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 | 867 | 982 | 6.0E-11 |
| sp|Q8CGB3|UACA_MOUSE | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 | 669 | 856 | 6.0E-11 |
| sp|Q9M8S6|SKOR_ARATH | Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 | 669 | 849 | 6.0E-11 |
| sp|Q8WXH4|ASB11_HUMAN | Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 | 730 | 937 | 6.0E-11 |
| sp|Q8VHS6|ASB15_MOUSE | Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 | 784 | 1078 | 6.0E-11 |
| sp|Q5RFS1|ASB11_PONAB | Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 | 765 | 970 | 6.0E-11 |
| sp|Q96T49|PP16B_HUMAN | Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 | 666 | 900 | 6.0E-11 |
| sp|Q94CT7|XB31_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS31 OS=Oryza sativa subsp. japonica GN=XBOS31 PE=2 SV=1 | 665 | 855 | 6.0E-11 |
| sp|Q8VHQ3|PP16B_MOUSE | Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 | 666 | 900 | 6.0E-11 |
| sp|Q978J0|Y1425_THEVO | Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 | 797 | 946 | 7.0E-11 |
| sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 860 | 1044 | 7.0E-11 |
| sp|Q9CR42|ANKR1_MOUSE | Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 | 667 | 805 | 7.0E-11 |
| sp|Q8TC84|FANK1_HUMAN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 | 669 | 882 | 7.0E-11 |
| sp|Q04861|NFKB1_CHICK | Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus GN=NFKB1 PE=2 SV=2 | 760 | 960 | 7.0E-11 |
| sp|Q5RFS1|ASB11_PONAB | Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 | 730 | 937 | 7.0E-11 |
| sp|P83757|CACT_DROYA | NF-kappa-B inhibitor cactus OS=Drosophila yakuba GN=cact PE=3 SV=1 | 693 | 870 | 7.0E-11 |
| sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 823 | 1055 | 8.0E-11 |
| sp|F8W2M1|HACE1_DANRE | E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 | 759 | 928 | 8.0E-11 |
| sp|Q9JIA3|IKBB_RAT | NF-kappa-B inhibitor beta OS=Rattus norvegicus GN=Nfkbib PE=1 SV=1 | 696 | 900 | 8.0E-11 |
| sp|Q2TB02|IKBD_MOUSE | NF-kappa-B inhibitor delta OS=Mus musculus GN=Nfkbid PE=1 SV=2 | 668 | 868 | 8.0E-11 |
| sp|Q17QS6|ASB5_BOVIN | Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 | 667 | 875 | 8.0E-11 |
| sp|Q4KL97|ANKR1_XENLA | Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 | 659 | 837 | 9.0E-11 |
| sp|Q812A3|ANR23_MOUSE | Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 | 683 | 837 | 9.0E-11 |
| sp|Q28BK1|HACE1_XENTR | E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 | 759 | 928 | 9.0E-11 |
| sp|Q96KQ7|EHMT2_HUMAN | Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 | 750 | 968 | 9.0E-11 |
| sp|Q9HCD6|TANC2_HUMAN | Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 | 666 | 955 | 9.0E-11 |
| sp|Q8WXD9|CSKI1_HUMAN | Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 | 760 | 968 | 9.0E-11 |
| sp|Q4R690|ZDH13_MACFA | Palmitoyltransferase ZDHHC13 OS=Macaca fascicularis GN=ZDHHC13 PE=2 SV=1 | 637 | 837 | 9.0E-11 |
| sp|Q6C520|AKR1_YARLI | Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 | 764 | 937 | 1.0E-10 |
| sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 839 | 983 | 1.0E-10 |
| sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 839 | 983 | 1.0E-10 |
| sp|Q9EP71|RAI14_MOUSE | Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 | 742 | 933 | 1.0E-10 |
| sp|Q5JPF3|AN36C_HUMAN | Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 | 667 | 859 | 1.0E-10 |
| sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 669 | 851 | 1.0E-10 |
| sp|Q68LP1|MIB2_RAT | E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 | 764 | 982 | 1.0E-10 |
| sp|O54910|IKBE_MOUSE | NF-kappa-B inhibitor epsilon OS=Mus musculus GN=Nfkbie PE=1 SV=2 | 764 | 959 | 1.0E-10 |
| sp|Q7XUW4|KOR2_ORYSJ | Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 | 783 | 900 | 1.0E-10 |
| sp|Q812A3|ANR23_MOUSE | Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 | 853 | 983 | 1.0E-10 |
| sp|Q6DCL5|HACE1_XENLA | E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 | 759 | 928 | 1.0E-10 |
| sp|Q4UJ75|A20A4_HUMAN | Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 | 714 | 897 | 1.0E-10 |
| sp|P31695|NOTC4_MOUSE | Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 | 814 | 982 | 1.0E-10 |
| sp|Q8HXA6|ASB15_BOVIN | Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 | 732 | 956 | 1.0E-10 |
| sp|Q92625|ANS1A_HUMAN | Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 | 799 | 982 | 1.0E-10 |
| sp|Q9BZF9|UACA_HUMAN | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 | 816 | 1004 | 1.0E-10 |
| sp|A6QL64|AN36A_HUMAN | Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 | 669 | 860 | 1.0E-10 |
| sp|Q8BIZ1|ANS1B_MOUSE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 | 754 | 980 | 1.0E-10 |
| sp|Q8VHS6|ASB15_MOUSE | Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 | 732 | 956 | 1.0E-10 |
| sp|Q9EST8|IKBZ_MOUSE | NF-kappa-B inhibitor zeta OS=Mus musculus GN=Nfkbiz PE=1 SV=1 | 693 | 951 | 1.0E-10 |
| sp|Q9J5H8|V023_FOWPN | Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 | 750 | 944 | 1.0E-10 |
| sp|Q5UR04|YR911_MIMIV | Putative ankyrin repeat protein R911 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R911 PE=3 SV=1 | 683 | 1010 | 1.0E-10 |
| sp|Q9GL21|UACA_CANLF | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 | 746 | 889 | 1.0E-10 |
| sp|Q07E15|CTTB2_MUSPF | Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 | 655 | 932 | 1.0E-10 |
| sp|Q8IUH5|ZDH17_HUMAN | Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 | 744 | 971 | 1.0E-10 |
| sp|Q9Y6X6|MYO16_HUMAN | Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 | 627 | 888 | 1.0E-10 |
| sp|Q91ZT8|ASB9_MOUSE | Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 | 667 | 867 | 1.0E-10 |
| sp|Q5UQF1|YL483_MIMIV | Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 | 683 | 982 | 1.0E-10 |
| sp|Q5UPF8|YL088_MIMIV | Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 | 790 | 1032 | 2.0E-10 |
| sp|Q3KP44|ANR55_HUMAN | Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 | 799 | 1004 | 2.0E-10 |
| sp|Q05921|RN5A_MOUSE | 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 | 837 | 1024 | 2.0E-10 |
| sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 669 | 851 | 2.0E-10 |
| sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 669 | 851 | 2.0E-10 |
| sp|Q90623|MYPT1_CHICK | Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 | 750 | 969 | 2.0E-10 |
| sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 669 | 851 | 2.0E-10 |
| sp|Q9TU71|ANKR1_RABIT | Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 | 730 | 873 | 2.0E-10 |
| sp|Q5CZ79|AN20B_HUMAN | Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 | 768 | 1021 | 2.0E-10 |
| sp|Q5CZ79|AN20B_HUMAN | Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 | 714 | 897 | 2.0E-10 |
| sp|Q865U8|ANKR1_PIG | Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 | 667 | 806 | 2.0E-10 |
| sp|Q865U8|ANKR1_PIG | Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 | 730 | 873 | 2.0E-10 |
| sp|Q4KL97|ANKR1_XENLA | Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 | 667 | 805 | 2.0E-10 |
| sp|Q8N2N9|AN36B_HUMAN | Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 | 667 | 831 | 2.0E-10 |
| sp|Q8R560|ANKR1_RAT | Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 | 667 | 805 | 2.0E-10 |
| sp|Q61982|NOTC3_MOUSE | Neurogenic locus notch homolog protein 3 OS=Mus musculus GN=Notch3 PE=1 SV=1 | 754 | 981 | 2.0E-10 |
| sp|Q9J5H7|V024_FOWPN | Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 | 699 | 983 | 2.0E-10 |
| sp|Q8WXK1|ASB15_HUMAN | Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 | 693 | 1002 | 2.0E-10 |
| sp|Q9J5I7|V014_FOWPN | Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 | 747 | 982 | 2.0E-10 |
| sp|Q9J5H5|V026_FOWPN | Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 | 735 | 888 | 2.0E-10 |
| sp|Q9M8S6|SKOR_ARATH | Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 | 834 | 1001 | 2.0E-10 |
| sp|Q3SZE4|ASB11_BOVIN | Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 | 765 | 970 | 2.0E-10 |
| sp|Q9GL21|UACA_CANLF | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 | 782 | 984 | 2.0E-10 |
| sp|Q91ZT8|ASB9_MOUSE | Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 | 730 | 918 | 2.0E-10 |
| sp|Q2IBF8|CTTB2_EULMM | Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 | 695 | 931 | 2.0E-10 |
| sp|Q8VHK1|CSKI2_MOUSE | Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 | 821 | 968 | 2.0E-10 |
| sp|Q8VE42|ANR49_MOUSE | Ankyrin repeat domain-containing protein 49 OS=Mus musculus GN=Ankrd49 PE=1 SV=1 | 816 | 919 | 2.0E-10 |
| sp|Q2QLB5|ASZ1_CALMO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callicebus moloch GN=ASZ1 PE=3 SV=1 | 804 | 989 | 2.0E-10 |
| sp|Q9J5H9|V022_FOWPN | Putative ankyrin repeat protein FPV022 OS=Fowlpox virus (strain NVSL) GN=FPV022 PE=3 SV=1 | 656 | 950 | 2.0E-10 |
| sp|A2RUV0|NOTC1_XENTR | Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis GN=notch1 PE=1 SV=2 | 693 | 948 | 2.0E-10 |
| sp|Q07DZ5|CTTB2_ORNAN | Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 | 662 | 862 | 2.0E-10 |
| sp|Q9J5A7|V155_FOWPN | Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 | 816 | 1010 | 2.0E-10 |
| sp|Q8WXE0|CSKI2_HUMAN | Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 | 756 | 968 | 2.0E-10 |
| sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 667 | 862 | 3.0E-10 |
| sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 792 | 982 | 3.0E-10 |
| sp|Q5TYW2|A20A1_HUMAN | Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 | 768 | 972 | 3.0E-10 |
| sp|Q8R560|ANKR1_RAT | Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 | 730 | 867 | 3.0E-10 |
| sp|Q8IVF6|AN18A_HUMAN | Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 | 714 | 898 | 3.0E-10 |
| sp|P31695|NOTC4_MOUSE | Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 | 781 | 989 | 3.0E-10 |
| sp|Q8HXA6|ASB15_BOVIN | Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 | 693 | 982 | 3.0E-10 |
| sp|Q9DAM9|FANK1_MOUSE | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 | 747 | 919 | 3.0E-10 |
| sp|Q6P9K8|CSKI1_MOUSE | Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 | 822 | 982 | 3.0E-10 |
| sp|Q8VHS6|ASB15_MOUSE | Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 | 695 | 950 | 3.0E-10 |
| sp|Q17QS6|ASB5_BOVIN | Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 | 703 | 949 | 3.0E-10 |
| sp|Q17QS6|ASB5_BOVIN | Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 | 794 | 982 | 3.0E-10 |
| sp|Q9GL21|UACA_CANLF | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 | 816 | 1028 | 3.0E-10 |
| sp|Q80TN5|ZDH17_MOUSE | Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 | 744 | 971 | 3.0E-10 |
| sp|Q876L5|AKR1_SACU7 | Palmitoyltransferase AKR1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AKR1 PE=3 SV=2 | 688 | 917 | 3.0E-10 |
| sp|E9PTT0|ZDH17_RAT | Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 | 744 | 971 | 3.0E-10 |
| sp|A1X154|ASZ1_ECHTE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 | 804 | 989 | 3.0E-10 |
| sp|Q0V8G2|GABP2_BOVIN | GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 | 867 | 982 | 3.0E-10 |
| sp|P59672|ANS1A_MOUSE | Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 | 754 | 997 | 3.0E-10 |
| sp|Q92527|ANKR7_HUMAN | Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 | 814 | 982 | 4.0E-10 |
| sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 761 | 951 | 4.0E-10 |
| sp|E1C656|HACE1_CHICK | E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 | 669 | 851 | 4.0E-10 |
| sp|Q9TU71|ANKR1_RABIT | Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 | 667 | 806 | 4.0E-10 |
| sp|Q2T9W8|ANR61_BOVIN | Ankyrin repeat domain-containing protein 61 OS=Bos taurus GN=ANKRD61 PE=2 SV=1 | 800 | 1010 | 4.0E-10 |
| sp|Q9QW30|NOTC2_RAT | Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 | 756 | 981 | 4.0E-10 |
| sp|Q04721|NOTC2_HUMAN | Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 | 756 | 981 | 4.0E-10 |
| sp|Q00420|GABP1_MOUSE | GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 | 837 | 981 | 4.0E-10 |
| sp|Q9ET47|ESPN_MOUSE | Espin OS=Mus musculus GN=Espn PE=1 SV=2 | 661 | 865 | 4.0E-10 |
| sp|Q96I34|PP16A_HUMAN | Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens GN=PPP1R16A PE=1 SV=1 | 747 | 968 | 4.0E-10 |
| sp|Q8WXH4|ASB11_HUMAN | Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 | 795 | 1018 | 4.0E-10 |
| sp|P81069|GABP2_MOUSE | GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 | 867 | 982 | 4.0E-10 |
| sp|Q9BYH8|IKBZ_HUMAN | NF-kappa-B inhibitor zeta OS=Homo sapiens GN=NFKBIZ PE=1 SV=1 | 693 | 925 | 4.0E-10 |
| sp|Q6B858|FANK1_BOVIN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 | 768 | 981 | 4.0E-10 |
| sp|Q4FE45|XB33_ARATH | E3 ubiquitin-protein ligase XBAT33 OS=Arabidopsis thaliana GN=XBAT33 PE=2 SV=1 | 897 | 982 | 4.0E-10 |
| sp|Q5UPV1|YL271_MIMIV | Putative ankyrin repeat protein L271 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L271 PE=3 SV=1 | 593 | 923 | 4.0E-10 |
| sp|Q5UPV1|YL271_MIMIV | Putative ankyrin repeat protein L271 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L271 PE=3 SV=1 | 813 | 1010 | 4.0E-10 |
| sp|P57044|ILK_CAVPO | Integrin-linked protein kinase OS=Cavia porcellus GN=ILK PE=2 SV=1 | 855 | 969 | 4.0E-10 |
| sp|P0CS66|AKR1_CRYNJ | Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 | 822 | 1000 | 5.0E-10 |
| sp|P0CS67|AKR1_CRYNB | Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 | 822 | 1000 | 5.0E-10 |
| sp|Q1RI12|Y921_RICBR | Putative ankyrin repeat protein RBE_0921 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0921 PE=3 SV=1 | 693 | 933 | 5.0E-10 |
| sp|Q15327|ANKR1_HUMAN | Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 | 667 | 805 | 5.0E-10 |
| sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 804 | 969 | 5.0E-10 |
| sp|Q99466|NOTC4_HUMAN | Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 | 830 | 982 | 5.0E-10 |
| sp|Q5UPA0|YL025_MIMIV | Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 | 698 | 982 | 5.0E-10 |
| sp|Q3EC11|ZDHC2_ARATH | Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 | 816 | 983 | 5.0E-10 |
| sp|Q6B858|FANK1_BOVIN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 | 801 | 982 | 5.0E-10 |
| sp|P24769|B4_VACCW | Ankyrin repeat protein B4 OS=Vaccinia virus (strain Western Reserve) GN=VACWR186 PE=3 SV=1 | 715 | 992 | 5.0E-10 |
| sp|Q8H569|AKT3_ORYSJ | Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 | 696 | 866 | 5.0E-10 |
| sp|Q5GIG6|TNI3K_MOUSE | Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 | 667 | 856 | 6.0E-10 |
| sp|A5A3E0|POTEF_HUMAN | POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 | 667 | 859 | 6.0E-10 |
| sp|Q7S3M5|AKR1_NEUCR | Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 | 827 | 982 | 6.0E-10 |
| sp|O14974|MYPT1_HUMAN | Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 | 750 | 1007 | 6.0E-10 |
| sp|Q91ZT7|ASB10_MOUSE | Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 | 667 | 887 | 6.0E-10 |
| sp|Q1RMI3|GABP1_BOVIN | GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 | 837 | 981 | 6.0E-10 |
| sp|Q653P0|KOR1_ORYSJ | Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 | 837 | 982 | 6.0E-10 |
| sp|Q8TC84|FANK1_HUMAN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 | 801 | 982 | 6.0E-10 |
| sp|Q5ZLC6|ANR10_CHICK | Ankyrin repeat domain-containing protein 10 OS=Gallus gallus GN=ANKRD10 PE=2 SV=1 | 831 | 982 | 6.0E-10 |
| sp|Q9J5H5|V026_FOWPN | Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 | 669 | 822 | 6.0E-10 |
| sp|Q9J5H5|V026_FOWPN | Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 | 703 | 855 | 6.0E-10 |
| sp|Q8HYY4|UACA_BOVIN | Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 | 782 | 984 | 6.0E-10 |
| sp|Q8VHK2|CSKI1_RAT | Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 | 822 | 982 | 6.0E-10 |
| sp|Q5RFS1|ASB11_PONAB | Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 | 795 | 981 | 6.0E-10 |
| sp|Q8WXD9|CSKI1_HUMAN | Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 | 822 | 982 | 6.0E-10 |
| sp|Q09YN0|ASZ1_RABIT | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 | 804 | 989 | 6.0E-10 |
| sp|Q13418|ILK_HUMAN | Integrin-linked protein kinase OS=Homo sapiens GN=ILK PE=1 SV=2 | 855 | 969 | 6.0E-10 |
| sp|Q5R5V4|ILK_PONAB | Integrin-linked protein kinase OS=Pongo abelii GN=ILK PE=2 SV=1 | 855 | 969 | 6.0E-10 |
| sp|Q3SWY2|ILK_BOVIN | Integrin-linked protein kinase OS=Bos taurus GN=ILK PE=2 SV=1 | 855 | 969 | 6.0E-10 |
| sp|Q99J82|ILK_RAT | Integrin-linked protein kinase OS=Rattus norvegicus GN=Ilk PE=2 SV=1 | 855 | 969 | 6.0E-10 |
| sp|O55222|ILK_MOUSE | Integrin-linked protein kinase OS=Mus musculus GN=Ilk PE=1 SV=2 | 855 | 969 | 6.0E-10 |
| sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 823 | 1055 | 7.0E-10 |
| sp|P0CG38|POTEI_HUMAN | POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 | 819 | 1009 | 7.0E-10 |
| sp|P0CG39|POTEJ_HUMAN | POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 | 819 | 1009 | 7.0E-10 |
| sp|Q6S8J3|POTEE_HUMAN | POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 | 667 | 859 | 7.0E-10 |
| sp|Q6S8J3|POTEE_HUMAN | POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 | 819 | 1009 | 7.0E-10 |
| sp|Q5UPF8|YL088_MIMIV | Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 | 679 | 982 | 7.0E-10 |
| sp|Q7ZT11|ANKR1_CHICK | Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 | 667 | 805 | 7.0E-10 |
| sp|Q812A3|ANR23_MOUSE | Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 | 704 | 873 | 7.0E-10 |
| sp|O35516|NOTC2_MOUSE | Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 | 756 | 981 | 7.0E-10 |
| sp|Q0JKV1|AKT1_ORYSJ | Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 | 768 | 944 | 7.0E-10 |
| sp|P0C550|AKT1_ORYSI | Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 | 768 | 944 | 7.0E-10 |
| sp|Q5ZLC6|ANR10_CHICK | Ankyrin repeat domain-containing protein 10 OS=Gallus gallus GN=ANKRD10 PE=2 SV=1 | 755 | 865 | 7.0E-10 |
| sp|Q8HYY4|UACA_BOVIN | Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 | 669 | 856 | 7.0E-10 |
| sp|Q9STP8|ACBP2_ARATH | Acyl-CoA-binding domain-containing protein 2 OS=Arabidopsis thaliana GN=ACBP2 PE=1 SV=1 | 693 | 770 | 7.0E-10 |
| sp|Q9BE45|IKBZ_BOVIN | NF-kappa-B inhibitor zeta OS=Bos taurus GN=NFKBIZ PE=2 SV=2 | 693 | 925 | 7.0E-10 |
| sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 667 | 852 | 8.0E-10 |
| sp|Q00653|NFKB2_HUMAN | Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens GN=NFKB2 PE=1 SV=4 | 667 | 867 | 8.0E-10 |
| sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 761 | 948 | 8.0E-10 |
| sp|Q3ZBX7|ANKR1_BOVIN | Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 | 669 | 837 | 8.0E-10 |
| sp|Q7XUW4|KOR2_ORYSJ | Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 | 813 | 981 | 8.0E-10 |
| sp|A2A2Z9|AN18B_HUMAN | Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 | 729 | 898 | 8.0E-10 |
| sp|Q06547|GABP1_HUMAN | GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 | 837 | 981 | 8.0E-10 |
| sp|Q92625|ANS1A_HUMAN | Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 | 733 | 933 | 8.0E-10 |
| sp|Q2QLG0|ASZ1_CALJA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 | 806 | 989 | 8.0E-10 |
| sp|Q2IBB4|ASZ1_RHIFE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 | 804 | 989 | 8.0E-10 |
| sp|Q108U1|ASZ1_LOXAF | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 | 804 | 989 | 8.0E-10 |
| sp|A5A3E0|POTEF_HUMAN | POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 | 819 | 1009 | 9.0E-10 |
| sp|Q94A76|GORK_ARATH | Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 | 783 | 948 | 9.0E-10 |
| sp|Q4UJ75|A20A4_HUMAN | Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 | 768 | 972 | 9.0E-10 |
| sp|Q9ET47|ESPN_MOUSE | Espin OS=Mus musculus GN=Espn PE=1 SV=2 | 753 | 1010 | 9.0E-10 |
| sp|Q9SQK3|EM506_ARATH | Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 | 716 | 843 | 9.0E-10 |
| sp|Q07E17|ASZ1_MUSPF | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 | 804 | 989 | 9.0E-10 |
| sp|Q66H07|FANK1_RAT | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 | 735 | 948 | 9.0E-10 |
| sp|Q68DC2|ANKS6_HUMAN | Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 | 895 | 982 | 9.0E-10 |
| sp|Q9J512|V223_FOWPN | Putative ankyrin repeat protein FPV223 OS=Fowlpox virus (strain NVSL) GN=FPV223 PE=3 SV=1 | 714 | 849 | 9.0E-10 |
| sp|Q4R3S3|ANKR7_MACFA | Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 | 816 | 982 | 1.0E-09 |
| sp|Q9BXX2|AN30B_HUMAN | Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 | 667 | 841 | 1.0E-09 |
| sp|Q9BXX2|AN30B_HUMAN | Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 | 749 | 949 | 1.0E-09 |
| sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 689 | 923 | 1.0E-09 |
| sp|Q5DW34|EHMT1_MOUSE | Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 | 786 | 1010 | 1.0E-09 |
| sp|Q8BLD6|ANR55_MOUSE | Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 | 659 | 916 | 1.0E-09 |
| sp|F8W2M1|HACE1_DANRE | E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 | 669 | 851 | 1.0E-09 |
| sp|Q1RMI3|GABP1_BOVIN | GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 | 701 | 860 | 1.0E-09 |
| sp|Q4KL97|ANKR1_XENLA | Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 | 730 | 867 | 1.0E-09 |
| sp|Q15327|ANKR1_HUMAN | Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 | 730 | 867 | 1.0E-09 |
| sp|O60237|MYPT2_HUMAN | Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens GN=PPP1R12B PE=1 SV=2 | 747 | 981 | 1.0E-09 |
| sp|Q00420|GABP1_MOUSE | GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 | 701 | 860 | 1.0E-09 |
| sp|Q653P0|KOR1_ORYSJ | Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 | 716 | 870 | 1.0E-09 |
| sp|Q06547|GABP1_HUMAN | GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 | 701 | 860 | 1.0E-09 |
| sp|Q9Z148|EHMT2_MOUSE | Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 | 701 | 932 | 1.0E-09 |
| sp|Q63618|ESPN_RAT | Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 | 661 | 865 | 1.0E-09 |
| sp|Q8CGB3|UACA_MOUSE | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 | 782 | 973 | 1.0E-09 |
| sp|Q6F6B3|TANC1_RAT | Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 | 722 | 922 | 1.0E-09 |
| sp|Q9BZF9|UACA_HUMAN | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 | 669 | 856 | 1.0E-09 |
| sp|P0C6S7|ANS1B_RAT | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 | 715 | 933 | 1.0E-09 |
| sp|Q6P9K8|CSKI1_MOUSE | Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 | 859 | 1010 | 1.0E-09 |
| sp|Q3EC11|ZDHC2_ARATH | Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 | 853 | 1014 | 1.0E-09 |
| sp|Q3EC11|ZDHC2_ARATH | Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 | 754 | 944 | 1.0E-09 |
| sp|Q8VHK2|CSKI1_RAT | Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 | 859 | 1010 | 1.0E-09 |
| sp|Q3SZE4|ASB11_BOVIN | Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 | 730 | 937 | 1.0E-09 |
| sp|Q9Y6X6|MYO16_HUMAN | Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 | 735 | 921 | 1.0E-09 |
| sp|P0C0T2|ANKS6_RAT | Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 | 827 | 982 | 1.0E-09 |
| sp|Q6FJ70|AKR1_CANGA | Palmitoyltransferase AKR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=AKR1 PE=3 SV=1 | 694 | 862 | 1.0E-09 |
| sp|Q5EA33|ANR49_BOVIN | Ankyrin repeat domain-containing protein 49 OS=Bos taurus GN=ANKRD49 PE=2 SV=1 | 816 | 919 | 1.0E-09 |
| sp|Q9D2J7|ANKE1_MOUSE | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 | 705 | 914 | 1.0E-09 |
| sp|Q9WV06|ANKR2_MOUSE | Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 | 761 | 899 | 1.0E-09 |
| sp|Q8WWX0|ASB5_HUMAN | Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 | 703 | 926 | 1.0E-09 |
| sp|Q6DD51|CSKI2_XENLA | Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 | 822 | 982 | 1.0E-09 |
| sp|Q09YH1|ASZ1_SAIBB | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 | 822 | 989 | 1.0E-09 |
| sp|Q8VD46|ASZ1_MOUSE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 | 804 | 989 | 1.0E-09 |
| sp|Q9GKW8|AND1A_MACFA | Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 | 764 | 982 | 2.0E-09 |
| sp|Q6S5H4|POTEB_HUMAN | POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 | 667 | 817 | 2.0E-09 |
| sp|A0JP26|POTB3_HUMAN | POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 | 667 | 817 | 2.0E-09 |
| sp|Q6S545|POTEH_HUMAN | POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 | 819 | 1009 | 2.0E-09 |
| sp|Q6S5H5|POTEG_HUMAN | POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 | 819 | 1009 | 2.0E-09 |
| sp|P0CG38|POTEI_HUMAN | POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 | 667 | 859 | 2.0E-09 |
| sp|P0CG39|POTEJ_HUMAN | POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 | 667 | 859 | 2.0E-09 |
| sp|Q8VHS5|ASB16_MOUSE | Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 | 796 | 982 | 2.0E-09 |
| sp|Q5R6D7|ASB8_PONAB | Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 | 813 | 967 | 2.0E-09 |
| sp|Q9H765|ASB8_HUMAN | Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 | 813 | 967 | 2.0E-09 |
| sp|O60733|PLPL9_HUMAN | 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 | 591 | 868 | 2.0E-09 |
| sp|O60733|PLPL9_HUMAN | 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 | 694 | 965 | 2.0E-09 |
| sp|Q8BLD6|ANR55_MOUSE | Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 | 799 | 1004 | 2.0E-09 |
| sp|Q5BKI6|ANKR1_XENTR | Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 | 667 | 805 | 2.0E-09 |
| sp|Q6ZVH7|ESPNL_HUMAN | Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 | 812 | 1064 | 2.0E-09 |
| sp|Q7ZT11|ANKR1_CHICK | Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 | 827 | 969 | 2.0E-09 |
| sp|Q5CZ79|AN20B_HUMAN | Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 | 667 | 869 | 2.0E-09 |
| sp|Q4KL97|ANKR1_XENLA | Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 | 798 | 933 | 2.0E-09 |
| sp|Q5VUR7|A20A3_HUMAN | Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 | 768 | 972 | 2.0E-09 |
| sp|Q5SQ80|A20A2_HUMAN | Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 | 768 | 972 | 2.0E-09 |
| sp|Q9Z148|EHMT2_MOUSE | Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 | 750 | 968 | 2.0E-09 |
| sp|Q96DX5|ASB9_HUMAN | Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 | 665 | 836 | 2.0E-09 |
| sp|Q9SCX5|AKT5_ARATH | Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 | 783 | 944 | 2.0E-09 |
| sp|Q99466|NOTC4_HUMAN | Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 | 781 | 981 | 2.0E-09 |
| sp|Q8WXK1|ASB15_HUMAN | Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 | 693 | 982 | 2.0E-09 |
| sp|P25799|NFKB1_MOUSE | Nuclear factor NF-kappa-B p105 subunit OS=Mus musculus GN=Nfkb1 PE=1 SV=2 | 714 | 908 | 2.0E-09 |
| sp|Q9BZF9|UACA_HUMAN | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 | 782 | 984 | 2.0E-09 |
| sp|Q6P9K8|CSKI1_MOUSE | Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 | 802 | 982 | 2.0E-09 |
| sp|P39010|AKR1_YEAST | Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR1 PE=1 SV=1 | 716 | 916 | 2.0E-09 |
| sp|Q7Z6G8|ANS1B_HUMAN | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 | 712 | 933 | 2.0E-09 |
| sp|Q95N27|PP16B_BOVIN | Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 | 799 | 1047 | 2.0E-09 |
| sp|Q8BIZ1|ANS1B_MOUSE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 | 715 | 933 | 2.0E-09 |
| sp|Q8VHK2|CSKI1_RAT | Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 | 802 | 982 | 2.0E-09 |
| sp|Q8WXD9|CSKI1_HUMAN | Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 | 859 | 1010 | 2.0E-09 |
| sp|Q66H07|FANK1_RAT | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 | 716 | 919 | 2.0E-09 |
| sp|Q8WWX0|ASB5_HUMAN | Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 | 765 | 959 | 2.0E-09 |
| sp|Q5DU14|MYO16_MOUSE | Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 | 678 | 922 | 2.0E-09 |
| sp|Q6GQX6|ANKS6_MOUSE | Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 | 841 | 982 | 2.0E-09 |
| sp|Q8WVL7|ANR49_HUMAN | Ankyrin repeat domain-containing protein 49 OS=Homo sapiens GN=ANKRD49 PE=1 SV=1 | 816 | 919 | 2.0E-09 |
| sp|Q4JHE0|XB36_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 | 698 | 870 | 2.0E-09 |
| sp|B4E2M5|ANR66_HUMAN | Ankyrin repeat domain-containing protein 66 OS=Homo sapiens GN=ANKRD66 PE=2 SV=2 | 664 | 783 | 2.0E-09 |
| sp|Q2QLA2|CTTB2_HORSE | Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 | 659 | 862 | 2.0E-09 |
| sp|Q9Z2G1|FM1AA_MOUSE | Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 | 830 | 1011 | 2.0E-09 |
| sp|A0M8T3|ASZ1_FELCA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 | 804 | 989 | 2.0E-09 |
| sp|Q4V890|FEM1A_RAT | Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 | 830 | 1011 | 2.0E-09 |
| sp|Q94B55|XB31_ARATH | Putative E3 ubiquitin-protein ligase XBAT31 OS=Arabidopsis thaliana GN=XBAT31 PE=2 SV=1 | 768 | 941 | 2.0E-09 |
| sp|Q6NSI1|AR26L_HUMAN | Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens GN=ANKRD26P1 PE=5 SV=2 | 669 | 825 | 2.0E-09 |
| sp|Q566C8|ANR54_RAT | Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 | 745 | 837 | 2.0E-09 |
| sp|Q9UVH3|AKR1_MORAP | Palmitoyltransferase AKR1 (Fragment) OS=Mortierella alpina PE=3 SV=1 | 666 | 770 | 2.0E-09 |
| sp|Q07DV3|ASZ1_AOTNA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 | 828 | 989 | 2.0E-09 |
| sp|Q9R186|TRPV6_RAT | Transient receptor potential cation channel subfamily V member 6 OS=Rattus norvegicus GN=Trpv6 PE=1 SV=2 | 729 | 868 | 2.0E-09 |
| sp|A0JNU3|LPP60_MOUSE | 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 | 745 | 901 | 2.0E-09 |
| sp|Q6NXT1|ANR54_HUMAN | Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 | 747 | 837 | 2.0E-09 |
| sp|Q9HLN1|Y196_THEAC | Putative ankyrin repeat protein Ta0196 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0196 PE=3 SV=1 | 671 | 797 | 2.0E-09 |
| sp|Q810B6|ANFY1_MOUSE | Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 | 677 | 969 | 3.0E-09 |
| sp|Q91ZT9|ASB8_MOUSE | Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 | 813 | 967 | 3.0E-09 |
| sp|Q3KP44|ANR55_HUMAN | Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 | 667 | 867 | 3.0E-09 |
| sp|Q08E43|ASB8_BOVIN | Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 | 813 | 967 | 3.0E-09 |
| sp|Q4R544|ASB8_MACFA | Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 | 813 | 967 | 3.0E-09 |
| sp|Q9DBR7|MYPT1_MOUSE | Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 | 750 | 1007 | 3.0E-09 |
| sp|Q1RK13|Y220_RICBR | Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 | 683 | 909 | 3.0E-09 |
| sp|Q865U8|ANKR1_PIG | Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 | 822 | 968 | 3.0E-09 |
| sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 869 | 982 | 3.0E-09 |
| sp|Q9D1A4|ASB5_MOUSE | Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 | 703 | 926 | 3.0E-09 |
| sp|Q63618|ESPN_RAT | Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 | 753 | 1010 | 3.0E-09 |
| sp|Q10311|YD58_SCHPO | Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 | 694 | 867 | 3.0E-09 |
| sp|Q8NI38|IKBD_HUMAN | NF-kappa-B inhibitor delta OS=Homo sapiens GN=NFKBID PE=1 SV=1 | 668 | 868 | 3.0E-09 |
| sp|Q8T2Q0|ZDHC6_DICDI | Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 | 852 | 1004 | 3.0E-09 |
| sp|Q92625|ANS1A_HUMAN | Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 | 853 | 1009 | 3.0E-09 |
| sp|Q5NVB9|ZDH13_PONAB | Palmitoyltransferase ZDHHC13 OS=Pongo abelii GN=ZDHHC13 PE=2 SV=1 | 744 | 981 | 3.0E-09 |
| sp|Q96T49|PP16B_HUMAN | Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 | 799 | 1047 | 3.0E-09 |
| sp|Q8VHQ3|PP16B_MOUSE | Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 | 799 | 1047 | 3.0E-09 |
| sp|Q8WXD9|CSKI1_HUMAN | Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 | 802 | 982 | 3.0E-09 |
| sp|Q9J5H8|V023_FOWPN | Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 | 780 | 988 | 3.0E-09 |
| sp|Q9GL21|UACA_CANLF | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 | 669 | 864 | 3.0E-09 |
| sp|Q0V8G2|GABP2_BOVIN | GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 | 701 | 837 | 3.0E-09 |
| sp|P0C0T2|ANKS6_RAT | Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 | 837 | 982 | 3.0E-09 |
| sp|P0C0T2|ANKS6_RAT | Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 | 841 | 982 | 3.0E-09 |
| sp|Q6DD51|CSKI2_XENLA | Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 | 691 | 934 | 3.0E-09 |
| sp|Q5DU14|MYO16_MOUSE | Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 | 738 | 982 | 3.0E-09 |
| sp|Q6NXT1|ANR54_HUMAN | Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 | 813 | 903 | 3.0E-09 |
| sp|Q91WK7|ANR54_MOUSE | Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 | 747 | 837 | 3.0E-09 |
| sp|Q65XV2|XB3_ORYSJ | E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica GN=XB3 PE=1 SV=1 | 665 | 837 | 3.0E-09 |
| sp|Q9BYB0|SHAN3_HUMAN | SH3 and multiple ankyrin repeat domains protein 3 OS=Homo sapiens GN=SHANK3 PE=1 SV=3 | 716 | 908 | 3.0E-09 |
| sp|P14360|V240_FOWPN | Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 | 677 | 855 | 3.0E-09 |
| sp|Q9GZV1|ANKR2_HUMAN | Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 | 745 | 899 | 3.0E-09 |
| sp|Q2QLA4|ASZ1_HORSE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 | 804 | 989 | 3.0E-09 |
| sp|Q07DY6|ASZ1_COLGU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 | 813 | 989 | 3.0E-09 |
| sp|Q00PJ3|ASZ1_ATEAB | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 | 747 | 905 | 3.0E-09 |
| sp|Q5RF15|TNI3K_PONAB | Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 | 666 | 893 | 4.0E-09 |
| sp|H3BUK9|POTB2_HUMAN | POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 | 667 | 817 | 4.0E-09 |
| sp|Q978J0|Y1425_THEVO | Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 | 760 | 918 | 4.0E-09 |
| sp|Q7S3M5|AKR1_NEUCR | Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 | 756 | 936 | 4.0E-09 |
| sp|Q10728|MYPT1_RAT | Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 | 750 | 1007 | 4.0E-09 |
| sp|Q5DW34|EHMT1_MOUSE | Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 | 669 | 840 | 4.0E-09 |
| sp|Q5BKI6|ANKR1_XENTR | Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 | 827 | 971 | 4.0E-09 |
| sp|Q9FY48|KEG_ARATH | E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 | 670 | 872 | 4.0E-09 |
| sp|Q812A3|ANR23_MOUSE | Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 | 869 | 982 | 4.0E-09 |
| sp|Q653P0|KOR1_ORYSJ | Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 | 738 | 925 | 4.0E-09 |
| sp|Q5TYW2|A20A1_HUMAN | Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 | 667 | 831 | 4.0E-09 |
| sp|Q4UJ75|A20A4_HUMAN | Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 | 667 | 831 | 4.0E-09 |
| sp|Q5VUR7|A20A3_HUMAN | Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 | 667 | 831 | 4.0E-09 |
| sp|Q5SQ80|A20A2_HUMAN | Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 | 667 | 831 | 4.0E-09 |
| sp|Q96DX5|ASB9_HUMAN | Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 | 799 | 1001 | 4.0E-09 |
| sp|Q8NI38|IKBD_HUMAN | NF-kappa-B inhibitor delta OS=Homo sapiens GN=NFKBID PE=1 SV=1 | 823 | 982 | 4.0E-09 |
| sp|Q96KQ7|EHMT2_HUMAN | Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 | 701 | 932 | 4.0E-09 |
| sp|Q9J502|V233_FOWPN | Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 | 694 | 834 | 4.0E-09 |
| sp|Q8VHS6|ASB15_MOUSE | Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 | 667 | 1015 | 4.0E-09 |
| sp|P83757|CACT_DROYA | NF-kappa-B inhibitor cactus OS=Drosophila yakuba GN=cact PE=3 SV=1 | 764 | 982 | 4.0E-09 |
| sp|Q9STP8|ACBP2_ARATH | Acyl-CoA-binding domain-containing protein 2 OS=Arabidopsis thaliana GN=ACBP2 PE=1 SV=1 | 719 | 836 | 4.0E-09 |
| sp|Q94B55|XB31_ARATH | Putative E3 ubiquitin-protein ligase XBAT31 OS=Arabidopsis thaliana GN=XBAT31 PE=2 SV=1 | 669 | 837 | 4.0E-09 |
| sp|Q8GXE6|AKT6_ARATH | Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 | 789 | 981 | 4.0E-09 |
| sp|P21783|NOTC1_XENLA | Neurogenic locus notch homolog protein 1 OS=Xenopus laevis GN=notch1 PE=1 SV=3 | 693 | 948 | 4.0E-09 |
| sp|Q6DGX3|ANR54_DANRE | Ankyrin repeat domain-containing protein 54 OS=Danio rerio GN=ankrd54 PE=2 SV=1 | 825 | 903 | 4.0E-09 |
| sp|Q4R739|ANR53_MACFA | Ankyrin repeat domain-containing protein 53 OS=Macaca fascicularis GN=ANKRD53 PE=2 SV=1 | 761 | 867 | 4.0E-09 |
| sp|Q9CWU2|ZDH13_MOUSE | Palmitoyltransferase ZDHHC13 OS=Mus musculus GN=Zdhhc13 PE=1 SV=2 | 744 | 981 | 4.0E-09 |
| sp|Q8WXI3|ASB10_HUMAN | Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 | 732 | 957 | 4.0E-09 |
| sp|Q8N9V6|ANR53_HUMAN | Ankyrin repeat domain-containing protein 53 OS=Homo sapiens GN=ANKRD53 PE=2 SV=3 | 761 | 867 | 4.0E-09 |
| sp|Q8TAK5|GABP2_HUMAN | GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 | 701 | 837 | 4.0E-09 |
| sp|P50086|PSD10_YEAST | Probable 26S proteasome regulatory subunit p28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAS6 PE=1 SV=1 | 767 | 962 | 4.0E-09 |
| sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 820 | 986 | 5.0E-09 |
| sp|Q9BXX2|AN30B_HUMAN | Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 | 789 | 982 | 5.0E-09 |
| sp|Q9BGT9|ASB7_MACFA | Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 | 667 | 786 | 5.0E-09 |
| sp|Q4I8B6|AKR1_GIBZE | Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 | 826 | 982 | 5.0E-09 |
| sp|Q8BG95|MYPT2_MOUSE | Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 | 747 | 981 | 5.0E-09 |
| sp|P19838|NFKB1_HUMAN | Nuclear factor NF-kappa-B p105 subunit OS=Homo sapiens GN=NFKB1 PE=1 SV=2 | 714 | 908 | 5.0E-09 |
| sp|Q8IUH4|ZDH13_HUMAN | Palmitoyltransferase ZDHHC13 OS=Homo sapiens GN=ZDHHC13 PE=1 SV=3 | 744 | 981 | 5.0E-09 |
| sp|A6NK59|ASB14_HUMAN | Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 | 662 | 906 | 5.0E-09 |
| sp|Q68DC2|ANKS6_HUMAN | Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 | 827 | 982 | 5.0E-09 |
| sp|Q8WWX0|ASB5_HUMAN | Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 | 794 | 982 | 5.0E-09 |
| sp|Q91WK7|ANR54_MOUSE | Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 | 813 | 903 | 5.0E-09 |
| sp|Q07E41|CTTB2_DASNO | Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 | 695 | 931 | 5.0E-09 |
| sp|P33823|VB04_VAR67 | Ankyrin repeat protein B4 OS=Variola virus (isolate Human/India/Ind3/1967) GN=B4R PE=3 SV=1 | 772 | 982 | 5.0E-09 |
| sp|Q07E43|ASZ1_DASNO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 | 747 | 905 | 5.0E-09 |
| sp|Q1LZC5|ANR54_BOVIN | Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 | 813 | 903 | 5.0E-09 |
| sp|Q9SM23|ACBP1_ARATH | Acyl-CoA-binding domain-containing protein 1 OS=Arabidopsis thaliana GN=ACBP1 PE=1 SV=2 | 665 | 770 | 5.0E-09 |
| sp|Q9ERC1|MYO16_RAT | Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 | 678 | 922 | 5.0E-09 |
| sp|Q2IBB1|ASZ1_CHLAE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 | 813 | 989 | 5.0E-09 |
| sp|Q6UB99|ANR11_HUMAN | Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 | 846 | 982 | 5.0E-09 |
| sp|Q5BKI6|ANKR1_XENTR | Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 | 765 | 933 | 6.0E-09 |
| sp|Q28BK1|HACE1_XENTR | E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 | 669 | 851 | 6.0E-09 |
| sp|Q8R560|ANKR1_RAT | Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 | 827 | 968 | 6.0E-09 |
| sp|Q0VGY8|TANC1_MOUSE | Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 | 722 | 922 | 6.0E-09 |
| sp|Q9SQK3|EM506_ARATH | Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 | 790 | 940 | 6.0E-09 |
| sp|Q9J504|V231_FOWPN | Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 | 740 | 900 | 6.0E-09 |
| sp|Q17QS6|ASB5_BOVIN | Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 | 765 | 959 | 6.0E-09 |
| sp|P59672|ANS1A_MOUSE | Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 | 819 | 982 | 6.0E-09 |
| sp|P59672|ANS1A_MOUSE | Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 | 694 | 933 | 6.0E-09 |
| sp|Q6FJ70|AKR1_CANGA | Palmitoyltransferase AKR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=AKR1 PE=3 SV=1 | 687 | 916 | 6.0E-09 |
| sp|Q6DD51|CSKI2_XENLA | Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 | 756 | 968 | 6.0E-09 |
| sp|Q566C8|ANR54_RAT | Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 | 813 | 903 | 6.0E-09 |
| sp|Q9BYB0|SHAN3_HUMAN | SH3 and multiple ankyrin repeat domains protein 3 OS=Homo sapiens GN=SHANK3 PE=1 SV=3 | 739 | 941 | 6.0E-09 |
| sp|Q1LZC5|ANR54_BOVIN | Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 | 747 | 837 | 6.0E-09 |
| sp|Q8WMX7|ASZ1_PAPAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 | 813 | 989 | 6.0E-09 |
| sp|Q07E30|ASZ1_NEONE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 | 804 | 989 | 6.0E-09 |
| sp|A0PJZ0|A20A5_HUMAN | Putative ankyrin repeat domain-containing protein 20A5 OS=Homo sapiens GN=ANKRD20A5P PE=5 SV=1 | 742 | 861 | 6.0E-09 |
| sp|Q09YI1|CTTB2_SHEEP | Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 | 695 | 932 | 6.0E-09 |
| sp|P21001|B4_VACCC | Ankyrin repeat protein B4 OS=Vaccinia virus (strain Copenhagen) GN=B4R PE=3 SV=1 | 747 | 990 | 6.0E-09 |
| sp|Q59H18|TNI3K_HUMAN | Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 | 666 | 893 | 7.0E-09 |
| sp|Q3KP44|ANR55_HUMAN | Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 | 659 | 908 | 7.0E-09 |
| sp|Q9BXX3|AN30A_HUMAN | Ankyrin repeat domain-containing protein 30A OS=Homo sapiens GN=ANKRD30A PE=2 SV=3 | 815 | 982 | 7.0E-09 |
| sp|Q9CZK6|ANKS3_MOUSE | Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 | 635 | 837 | 7.0E-09 |
| sp|Q6DCL5|HACE1_XENLA | E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 | 669 | 851 | 7.0E-09 |
| sp|Q15327|ANKR1_HUMAN | Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 | 797 | 933 | 7.0E-09 |
| sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 798 | 933 | 7.0E-09 |
| sp|Q9D1A4|ASB5_MOUSE | Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 | 765 | 959 | 7.0E-09 |
| sp|Q9J5H7|V024_FOWPN | Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 | 700 | 952 | 7.0E-09 |
| sp|Q9DAM9|FANK1_MOUSE | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 | 801 | 982 | 7.0E-09 |
| sp|Q2QLG9|CTTB2_OTOGA | Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 | 695 | 931 | 7.0E-09 |
| sp|P14356|M1_VACCW | Ankyrin repeat protein M1 OS=Vaccinia virus (strain Western Reserve) GN=VACWR030 PE=3 SV=2 | 734 | 900 | 7.0E-09 |
| sp|Q69ZU8|ANKR6_MOUSE | Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 | 667 | 837 | 8.0E-09 |
| sp|Q4KL97|ANKR1_XENLA | Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 | 827 | 971 | 8.0E-09 |
| sp|Q15327|ANKR1_HUMAN | Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 | 822 | 969 | 8.0E-09 |
| sp|Q9H9B1|EHMT1_HUMAN | Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 | 682 | 924 | 8.0E-09 |
| sp|Q9HCD6|TANC2_HUMAN | Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 | 810 | 982 | 8.0E-09 |
| sp|Q2QLA2|CTTB2_HORSE | Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 | 695 | 932 | 8.0E-09 |
| sp|A7MB89|FEM1C_BOVIN | Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 | 830 | 1009 | 8.0E-09 |
| sp|P20640|M1_VACCC | Ankyrin repeat protein M1 OS=Vaccinia virus (strain Copenhagen) GN=M1L PE=3 SV=1 | 734 | 900 | 8.0E-09 |
| sp|P53356|HTK16_HYDVU | Tyrosine-protein kinase HTK16 OS=Hydra vulgaris GN=HTK16 PE=2 SV=1 | 769 | 945 | 8.0E-09 |
| sp|Q96JP0|FEM1C_HUMAN | Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 | 830 | 1009 | 8.0E-09 |
| sp|O88202|LPP60_RAT | 60 kDa lysophospholipase OS=Rattus norvegicus GN=Aspg PE=1 SV=1 | 745 | 888 | 8.0E-09 |
| sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 836 | 982 | 9.0E-09 |
| sp|Q9BXX2|AN30B_HUMAN | Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 | 815 | 982 | 9.0E-09 |
| sp|Q9J513|V222_FOWPN | Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 | 683 | 888 | 9.0E-09 |
| sp|Q8T2Q0|ZDHC6_DICDI | Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 | 820 | 994 | 9.0E-09 |
| sp|Q9C0D5|TANC1_HUMAN | Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 | 829 | 1001 | 9.0E-09 |
| sp|Q66H07|FANK1_RAT | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 | 801 | 982 | 9.0E-09 |
| sp|Q9ERC1|MYO16_RAT | Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 | 738 | 982 | 9.0E-09 |
| sp|Q8CEF1|FEM1C_MOUSE | Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 | 830 | 1009 | 9.0E-09 |
| sp|Q862Z2|ASB5_RABIT | Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 | 703 | 926 | 9.0E-09 |
| sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 667 | 862 | 1.0E-08 |
| sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 667 | 807 | 1.0E-08 |
| sp|Q9J4Z6|V244_FOWPN | Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 | 716 | 1027 | 1.0E-08 |
| sp|B2RU33|POTEC_HUMAN | POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 | 667 | 817 | 1.0E-08 |
| sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 855 | 1001 | 1.0E-08 |
| sp|Q54HW1|PSD10_DICDI | 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 | 747 | 926 | 1.0E-08 |
| sp|Q91974|IKBA_CHICK | NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 | 830 | 1010 | 1.0E-08 |
| sp|Q9BXX3|AN30A_HUMAN | Ankyrin repeat domain-containing protein 30A OS=Homo sapiens GN=ANKRD30A PE=2 SV=3 | 667 | 841 | 1.0E-08 |
| sp|Q9Y574|ASB4_HUMAN | Ankyrin repeat and SOCS box protein 4 OS=Homo sapiens GN=ASB4 PE=2 SV=1 | 732 | 888 | 1.0E-08 |
| sp|Q9H9B1|EHMT1_HUMAN | Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 | 683 | 875 | 1.0E-08 |
| sp|A5PMU4|ANS1B_DANRE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 | 799 | 1001 | 1.0E-08 |
| sp|Q9D1A4|ASB5_MOUSE | Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 | 794 | 1018 | 1.0E-08 |
| sp|Q09701|AKR1_SCHPO | Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 | 756 | 916 | 1.0E-08 |
| sp|Q6F6B3|TANC1_RAT | Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 | 829 | 989 | 1.0E-08 |
| sp|Q9BZF9|UACA_HUMAN | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 | 761 | 932 | 1.0E-08 |
| sp|Q5NVB9|ZDH13_PONAB | Palmitoyltransferase ZDHHC13 OS=Pongo abelii GN=ZDHHC13 PE=2 SV=1 | 689 | 915 | 1.0E-08 |
| sp|Q38998|AKT1_ARATH | Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 | 734 | 910 | 1.0E-08 |
| sp|Q8IUH4|ZDH13_HUMAN | Palmitoyltransferase ZDHHC13 OS=Homo sapiens GN=ZDHHC13 PE=1 SV=3 | 689 | 915 | 1.0E-08 |
| sp|Q9C0D5|TANC1_HUMAN | Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 | 722 | 932 | 1.0E-08 |
| sp|Q63369|NFKB1_RAT | Nuclear factor NF-kappa-B p105 subunit (Fragment) OS=Rattus norvegicus GN=Nfkb1 PE=1 SV=1 | 714 | 908 | 1.0E-08 |
| sp|Q7Z6G8|ANS1B_HUMAN | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 | 654 | 867 | 1.0E-08 |
| sp|Q9J504|V231_FOWPN | Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 | 708 | 867 | 1.0E-08 |
| sp|Q9GL21|UACA_CANLF | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 | 827 | 1003 | 1.0E-08 |
| sp|Q9GL21|UACA_CANLF | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 | 761 | 932 | 1.0E-08 |
| sp|Q9J5A7|V155_FOWPN | Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 | 715 | 872 | 1.0E-08 |
| sp|P59672|ANS1A_MOUSE | Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 | 654 | 911 | 1.0E-08 |
| sp|Q07E43|ASZ1_DASNO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 | 804 | 989 | 1.0E-08 |
| sp|Q862Z2|ASB5_RABIT | Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 | 765 | 959 | 1.0E-08 |
| sp|Q8WWH4|ASZ1_HUMAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 | 813 | 989 | 1.0E-08 |
| sp|Q54XX5|Y9849_DICDI | Probable serine/threonine-protein kinase DDB_G0278535 OS=Dictyostelium discoideum GN=DDB_G0278535 PE=3 SV=1 | 732 | 915 | 1.0E-08 |
| sp|Q6KAE5|XB32_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 | 659 | 916 | 1.0E-08 |
| sp|Q6GPE5|FEM1B_XENLA | Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 | 830 | 982 | 1.0E-08 |
| sp|A1ZBY1|FEM1B_DROME | Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 | 821 | 1033 | 1.0E-08 |
| sp|Q8WMX6|ASZ1_PANTR | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 | 813 | 989 | 1.0E-08 |
| sp|Q2IBF5|ASZ1_GORGO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 | 813 | 989 | 1.0E-08 |
| sp|Q9JLU4|SHAN3_RAT | SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus GN=Shank3 PE=1 SV=3 | 716 | 908 | 1.0E-08 |
| sp|Q811D2|ANR26_MOUSE | Ankyrin repeat domain-containing protein 26 OS=Mus musculus GN=Ankrd26 PE=1 SV=2 | 682 | 830 | 1.0E-08 |
| sp|Q01317|NUC2_NEUCR | Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 | 677 | 948 | 1.0E-08 |
| sp|Q99728|BARD1_HUMAN | BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 | 826 | 929 | 1.0E-08 |
| sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 807 | 982 | 2.0E-08 |
| sp|Q5GIG6|TNI3K_MOUSE | Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 | 666 | 893 | 2.0E-08 |
| sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 885 | 981 | 2.0E-08 |
| sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 858 | 999 | 2.0E-08 |
| sp|O73630|NFKB2_XENLA | Nuclear factor NF-kappa-B p100 subunit OS=Xenopus laevis GN=nfkb2 PE=2 SV=1 | 694 | 815 | 2.0E-08 |
| sp|Q18297|TRPA1_CAEEL | Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 | 665 | 837 | 2.0E-08 |
| sp|Q91ZU0|ASB7_MOUSE | Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 | 791 | 970 | 2.0E-08 |
| sp|Q9H672|ASB7_HUMAN | Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 | 791 | 970 | 2.0E-08 |
| sp|Q5RCK5|ASB7_PONAB | Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 | 791 | 970 | 2.0E-08 |
| sp|Q812A3|ANR23_MOUSE | Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 | 798 | 933 | 2.0E-08 |
| sp|Q9CR42|ANKR1_MOUSE | Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 | 827 | 968 | 2.0E-08 |
| sp|Q653P0|KOR1_ORYSJ | Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 | 669 | 849 | 2.0E-08 |
| sp|Q96KQ7|EHMT2_HUMAN | Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 | 887 | 1010 | 2.0E-08 |
| sp|Q15653|IKBB_HUMAN | NF-kappa-B inhibitor beta OS=Homo sapiens GN=NFKBIB PE=1 SV=2 | 723 | 821 | 2.0E-08 |
| sp|Q60778|IKBB_MOUSE | NF-kappa-B inhibitor beta OS=Mus musculus GN=Nfkbib PE=1 SV=2 | 723 | 821 | 2.0E-08 |
| sp|Q6DRG7|MYPT1_DANRE | Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 | 750 | 969 | 2.0E-08 |
| sp|P46531|NOTC1_HUMAN | Neurogenic locus notch homolog protein 1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4 | 756 | 982 | 2.0E-08 |
| sp|Q2TB02|IKBD_MOUSE | NF-kappa-B inhibitor delta OS=Mus musculus GN=Nfkbid PE=1 SV=2 | 823 | 982 | 2.0E-08 |
| sp|Q8HYY4|UACA_BOVIN | Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 | 761 | 932 | 2.0E-08 |
| sp|P0C6S7|ANS1B_RAT | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 | 654 | 867 | 2.0E-08 |
| sp|P0C6S7|ANS1B_RAT | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 | 787 | 1034 | 2.0E-08 |
| sp|A6QL64|AN36A_HUMAN | Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 | 826 | 998 | 2.0E-08 |
| sp|A2A690|TANC2_MOUSE | Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 | 816 | 982 | 2.0E-08 |
| sp|Q3EC11|ZDHC2_ARATH | Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 | 639 | 841 | 2.0E-08 |
| sp|Q54BA2|Y3800_DICDI | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 | 783 | 926 | 2.0E-08 |
| sp|Q8BIZ1|ANS1B_MOUSE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 | 654 | 867 | 2.0E-08 |
| sp|Q8BIZ1|ANS1B_MOUSE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 | 787 | 1001 | 2.0E-08 |
| sp|Q94CT7|XB31_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS31 OS=Oryza sativa subsp. japonica GN=XBOS31 PE=2 SV=1 | 862 | 982 | 2.0E-08 |
| sp|Q9Y6X6|MYO16_HUMAN | Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 | 801 | 983 | 2.0E-08 |
| sp|P81069|GABP2_MOUSE | GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 | 701 | 837 | 2.0E-08 |
| sp|P57044|ILK_CAVPO | Integrin-linked protein kinase OS=Cavia porcellus GN=ILK PE=2 SV=1 | 694 | 823 | 2.0E-08 |
| sp|Q9BE45|IKBZ_BOVIN | NF-kappa-B inhibitor zeta OS=Bos taurus GN=NFKBIZ PE=2 SV=2 | 757 | 968 | 2.0E-08 |
| sp|Q9WV06|ANKR2_MOUSE | Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 | 667 | 803 | 2.0E-08 |
| sp|Q8VD46|ASZ1_MOUSE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 | 747 | 905 | 2.0E-08 |
| sp|Q4JHE0|XB36_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 | 865 | 982 | 2.0E-08 |
| sp|Q8TAK5|GABP2_HUMAN | GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 | 794 | 1044 | 2.0E-08 |
| sp|Q09YI1|CTTB2_SHEEP | Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 | 659 | 862 | 2.0E-08 |
| sp|Q862Z2|ASB5_RABIT | Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 | 794 | 982 | 2.0E-08 |
| sp|Q2T9K6|FEM1C_XENLA | Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 | 696 | 851 | 2.0E-08 |
| sp|Q2IBE3|ASZ1_PONAB | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 | 813 | 989 | 2.0E-08 |
| sp|Q4ACU6|SHAN3_MOUSE | SH3 and multiple ankyrin repeat domains protein 3 OS=Mus musculus GN=Shank3 PE=1 SV=3 | 716 | 908 | 2.0E-08 |
| sp|Q07DX6|ASZ1_NOMLE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 | 813 | 989 | 2.0E-08 |
| sp|Q9VFD5|FEM1A_DROME | Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 | 696 | 862 | 2.0E-08 |
| sp|Q9UPS8|ANR26_HUMAN | Ankyrin repeat domain-containing protein 26 OS=Homo sapiens GN=ANKRD26 PE=1 SV=3 | 682 | 828 | 2.0E-08 |
| sp|A0M8T5|CTTB2_FELCA | Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 | 745 | 932 | 2.0E-08 |
| sp|Q2QL84|ASZ1_MICMU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 | 804 | 993 | 2.0E-08 |
| sp|Q1RHT6|Y997_RICBR | Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 | 747 | 1028 | 2.0E-08 |
| sp|Q2IBG0|ASZ1_EULMM | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 | 804 | 993 | 2.0E-08 |
| sp|Q80T11|USH1G_MOUSE | Usher syndrome type-1G protein homolog OS=Mus musculus GN=Ush1g PE=1 SV=1 | 689 | 796 | 2.0E-08 |
| sp|Q2IBB2|CTTB2_RHIFE | Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 | 695 | 931 | 2.0E-08 |
| sp|Q495M9|USH1G_HUMAN | Usher syndrome type-1G protein OS=Homo sapiens GN=USH1G PE=1 SV=1 | 689 | 796 | 2.0E-08 |
| sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 837 | 1048 | 3.0E-08 |
| sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 667 | 863 | 3.0E-08 |
| sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 837 | 1048 | 3.0E-08 |
| sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 807 | 982 | 3.0E-08 |
| sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 669 | 838 | 3.0E-08 |
| sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 812 | 982 | 3.0E-08 |
| sp|Q9J4Z5|V245_FOWPN | Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 | 766 | 1004 | 3.0E-08 |
| sp|Q9P2R3|ANFY1_HUMAN | Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 | 695 | 973 | 3.0E-08 |
| sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 820 | 986 | 3.0E-08 |
| sp|Q9TU71|ANKR1_RABIT | Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 | 797 | 933 | 3.0E-08 |
| sp|Q9CR42|ANKR1_MOUSE | Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 | 669 | 836 | 3.0E-08 |
| sp|Q755Y0|AKR1_ASHGO | Palmitoyltransferase AKR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AKR1 PE=3 SV=1 | 819 | 983 | 3.0E-08 |
| sp|Q9Z148|EHMT2_MOUSE | Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 | 887 | 1010 | 3.0E-08 |
| sp|Q5ZLC6|ANR10_CHICK | Ankyrin repeat domain-containing protein 10 OS=Gallus gallus GN=ANKRD10 PE=2 SV=1 | 798 | 950 | 3.0E-08 |
| sp|Q0VGY8|TANC1_MOUSE | Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 | 810 | 982 | 3.0E-08 |
| sp|G3I6Z6|NOTC1_CRIGR | Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus GN=NOTCH1 PE=1 SV=2 | 756 | 982 | 3.0E-08 |
| sp|Q07008|NOTC1_RAT | Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus GN=Notch1 PE=1 SV=3 | 756 | 982 | 3.0E-08 |
| sp|Q01705|NOTC1_MOUSE | Neurogenic locus notch homolog protein 1 OS=Mus musculus GN=Notch1 PE=1 SV=3 | 756 | 982 | 3.0E-08 |
| sp|Q9NXR5|ANR10_HUMAN | Ankyrin repeat domain-containing protein 10 OS=Homo sapiens GN=ANKRD10 PE=1 SV=2 | 831 | 982 | 3.0E-08 |
| sp|A6NK59|ASB14_HUMAN | Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 | 800 | 952 | 3.0E-08 |
| sp|Q4R690|ZDH13_MACFA | Palmitoyltransferase ZDHHC13 OS=Macaca fascicularis GN=ZDHHC13 PE=2 SV=1 | 744 | 981 | 3.0E-08 |
| sp|Q0V8G2|GABP2_BOVIN | GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 | 794 | 908 | 3.0E-08 |
| sp|Q13418|ILK_HUMAN | Integrin-linked protein kinase OS=Homo sapiens GN=ILK PE=1 SV=2 | 694 | 823 | 3.0E-08 |
| sp|Q5R5V4|ILK_PONAB | Integrin-linked protein kinase OS=Pongo abelii GN=ILK PE=2 SV=1 | 694 | 823 | 3.0E-08 |
| sp|Q3SWY2|ILK_BOVIN | Integrin-linked protein kinase OS=Bos taurus GN=ILK PE=2 SV=1 | 694 | 823 | 3.0E-08 |
| sp|Q99J82|ILK_RAT | Integrin-linked protein kinase OS=Rattus norvegicus GN=Ilk PE=2 SV=1 | 694 | 823 | 3.0E-08 |
| sp|O55222|ILK_MOUSE | Integrin-linked protein kinase OS=Mus musculus GN=Ilk PE=1 SV=2 | 694 | 823 | 3.0E-08 |
| sp|Q07E17|ASZ1_MUSPF | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 | 879 | 1071 | 3.0E-08 |
| sp|Q2QLA2|CTTB2_HORSE | Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 | 795 | 982 | 3.0E-08 |
| sp|A0JNU3|LPP60_MOUSE | 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 | 780 | 922 | 3.0E-08 |
| sp|P21783|NOTC1_XENLA | Neurogenic locus notch homolog protein 1 OS=Xenopus laevis GN=notch1 PE=1 SV=3 | 756 | 981 | 3.0E-08 |
| sp|Q6DGX3|ANR54_DANRE | Ankyrin repeat domain-containing protein 54 OS=Danio rerio GN=ankrd54 PE=2 SV=1 | 745 | 837 | 3.0E-08 |
| sp|Q8WXI3|ASB10_HUMAN | Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 | 830 | 1001 | 3.0E-08 |
| sp|Q9VFD5|FEM1A_DROME | Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 | 833 | 993 | 3.0E-08 |
| sp|A0M8T5|CTTB2_FELCA | Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 | 750 | 882 | 3.0E-08 |
| sp|Q86YR6|POTED_HUMAN | POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 | 667 | 817 | 4.0E-08 |
| sp|Q4X251|AKR1_ASPFU | Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 | 826 | 982 | 4.0E-08 |
| sp|Q9J513|V222_FOWPN | Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 | 695 | 921 | 4.0E-08 |
| sp|Q865U8|ANKR1_PIG | Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 | 797 | 933 | 4.0E-08 |
| sp|Q1RMI3|GABP1_BOVIN | GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 | 903 | 1009 | 4.0E-08 |
| sp|Q96NS5|ASB16_HUMAN | Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens GN=ASB16 PE=1 SV=2 | 796 | 982 | 4.0E-08 |
| sp|Q06547|GABP1_HUMAN | GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 | 903 | 1009 | 4.0E-08 |
| sp|Q0VGY8|TANC1_MOUSE | Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 | 829 | 989 | 4.0E-08 |
| sp|Q52T38|ZDH22_ARATH | Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 | 754 | 944 | 4.0E-08 |
| sp|Q8HYY4|UACA_BOVIN | Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 | 827 | 1003 | 4.0E-08 |
| sp|Q38998|AKT1_ARATH | Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 | 767 | 944 | 4.0E-08 |
| sp|Q9J5H8|V023_FOWPN | Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 | 667 | 834 | 4.0E-08 |
| sp|P81069|GABP2_MOUSE | GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 | 794 | 908 | 4.0E-08 |
| sp|Q8H569|AKT3_ORYSJ | Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 | 801 | 974 | 4.0E-08 |
| sp|Q65XV2|XB3_ORYSJ | E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica GN=XB3 PE=1 SV=1 | 801 | 981 | 4.0E-08 |
| sp|E5RJM6|ANR65_HUMAN | Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 | 863 | 974 | 5.0E-08 |
| sp|Q5ZIJ9|MIB2_CHICK | E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 | 690 | 851 | 5.0E-08 |
| sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 753 | 891 | 5.0E-08 |
| sp|Q7ZT11|ANKR1_CHICK | Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 | 794 | 933 | 5.0E-08 |
| sp|Q6P6B7|ANR16_HUMAN | Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 | 667 | 820 | 5.0E-08 |
| sp|Q00420|GABP1_MOUSE | GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 | 903 | 1009 | 5.0E-08 |
| sp|Q8TC84|FANK1_HUMAN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 | 834 | 1009 | 5.0E-08 |
| sp|Q60778|IKBB_MOUSE | NF-kappa-B inhibitor beta OS=Mus musculus GN=Nfkbib PE=1 SV=2 | 696 | 870 | 5.0E-08 |
| sp|Q52T38|ZDH22_ARATH | Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 | 668 | 907 | 5.0E-08 |
| sp|Q91ZT8|ASB9_MOUSE | Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 | 699 | 900 | 5.0E-08 |
| sp|Q00PJ3|ASZ1_ATEAB | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 | 804 | 989 | 5.0E-08 |
| sp|P50086|PSD10_YEAST | Probable 26S proteasome regulatory subunit p28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAS6 PE=1 SV=1 | 693 | 863 | 5.0E-08 |
| sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 816 | 969 | 6.0E-08 |
| sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 667 | 818 | 6.0E-08 |
| sp|Q6S8J7|POTEA_HUMAN | POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 | 732 | 898 | 6.0E-08 |
| sp|Q7Z8U2|AKR1_ASPOR | Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 | 760 | 949 | 6.0E-08 |
| sp|Q8CGB3|UACA_MOUSE | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 | 761 | 932 | 6.0E-08 |
| sp|Q94CT7|XB31_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS31 OS=Oryza sativa subsp. japonica GN=XBOS31 PE=2 SV=1 | 761 | 943 | 6.0E-08 |
| sp|Q2IBF8|CTTB2_EULMM | Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 | 659 | 861 | 6.0E-08 |
| sp|Q9D2J7|ANKE1_MOUSE | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 | 691 | 823 | 6.0E-08 |
| sp|Q54XX5|Y9849_DICDI | Probable serine/threonine-protein kinase DDB_G0278535 OS=Dictyostelium discoideum GN=DDB_G0278535 PE=3 SV=1 | 703 | 962 | 6.0E-08 |
| sp|Q9BGT9|ASB7_MACFA | Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 | 791 | 970 | 7.0E-08 |
| sp|A6NC57|ANR62_HUMAN | Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 | 804 | 982 | 7.0E-08 |
| sp|A2AS55|ANR16_MOUSE | Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 | 667 | 820 | 7.0E-08 |
| sp|Q15327|ANKR1_HUMAN | Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 | 667 | 837 | 7.0E-08 |
| sp|Q8R560|ANKR1_RAT | Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 | 669 | 836 | 7.0E-08 |
| sp|Q9WV71|ASB4_MOUSE | Ankyrin repeat and SOCS box protein 4 OS=Mus musculus GN=Asb4 PE=1 SV=1 | 799 | 982 | 7.0E-08 |
| sp|Q9BYH8|IKBZ_HUMAN | NF-kappa-B inhibitor zeta OS=Homo sapiens GN=NFKBIZ PE=1 SV=1 | 757 | 968 | 7.0E-08 |
| sp|Q9CWU2|ZDH13_MOUSE | Palmitoyltransferase ZDHHC13 OS=Mus musculus GN=Zdhhc13 PE=1 SV=2 | 684 | 915 | 7.0E-08 |
| sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 815 | 981 | 8.0E-08 |
| sp|Q7ZT11|ANKR1_CHICK | Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 | 671 | 837 | 8.0E-08 |
| sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 853 | 983 | 8.0E-08 |
| sp|Q9BZF9|UACA_HUMAN | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 | 827 | 1003 | 8.0E-08 |
| sp|Q9J5A7|V155_FOWPN | Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 | 688 | 838 | 8.0E-08 |
| sp|Q6B858|FANK1_BOVIN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 | 846 | 1009 | 8.0E-08 |
| sp|A0M8T5|CTTB2_FELCA | Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 | 795 | 982 | 8.0E-08 |
| sp|Q9C0D5|TANC1_HUMAN | Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 | 810 | 982 | 9.0E-08 |
| sp|Q6GQX6|ANKS6_MOUSE | Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 | 827 | 982 | 9.0E-08 |
| sp|Q9JLU4|SHAN3_RAT | SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus GN=Shank3 PE=1 SV=3 | 800 | 969 | 9.0E-08 |
| sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 658 | 851 | 1.0E-07 |
| sp|Q00653|NFKB2_HUMAN | Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens GN=NFKB2 PE=1 SV=4 | 694 | 840 | 1.0E-07 |
| sp|Q9J517|V218_FOWPN | Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 | 768 | 1012 | 1.0E-07 |
| sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 879 | 1009 | 1.0E-07 |
| sp|Q3KP44|ANR55_HUMAN | Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 | 669 | 871 | 1.0E-07 |
| sp|Q9BXX3|AN30A_HUMAN | Ankyrin repeat domain-containing protein 30A OS=Homo sapiens GN=ANKRD30A PE=2 SV=3 | 789 | 981 | 1.0E-07 |
| sp|Q9Y574|ASB4_HUMAN | Ankyrin repeat and SOCS box protein 4 OS=Homo sapiens GN=ASB4 PE=2 SV=1 | 663 | 863 | 1.0E-07 |
| sp|O54910|IKBE_MOUSE | NF-kappa-B inhibitor epsilon OS=Mus musculus GN=Nfkbie PE=1 SV=2 | 698 | 861 | 1.0E-07 |
| sp|Q9TU71|ANKR1_RABIT | Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 | 822 | 968 | 1.0E-07 |
| sp|Q923M0|PP16A_MOUSE | Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 | 747 | 968 | 1.0E-07 |
| sp|Q9CR42|ANKR1_MOUSE | Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 | 797 | 933 | 1.0E-07 |
| sp|Q9Z2X3|PSD10_RAT | 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 | 761 | 903 | 1.0E-07 |
| sp|Q9SQK3|EM506_ARATH | Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 | 710 | 870 | 1.0E-07 |
| sp|Q6ZVZ8|ASB18_HUMAN | Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens GN=ASB18 PE=2 SV=2 | 799 | 982 | 1.0E-07 |
| sp|A7E2S9|A30BL_HUMAN | Putative ankyrin repeat domain-containing protein 30B-like OS=Homo sapiens GN=ANKRD30BL PE=2 SV=3 | 756 | 888 | 1.0E-07 |
| sp|Q6UB98|ANR12_HUMAN | Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 | 706 | 885 | 1.0E-07 |
| sp|Q9DAM9|FANK1_MOUSE | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 | 856 | 1009 | 1.0E-07 |
| sp|Q9J502|V233_FOWPN | Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 | 847 | 982 | 1.0E-07 |
| sp|Q4R690|ZDH13_MACFA | Palmitoyltransferase ZDHHC13 OS=Macaca fascicularis GN=ZDHHC13 PE=2 SV=1 | 689 | 915 | 1.0E-07 |
| sp|Q9EST8|IKBZ_MOUSE | NF-kappa-B inhibitor zeta OS=Mus musculus GN=Nfkbiz PE=1 SV=1 | 757 | 968 | 1.0E-07 |
| sp|Q6B858|FANK1_BOVIN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 | 717 | 919 | 1.0E-07 |
| sp|P57044|ILK_CAVPO | Integrin-linked protein kinase OS=Cavia porcellus GN=ILK PE=2 SV=1 | 799 | 903 | 1.0E-07 |
| sp|Q8H569|AKT3_ORYSJ | Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 | 798 | 944 | 1.0E-07 |
| sp|Q66H07|FANK1_RAT | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 | 856 | 1009 | 1.0E-07 |
| sp|Q4JHE0|XB36_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 | 897 | 982 | 1.0E-07 |
| sp|P14360|V240_FOWPN | Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 | 762 | 888 | 1.0E-07 |
| sp|Q9CWU2|ZDH13_MOUSE | Palmitoyltransferase ZDHHC13 OS=Mus musculus GN=Zdhhc13 PE=1 SV=2 | 837 | 1011 | 1.0E-07 |
| sp|P21001|B4_VACCC | Ankyrin repeat protein B4 OS=Vaccinia virus (strain Copenhagen) GN=B4R PE=3 SV=1 | 659 | 871 | 1.0E-07 |
| sp|Q2T9K6|FEM1C_XENLA | Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 | 830 | 1011 | 1.0E-07 |
| sp|Q4ACU6|SHAN3_MOUSE | SH3 and multiple ankyrin repeat domains protein 3 OS=Mus musculus GN=Shank3 PE=1 SV=3 | 800 | 969 | 1.0E-07 |
| sp|Q1RHT6|Y997_RICBR | Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 | 669 | 949 | 1.0E-07 |
| sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 818 | 1001 | 2.0E-07 |
| sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 818 | 1001 | 2.0E-07 |
| sp|Q9GKW8|AND1A_MACFA | Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 | 896 | 1001 | 2.0E-07 |
| sp|Q8VBX0|ASB13_MOUSE | Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 | 865 | 1034 | 2.0E-07 |
| sp|Q8WXK3|ASB13_HUMAN | Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 | 865 | 1034 | 2.0E-07 |
| sp|P0CG38|POTEI_HUMAN | POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 | 729 | 898 | 2.0E-07 |
| sp|P0CG39|POTEJ_HUMAN | POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 | 729 | 898 | 2.0E-07 |
| sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 896 | 1006 | 2.0E-07 |
| sp|Q08353|IKBA_PIG | NF-kappa-B inhibitor alpha OS=Sus scrofa GN=NFKBIA PE=2 SV=1 | 698 | 853 | 2.0E-07 |
| sp|P25963|IKBA_HUMAN | NF-kappa-B inhibitor alpha OS=Homo sapiens GN=NFKBIA PE=1 SV=1 | 698 | 864 | 2.0E-07 |
| sp|Q9Z1E3|IKBA_MOUSE | NF-kappa-B inhibitor alpha OS=Mus musculus GN=Nfkbia PE=1 SV=2 | 698 | 853 | 2.0E-07 |
| sp|Q8BLD6|ANR55_MOUSE | Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 | 663 | 826 | 2.0E-07 |
| sp|Q9J513|V222_FOWPN | Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 | 660 | 890 | 2.0E-07 |
| sp|Q80VM7|ANR24_MOUSE | Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 | 732 | 908 | 2.0E-07 |
| sp|Q8IVF6|AN18A_HUMAN | Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 | 667 | 844 | 2.0E-07 |
| sp|Q8HXA6|ASB15_BOVIN | Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 | 637 | 855 | 2.0E-07 |
| sp|Q05753|AKRP_ARATH | Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 | 654 | 811 | 2.0E-07 |
| sp|Q03017|CACT_DROME | NF-kappa-B inhibitor cactus OS=Drosophila melanogaster GN=cact PE=1 SV=2 | 793 | 982 | 2.0E-07 |
| sp|Q6UB98|ANR12_HUMAN | Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 | 896 | 982 | 2.0E-07 |
| sp|Q9J5H5|V026_FOWPN | Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 | 834 | 1013 | 2.0E-07 |
| sp|Q5NVB9|ZDH13_PONAB | Palmitoyltransferase ZDHHC13 OS=Pongo abelii GN=ZDHHC13 PE=2 SV=1 | 837 | 1011 | 2.0E-07 |
| sp|Q9WV48|SHAN1_RAT | SH3 and multiple ankyrin repeat domains protein 1 OS=Rattus norvegicus GN=Shank1 PE=1 SV=1 | 739 | 941 | 2.0E-07 |
| sp|D3YZU1|SHAN1_MOUSE | SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus GN=Shank1 PE=1 SV=1 | 739 | 941 | 2.0E-07 |
| sp|Q3EC11|ZDHC2_ARATH | Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 | 819 | 1001 | 2.0E-07 |
| sp|Q91ZT8|ASB9_MOUSE | Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 | 665 | 838 | 2.0E-07 |
| sp|Q0V8G2|GABP2_BOVIN | GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 | 747 | 858 | 2.0E-07 |
| sp|Q13418|ILK_HUMAN | Integrin-linked protein kinase OS=Homo sapiens GN=ILK PE=1 SV=2 | 799 | 903 | 2.0E-07 |
| sp|Q5R5V4|ILK_PONAB | Integrin-linked protein kinase OS=Pongo abelii GN=ILK PE=2 SV=1 | 799 | 903 | 2.0E-07 |
| sp|Q3SWY2|ILK_BOVIN | Integrin-linked protein kinase OS=Bos taurus GN=ILK PE=2 SV=1 | 799 | 903 | 2.0E-07 |
| sp|Q99J82|ILK_RAT | Integrin-linked protein kinase OS=Rattus norvegicus GN=Ilk PE=2 SV=1 | 799 | 903 | 2.0E-07 |
| sp|O55222|ILK_MOUSE | Integrin-linked protein kinase OS=Mus musculus GN=Ilk PE=1 SV=2 | 799 | 903 | 2.0E-07 |
| sp|Q8WWX0|ASB5_HUMAN | Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 | 666 | 807 | 2.0E-07 |
| sp|Q94B55|XB31_ARATH | Putative E3 ubiquitin-protein ligase XBAT31 OS=Arabidopsis thaliana GN=XBAT31 PE=2 SV=1 | 801 | 981 | 2.0E-07 |
| sp|Q6NSI1|AR26L_HUMAN | Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens GN=ANKRD26P1 PE=5 SV=2 | 755 | 867 | 2.0E-07 |
| sp|Q6NXT1|ANR54_HUMAN | Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 | 780 | 870 | 2.0E-07 |
| sp|Q9HLN1|Y196_THEAC | Putative ankyrin repeat protein Ta0196 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0196 PE=3 SV=1 | 826 | 981 | 2.0E-07 |
| sp|P14360|V240_FOWPN | Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 | 764 | 957 | 2.0E-07 |
| sp|Q6DGX3|ANR54_DANRE | Ankyrin repeat domain-containing protein 54 OS=Danio rerio GN=ankrd54 PE=2 SV=1 | 671 | 771 | 2.0E-07 |
| sp|Q8TAK5|GABP2_HUMAN | GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 | 747 | 858 | 2.0E-07 |
| sp|Q07E41|CTTB2_DASNO | Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 | 659 | 784 | 2.0E-07 |
| sp|P33823|VB04_VAR67 | Ankyrin repeat protein B4 OS=Variola virus (isolate Human/India/Ind3/1967) GN=B4R PE=3 SV=1 | 659 | 871 | 2.0E-07 |
| sp|Q6UB99|ANR11_HUMAN | Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 | 780 | 952 | 2.0E-07 |
| sp|Q09YI1|CTTB2_SHEEP | Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 | 795 | 982 | 2.0E-07 |
| sp|Q862Z2|ASB5_RABIT | Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 | 666 | 807 | 2.0E-07 |
| sp|A0M8T5|CTTB2_FELCA | Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 | 659 | 862 | 2.0E-07 |
| sp|Q2QL84|ASZ1_MICMU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 | 747 | 905 | 2.0E-07 |
| sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 654 | 852 | 3.0E-07 |
| sp|Q7T163|KDIS_DANRE | Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 | 654 | 852 | 3.0E-07 |
| sp|Q6S8J3|POTEE_HUMAN | POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 | 729 | 898 | 3.0E-07 |
| sp|A5A3E0|POTEF_HUMAN | POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 | 729 | 898 | 3.0E-07 |
| sp|Q978J0|Y1425_THEVO | Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 | 693 | 852 | 3.0E-07 |
| sp|Q63746|IKBA_RAT | NF-kappa-B inhibitor alpha OS=Rattus norvegicus GN=Nfkbia PE=2 SV=1 | 698 | 853 | 3.0E-07 |
| sp|Q9BXX2|AN30B_HUMAN | Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 | 732 | 918 | 3.0E-07 |
| sp|A2A2Z9|AN18B_HUMAN | Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 | 667 | 839 | 3.0E-07 |
| sp|A5PMU4|ANS1B_DANRE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 | 667 | 867 | 3.0E-07 |
| sp|Q9JIA3|IKBB_RAT | NF-kappa-B inhibitor beta OS=Rattus norvegicus GN=Nfkbib PE=1 SV=1 | 723 | 831 | 3.0E-07 |
| sp|Q9SCX5|AKT5_ARATH | Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 | 750 | 910 | 3.0E-07 |
| sp|Q05753|AKRP_ARATH | Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 | 716 | 843 | 3.0E-07 |
| sp|Q6ZVZ8|ASB18_HUMAN | Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens GN=ASB18 PE=2 SV=2 | 666 | 887 | 3.0E-07 |
| sp|Q8IUH4|ZDH13_HUMAN | Palmitoyltransferase ZDHHC13 OS=Homo sapiens GN=ZDHHC13 PE=1 SV=3 | 837 | 1011 | 3.0E-07 |
| sp|Q9J502|V233_FOWPN | Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 | 684 | 781 | 3.0E-07 |
| sp|Q54BA2|Y3800_DICDI | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 | 841 | 982 | 3.0E-07 |
| sp|A2RUV0|NOTC1_XENTR | Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis GN=notch1 PE=1 SV=2 | 756 | 981 | 3.0E-07 |
| sp|Q07DY6|ASZ1_COLGU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 | 747 | 905 | 3.0E-07 |
| sp|P21783|NOTC1_XENLA | Neurogenic locus notch homolog protein 1 OS=Xenopus laevis GN=notch1 PE=1 SV=3 | 813 | 982 | 3.0E-07 |
| sp|Q8N9V6|ANR53_HUMAN | Ankyrin repeat domain-containing protein 53 OS=Homo sapiens GN=ANKRD53 PE=2 SV=3 | 669 | 801 | 3.0E-07 |
| sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 696 | 852 | 4.0E-07 |
| sp|Q7S3M5|AKR1_NEUCR | Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 | 847 | 982 | 4.0E-07 |
| sp|Q60778|IKBB_MOUSE | NF-kappa-B inhibitor beta OS=Mus musculus GN=Nfkbib PE=1 SV=2 | 757 | 862 | 4.0E-07 |
| sp|Q9NXR5|ANR10_HUMAN | Ankyrin repeat domain-containing protein 10 OS=Homo sapiens GN=ANKRD10 PE=1 SV=2 | 788 | 916 | 4.0E-07 |
| sp|Q9Y566|SHAN1_HUMAN | SH3 and multiple ankyrin repeat domains protein 1 OS=Homo sapiens GN=SHANK1 PE=1 SV=2 | 739 | 941 | 4.0E-07 |
| sp|Q54BA2|Y3800_DICDI | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 | 716 | 868 | 4.0E-07 |
| sp|Q65XV2|XB3_ORYSJ | E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica GN=XB3 PE=1 SV=1 | 870 | 982 | 4.0E-07 |
| sp|Q9GZV1|ANKR2_HUMAN | Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 | 812 | 968 | 4.0E-07 |
| sp|Q1LZC5|ANR54_BOVIN | Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 | 716 | 804 | 4.0E-07 |
| sp|Q1LZC5|ANR54_BOVIN | Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 | 780 | 870 | 4.0E-07 |
| sp|Q2IBB1|ASZ1_CHLAE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 | 747 | 905 | 4.0E-07 |
| sp|Q8WMX7|ASZ1_PAPAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 | 747 | 905 | 4.0E-07 |
| sp|A6NHY2|AKD1B_HUMAN | Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 | 637 | 885 | 5.0E-07 |
| sp|Q94A76|GORK_ARATH | Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 | 669 | 812 | 5.0E-07 |
| sp|Q9BGT9|ASB7_MACFA | Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 | 804 | 959 | 5.0E-07 |
| sp|Q91ZU0|ASB7_MOUSE | Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 | 804 | 959 | 5.0E-07 |
| sp|Q9H672|ASB7_HUMAN | Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 | 804 | 959 | 5.0E-07 |
| sp|Q5BKI6|ANKR1_XENTR | Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 | 853 | 1011 | 5.0E-07 |
| sp|Q8CGB3|UACA_MOUSE | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 | 827 | 1003 | 5.0E-07 |
| sp|Q9M8S6|SKOR_ARATH | Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 | 841 | 1022 | 5.0E-07 |
| sp|Q6FJ70|AKR1_CANGA | Palmitoyltransferase AKR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=AKR1 PE=3 SV=1 | 761 | 990 | 5.0E-07 |
| sp|Q6NXT1|ANR54_HUMAN | Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 | 684 | 771 | 5.0E-07 |
| sp|Q91WK7|ANR54_MOUSE | Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 | 716 | 804 | 5.0E-07 |
| sp|Q9BYB0|SHAN3_HUMAN | SH3 and multiple ankyrin repeat domains protein 3 OS=Homo sapiens GN=SHANK3 PE=1 SV=3 | 800 | 969 | 5.0E-07 |
| sp|Q811D2|ANR26_MOUSE | Ankyrin repeat domain-containing protein 26 OS=Mus musculus GN=Ankrd26 PE=1 SV=2 | 667 | 792 | 5.0E-07 |
| sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 658 | 837 | 6.0E-07 |
| sp|Q63746|IKBA_RAT | NF-kappa-B inhibitor alpha OS=Rattus norvegicus GN=Nfkbia PE=2 SV=1 | 659 | 803 | 6.0E-07 |
| sp|Q7Z8U2|AKR1_ASPOR | Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 | 826 | 973 | 6.0E-07 |
| sp|Q5RCK5|ASB7_PONAB | Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 | 813 | 959 | 6.0E-07 |
| sp|Q9D1A4|ASB5_MOUSE | Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 | 666 | 811 | 6.0E-07 |
| sp|P81069|GABP2_MOUSE | GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 | 747 | 858 | 6.0E-07 |
| sp|Q8H569|AKT3_ORYSJ | Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 | 750 | 910 | 6.0E-07 |
| sp|Q2QLG0|ASZ1_CALJA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 | 757 | 905 | 6.0E-07 |
| sp|Q66H07|FANK1_RAT | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 | 669 | 826 | 6.0E-07 |
| sp|Q09YH1|ASZ1_SAIBB | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 | 757 | 905 | 6.0E-07 |
| sp|Q566C8|ANR54_RAT | Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 | 716 | 804 | 6.0E-07 |
| sp|Q6NXT1|ANR54_HUMAN | Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 | 716 | 804 | 6.0E-07 |
| sp|Q8GXE6|AKT6_ARATH | Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 | 701 | 866 | 6.0E-07 |
| sp|Q8WWH4|ASZ1_HUMAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 | 747 | 905 | 6.0E-07 |
| sp|Q2IBE3|ASZ1_PONAB | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 | 747 | 905 | 6.0E-07 |
| sp|Q5M9H0|ANKS3_RAT | Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 | 669 | 841 | 7.0E-07 |
| sp|Q9WV48|SHAN1_RAT | SH3 and multiple ankyrin repeat domains protein 1 OS=Rattus norvegicus GN=Shank1 PE=1 SV=1 | 678 | 841 | 7.0E-07 |
| sp|P57044|ILK_CAVPO | Integrin-linked protein kinase OS=Cavia porcellus GN=ILK PE=2 SV=1 | 756 | 870 | 7.0E-07 |
| sp|Q566C8|ANR54_RAT | Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 | 780 | 870 | 7.0E-07 |
| sp|Q9UVH3|AKR1_MORAP | Palmitoyltransferase AKR1 (Fragment) OS=Mortierella alpina PE=3 SV=1 | 756 | 900 | 7.0E-07 |
| sp|Q91WK7|ANR54_MOUSE | Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 | 780 | 870 | 7.0E-07 |
| sp|Q91WK7|ANR54_MOUSE | Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 | 684 | 771 | 7.0E-07 |
| sp|Q6DGX3|ANR54_DANRE | Ankyrin repeat domain-containing protein 54 OS=Danio rerio GN=ankrd54 PE=2 SV=1 | 792 | 870 | 7.0E-07 |
| sp|Q8WMX6|ASZ1_PANTR | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 | 747 | 905 | 7.0E-07 |
| sp|Q2IBF5|ASZ1_GORGO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 | 747 | 905 | 7.0E-07 |
| sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 654 | 852 | 8.0E-07 |
| sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 696 | 852 | 8.0E-07 |
| sp|A2AS55|ANR16_MOUSE | Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 | 826 | 1013 | 8.0E-07 |
| sp|Q876A6|AKR1_NAUCC | Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 | 747 | 990 | 8.0E-07 |
| sp|D3YZU1|SHAN1_MOUSE | SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus GN=Shank1 PE=1 SV=1 | 678 | 841 | 8.0E-07 |
| sp|Q6GQX6|ANKS6_MOUSE | Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 | 697 | 911 | 8.0E-07 |
| sp|Q566C8|ANR54_RAT | Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 | 684 | 771 | 8.0E-07 |
| sp|Q07DV3|ASZ1_AOTNA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 | 762 | 905 | 8.0E-07 |
| sp|Q4R739|ANR53_MACFA | Ankyrin repeat domain-containing protein 53 OS=Macaca fascicularis GN=ANKRD53 PE=2 SV=1 | 669 | 801 | 8.0E-07 |
| sp|A7MB89|FEM1C_BOVIN | Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 | 663 | 851 | 8.0E-07 |
| sp|Q96JP0|FEM1C_HUMAN | Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 | 663 | 851 | 8.0E-07 |
| sp|Q4X251|AKR1_ASPFU | Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 | 680 | 771 | 9.0E-07 |
| sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 753 | 891 | 9.0E-07 |
| sp|P46530|NOTC1_DANRE | Neurogenic locus notch homolog protein 1 OS=Danio rerio GN=notch1a PE=2 SV=1 | 756 | 981 | 9.0E-07 |
| sp|Q38998|AKT1_ARATH | Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 | 716 | 866 | 9.0E-07 |
| sp|A6NK59|ASB14_HUMAN | Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 | 764 | 1012 | 9.0E-07 |
| sp|Q6B858|FANK1_BOVIN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 | 669 | 819 | 9.0E-07 |
| sp|P0C0T2|ANKS6_RAT | Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 | 697 | 932 | 9.0E-07 |
| sp|Q4V890|FEM1A_RAT | Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 | 764 | 972 | 9.0E-07 |
| sp|Q6NXT1|ANR54_HUMAN | Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 | 867 | 969 | 9.0E-07 |
| sp|Q6DGX3|ANR54_DANRE | Ankyrin repeat domain-containing protein 54 OS=Danio rerio GN=ankrd54 PE=2 SV=1 | 712 | 804 | 9.0E-07 |
| sp|Q8CEF1|FEM1C_MOUSE | Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 | 663 | 851 | 9.0E-07 |
| sp|Q2IBB2|CTTB2_RHIFE | Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 | 795 | 982 | 9.0E-07 |
| sp|P98150|NFKB2_CHICK | Nuclear factor NF-kappa-B p100 subunit OS=Gallus gallus GN=NFKB2 PE=1 SV=1 | 697 | 794 | 1.0E-06 |
| sp|Q978J0|Y1425_THEVO | Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 | 683 | 766 | 1.0E-06 |
| sp|Q9BXX3|AN30A_HUMAN | Ankyrin repeat domain-containing protein 30A OS=Homo sapiens GN=ANKRD30A PE=2 SV=3 | 756 | 949 | 1.0E-06 |
| sp|Q9Z1E3|IKBA_MOUSE | NF-kappa-B inhibitor alpha OS=Mus musculus GN=Nfkbia PE=1 SV=2 | 659 | 803 | 1.0E-06 |
| sp|Q641X1|ANR61_RAT | Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 | 669 | 842 | 1.0E-06 |
| sp|O00221|IKBE_HUMAN | NF-kappa-B inhibitor epsilon OS=Homo sapiens GN=NFKBIE PE=1 SV=3 | 698 | 866 | 1.0E-06 |
| sp|O00221|IKBE_HUMAN | NF-kappa-B inhibitor epsilon OS=Homo sapiens GN=NFKBIE PE=1 SV=3 | 764 | 981 | 1.0E-06 |
| sp|Q865U8|ANKR1_PIG | Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 | 860 | 1001 | 1.0E-06 |
| sp|Q15327|ANKR1_HUMAN | Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 | 860 | 1001 | 1.0E-06 |
| sp|P31695|NOTC4_MOUSE | Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 | 863 | 1025 | 1.0E-06 |
| sp|Q09701|AKR1_SCHPO | Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 | 814 | 982 | 1.0E-06 |
| sp|Q9SCX5|AKT5_ARATH | Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 | 667 | 798 | 1.0E-06 |
| sp|Q05753|AKRP_ARATH | Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 | 792 | 933 | 1.0E-06 |
| sp|Q96KQ7|EHMT2_HUMAN | Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 | 664 | 865 | 1.0E-06 |
| sp|Q4ULZ2|Y580_RICFE | Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 | 747 | 957 | 1.0E-06 |
| sp|Q9J507|V228_FOWPN | Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 | 769 | 982 | 1.0E-06 |
| sp|Q99LW0|ANR10_MOUSE | Ankyrin repeat domain-containing protein 10 OS=Mus musculus GN=Ankrd10 PE=2 SV=2 | 854 | 982 | 1.0E-06 |
| sp|Q9WV48|SHAN1_RAT | SH3 and multiple ankyrin repeat domains protein 1 OS=Rattus norvegicus GN=Shank1 PE=1 SV=1 | 799 | 974 | 1.0E-06 |
| sp|A6QL64|AN36A_HUMAN | Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 | 667 | 831 | 1.0E-06 |
| sp|Q17QS6|ASB5_BOVIN | Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 | 666 | 807 | 1.0E-06 |
| sp|Q8IUH5|ZDH17_HUMAN | Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 | 827 | 974 | 1.0E-06 |
| sp|Q9J5A7|V155_FOWPN | Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 | 730 | 986 | 1.0E-06 |
| sp|Q80TN5|ZDH17_MOUSE | Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 | 827 | 974 | 1.0E-06 |
| sp|E9PTT0|ZDH17_RAT | Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 | 827 | 984 | 1.0E-06 |
| sp|Q0V8G2|GABP2_BOVIN | GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 | 837 | 969 | 1.0E-06 |
| sp|Q13418|ILK_HUMAN | Integrin-linked protein kinase OS=Homo sapiens GN=ILK PE=1 SV=2 | 756 | 870 | 1.0E-06 |
| sp|Q5R5V4|ILK_PONAB | Integrin-linked protein kinase OS=Pongo abelii GN=ILK PE=2 SV=1 | 756 | 870 | 1.0E-06 |
| sp|Q3SWY2|ILK_BOVIN | Integrin-linked protein kinase OS=Bos taurus GN=ILK PE=2 SV=1 | 756 | 870 | 1.0E-06 |
| sp|Q99J82|ILK_RAT | Integrin-linked protein kinase OS=Rattus norvegicus GN=Ilk PE=2 SV=1 | 756 | 870 | 1.0E-06 |
| sp|O55222|ILK_MOUSE | Integrin-linked protein kinase OS=Mus musculus GN=Ilk PE=1 SV=2 | 756 | 870 | 1.0E-06 |
| sp|Q9WV06|ANKR2_MOUSE | Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 | 812 | 968 | 1.0E-06 |
| sp|Q9UVH3|AKR1_MORAP | Palmitoyltransferase AKR1 (Fragment) OS=Mortierella alpina PE=3 SV=1 | 801 | 949 | 1.0E-06 |
| sp|Q8GXE6|AKT6_ARATH | Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 | 750 | 910 | 1.0E-06 |
| sp|Q8TAK5|GABP2_HUMAN | GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 | 903 | 1009 | 1.0E-06 |
| sp|Q6UB99|ANR11_HUMAN | Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 | 750 | 921 | 1.0E-06 |
| sp|A0PJZ0|A20A5_HUMAN | Putative ankyrin repeat domain-containing protein 20A5 OS=Homo sapiens GN=ANKRD20A5P PE=5 SV=1 | 714 | 828 | 1.0E-06 |
| sp|Q2QLG9|CTTB2_OTOGA | Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 | 659 | 861 | 1.0E-06 |
| sp|A7MB89|FEM1C_BOVIN | Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 | 821 | 981 | 1.0E-06 |
| sp|Q96JP0|FEM1C_HUMAN | Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 | 821 | 981 | 1.0E-06 |
| sp|Q8CEF1|FEM1C_MOUSE | Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 | 821 | 981 | 1.0E-06 |
| sp|Q9JLU4|SHAN3_RAT | SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus GN=Shank3 PE=1 SV=3 | 830 | 983 | 1.0E-06 |
| sp|Q01317|NUC2_NEUCR | Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 | 755 | 981 | 1.0E-06 |
| sp|Q99728|BARD1_HUMAN | BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 | 842 | 962 | 1.0E-06 |
| sp|Q4ACU6|SHAN3_MOUSE | SH3 and multiple ankyrin repeat domains protein 3 OS=Mus musculus GN=Shank3 PE=1 SV=3 | 830 | 983 | 1.0E-06 |
| sp|Q08353|IKBA_PIG | NF-kappa-B inhibitor alpha OS=Sus scrofa GN=NFKBIA PE=2 SV=1 | 659 | 803 | 2.0E-06 |
| sp|Q5B0V6|AKR1_EMENI | Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 | 761 | 950 | 2.0E-06 |
| sp|Q8TC84|FANK1_HUMAN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 | 650 | 851 | 2.0E-06 |
| sp|Q9JIA3|IKBB_RAT | NF-kappa-B inhibitor beta OS=Rattus norvegicus GN=Nfkbib PE=1 SV=1 | 757 | 862 | 2.0E-06 |
| sp|Q9SCX5|AKT5_ARATH | Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 | 701 | 865 | 2.0E-06 |
| sp|Q6ZVZ8|ASB18_HUMAN | Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens GN=ASB18 PE=2 SV=2 | 733 | 933 | 2.0E-06 |
| sp|Q9Y566|SHAN1_HUMAN | SH3 and multiple ankyrin repeat domains protein 1 OS=Homo sapiens GN=SHANK1 PE=1 SV=2 | 799 | 974 | 2.0E-06 |
| sp|Q9M8S6|SKOR_ARATH | Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 | 783 | 948 | 2.0E-06 |
| sp|D3YZU1|SHAN1_MOUSE | SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus GN=Shank1 PE=1 SV=1 | 799 | 974 | 2.0E-06 |
| sp|Q4R690|ZDH13_MACFA | Palmitoyltransferase ZDHHC13 OS=Macaca fascicularis GN=ZDHHC13 PE=2 SV=1 | 837 | 1011 | 2.0E-06 |
| sp|Q68DC2|ANKS6_HUMAN | Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 | 694 | 996 | 2.0E-06 |
| sp|Q9WV06|ANKR2_MOUSE | Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 | 840 | 1004 | 2.0E-06 |
| sp|Q9Z2G1|FM1AA_MOUSE | Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 | 696 | 851 | 2.0E-06 |
| sp|Q9Z2G1|FM1AA_MOUSE | Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 | 764 | 972 | 2.0E-06 |
| sp|Q4V890|FEM1A_RAT | Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 | 696 | 851 | 2.0E-06 |
| sp|Q9UVH3|AKR1_MORAP | Palmitoyltransferase AKR1 (Fragment) OS=Mortierella alpina PE=3 SV=1 | 735 | 836 | 2.0E-06 |
| sp|Q1LZC5|ANR54_BOVIN | Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 | 867 | 969 | 2.0E-06 |
| sp|Q2QLG9|CTTB2_OTOGA | Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 | 795 | 982 | 2.0E-06 |
| sp|Q07DX6|ASZ1_NOMLE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 | 747 | 905 | 2.0E-06 |
| sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 669 | 1006 | 3.0E-06 |
| sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 760 | 987 | 3.0E-06 |
| sp|Q9P0K7|RAI14_HUMAN | Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 | 667 | 777 | 3.0E-06 |
| sp|Q4P6L3|AKR1_USTMA | Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 | 747 | 931 | 3.0E-06 |
| sp|Q91ZT7|ASB10_MOUSE | Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 | 667 | 896 | 3.0E-06 |
| sp|Q0JKV1|AKT1_ORYSJ | Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 | 667 | 804 | 3.0E-06 |
| sp|P0C550|AKT1_ORYSI | Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 | 667 | 804 | 3.0E-06 |
| sp|Q8TC84|FANK1_HUMAN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 | 669 | 819 | 3.0E-06 |
| sp|Q9SQK3|EM506_ARATH | Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 | 833 | 975 | 3.0E-06 |
| sp|Q60778|IKBB_MOUSE | NF-kappa-B inhibitor beta OS=Mus musculus GN=Nfkbib PE=1 SV=2 | 686 | 788 | 3.0E-06 |
| sp|Q2IBF8|CTTB2_EULMM | Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 | 795 | 982 | 3.0E-06 |
| sp|Q07DZ5|CTTB2_ORNAN | Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 | 865 | 982 | 3.0E-06 |
| sp|P81069|GABP2_MOUSE | GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 | 837 | 981 | 3.0E-06 |
| sp|Q9STP8|ACBP2_ARATH | Acyl-CoA-binding domain-containing protein 2 OS=Arabidopsis thaliana GN=ACBP2 PE=1 SV=1 | 820 | 902 | 3.0E-06 |
| sp|Q9D2J7|ANKE1_MOUSE | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 | 800 | 981 | 3.0E-06 |
| sp|A0PJZ0|A20A5_HUMAN | Putative ankyrin repeat domain-containing protein 20A5 OS=Homo sapiens GN=ANKRD20A5P PE=5 SV=1 | 807 | 926 | 3.0E-06 |
| sp|Q9VFD5|FEM1A_DROME | Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 | 830 | 1011 | 3.0E-06 |
| sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 667 | 805 | 4.0E-06 |
| sp|Q9P2R3|ANFY1_HUMAN | Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 | 762 | 1029 | 4.0E-06 |
| sp|Q4KL97|ANKR1_XENLA | Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 | 853 | 1011 | 4.0E-06 |
| sp|Q9CR42|ANKR1_MOUSE | Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 | 860 | 1001 | 4.0E-06 |
| sp|Q9Z148|EHMT2_MOUSE | Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 | 664 | 865 | 4.0E-06 |
| sp|Q8VHK1|CSKI2_MOUSE | Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 | 822 | 982 | 4.0E-06 |
| sp|Q9J5H9|V022_FOWPN | Putative ankyrin repeat protein FPV022 OS=Fowlpox virus (strain NVSL) GN=FPV022 PE=3 SV=1 | 679 | 982 | 4.0E-06 |
| sp|Q9GZV1|ANKR2_HUMAN | Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 | 840 | 1000 | 4.0E-06 |
| sp|Q1LZC5|ANR54_BOVIN | Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 | 694 | 771 | 4.0E-06 |
| sp|P25963|IKBA_HUMAN | NF-kappa-B inhibitor alpha OS=Homo sapiens GN=NFKBIA PE=1 SV=1 | 659 | 803 | 5.0E-06 |
| sp|Q7Z8U2|AKR1_ASPOR | Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 | 680 | 771 | 5.0E-06 |
| sp|Q05823|RN5A_HUMAN | 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 | 667 | 952 | 5.0E-06 |
| sp|Q9DAM9|FANK1_MOUSE | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 | 650 | 851 | 5.0E-06 |
| sp|Q9J512|V223_FOWPN | Putative ankyrin repeat protein FPV223 OS=Fowlpox virus (strain NVSL) GN=FPV223 PE=3 SV=1 | 846 | 982 | 5.0E-06 |
| sp|P0C0T2|ANKS6_RAT | Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 | 694 | 968 | 5.0E-06 |
| sp|Q9WV06|ANKR2_MOUSE | Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 | 730 | 866 | 5.0E-06 |
| sp|Q9WV06|ANKR2_MOUSE | Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 | 798 | 931 | 5.0E-06 |
| sp|Q9R186|TRPV6_RAT | Transient receptor potential cation channel subfamily V member 6 OS=Rattus norvegicus GN=Trpv6 PE=1 SV=2 | 817 | 968 | 5.0E-06 |
| sp|Q9GZV1|ANKR2_HUMAN | Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 | 798 | 931 | 5.0E-06 |
| sp|Q811D2|ANR26_MOUSE | Ankyrin repeat domain-containing protein 26 OS=Mus musculus GN=Ankrd26 PE=1 SV=2 | 760 | 889 | 5.0E-06 |
| sp|Q2T9K6|FEM1C_XENLA | Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 | 821 | 981 | 5.0E-06 |
| sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 677 | 981 | 6.0E-06 |
| sp|Q8R516|MIB2_MOUSE | E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 | 790 | 1011 | 6.0E-06 |
| sp|Q6UB98|ANR12_HUMAN | Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 | 823 | 969 | 6.0E-06 |
| sp|Q52T38|ZDH22_ARATH | Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 | 853 | 1014 | 6.0E-06 |
| sp|Q876A6|AKR1_NAUCC | Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 | 663 | 847 | 6.0E-06 |
| sp|Q9C0D5|TANC1_HUMAN | Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 | 891 | 1009 | 6.0E-06 |
| sp|Q8IUH5|ZDH17_HUMAN | Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 | 661 | 771 | 6.0E-06 |
| sp|Q9HLN1|Y196_THEAC | Putative ankyrin repeat protein Ta0196 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0196 PE=3 SV=1 | 813 | 950 | 6.0E-06 |
| sp|Q91WK7|ANR54_MOUSE | Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 | 867 | 969 | 6.0E-06 |
| sp|Q6KAE5|XB32_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 | 897 | 982 | 6.0E-06 |
| sp|Q9D504|ANKR7_MOUSE | Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 | 797 | 982 | 7.0E-06 |
| sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 799 | 991 | 7.0E-06 |
| sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 896 | 983 | 7.0E-06 |
| sp|Q9EP71|RAI14_MOUSE | Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 | 667 | 777 | 7.0E-06 |
| sp|Q5JPF3|AN36C_HUMAN | Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 | 729 | 1019 | 7.0E-06 |
| sp|Q554E7|ZDHC5_DICDI | Putative ZDHHC-type palmitoyltransferase 5 OS=Dictyostelium discoideum GN=DDB_G0275097 PE=3 SV=1 | 694 | 865 | 7.0E-06 |
| sp|Q566C8|ANR54_RAT | Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 | 867 | 969 | 7.0E-06 |
| sp|Q8WXI3|ASB10_HUMAN | Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 | 667 | 885 | 7.0E-06 |
| sp|Q4V890|FEM1A_RAT | Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 | 830 | 986 | 8.0E-06 |
| sp|Q9UVH3|AKR1_MORAP | Palmitoyltransferase AKR1 (Fragment) OS=Mortierella alpina PE=3 SV=1 | 826 | 933 | 8.0E-06 |
| sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 694 | 865 | 9.0E-06 |
| sp|Q3ZBX7|ANKR1_BOVIN | Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 | 860 | 1001 | 9.0E-06 |
| sp|Q5M9H0|ANKS3_RAT | Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 | 733 | 873 | 9.0E-06 |
| sp|Q90623|MYPT1_CHICK | Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 | 816 | 999 | 9.0E-06 |
| sp|Q8WXE0|CSKI2_HUMAN | Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 | 822 | 982 | 9.0E-06 |
| sp|Q9Z2G1|FM1AA_MOUSE | Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 | 830 | 986 | 9.0E-06 |
| sp|Q68LP1|MIB2_RAT | E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 | 785 | 1011 | 1.0E-05 |
| sp|A7E2S9|A30BL_HUMAN | Putative ankyrin repeat domain-containing protein 30B-like OS=Homo sapiens GN=ANKRD30BL PE=2 SV=3 | 790 | 926 | 1.0E-05 |
| sp|Q4FE45|XB33_ARATH | E3 ubiquitin-protein ligase XBAT33 OS=Arabidopsis thaliana GN=XBAT33 PE=2 SV=1 | 865 | 950 | 1.0E-05 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005515 | protein binding | Yes |
| GO:0003674 | molecular_function | No |
| GO:0005488 | binding | No |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Cytoplasm | 0.4538 | 0.324 | 0.3179 | 0.1529 | 0.185 | 0.0264 | 0.1119 | 0.2312 | 0.1589 | 0.0243 |
| Orthofinder run ID | 4 |
| Orthogroup | 408 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|2243 MMADPFSIIGVIGVALQIVQEIAKLGLSWKDAPKNVRKFMAELQALKSTLSETNLNLALNPEFVLAFQGRRSAVL SQWKTETAANDTDKKVLTCKAELDGLLGELKKRANMKGQRAAWDRVKAAFLSDKTRQAVEDLHRQCQTLNSLAAI DSAALGAYTLNEFKTARQEHLDQERARQQSLVLDWLSSVDHGVVQYDCGLRQQSGTGQWFLDALEFRTWVKSCGE TLFCPGIPGAGKTILTSIIIDELRNQFHGDQDTGLAYIYCNFKLQHAQTATHLLASLLKQLAQQRPCLPEGVQAL YNKHAHGARQGRPSHEDVSRTLHETVSMYKRVFIVIDALDECSKIDGCREKLVSELVELQRRGCANLLVTSRPLL EINRFFESSTKVEIRAAGEDVRAYLEGQMSQSTGPLRRNCELQEEVVTGIEDAVDGMFLLAKLHLDGLRGKVSPK AVRTALLKLPTGSDAYDLSYHDAMERIESQLTDQANLAKRVISWIAYSKRPLTTEELQHALAVEIGQHELDEDNI ADIEDIVSACAGLVTVEQESSVIRLVHYTTQEYFERSGHKWFPEARGDIAQTCLTYLSFSAFQNGACRKGGEFEA RLRHHKLYDYAACHWGHHARDADTSVQTIAGFLESEGRFEASSQALVFKGRSMRNPSGSFGCTTQVTGLHAAAYF GLDSLALFLVKDGEADPRDSDGETPLVWAITKGQETSARLLIQQGADLEATNHRWSQTPLHLAVIFESENCIKTL VQLGADLEAKDRYGQTPLHLAVISESAICIEILVQLGAHLEAKNWKSRTPLHLAVTSESEICIDTLARRGANLEA RDRYGKTPLHLATCSGAESSIKVLAQLGADLEAKDEDGYTPLHQAANYNLEGSVNALIQSGADLETEARCGQTPL HVAARIGNEDSVHRLLMDKASIDSRDFCGRTSLISAAAYGHKSIVRRLLSGGCAVNVRDLYGQTALSLAARHGHE GVVQLLLFTVPLIEMDSKDAFGRSPLWWSTRNSHISTSTSFHEIAVRRGVTLWEEDITETSKHKVSGSGELWVYC DVCLSPVLTSSQRDSRYCTVCLGGDFDICPECLSFGARCLDASHILTRRECYLARITTNVTSKKGRRAIA* |
| Coding | >Hirsu2|2243 ATGATGGCTGACCCATTCAGCATTATTGGCGTCATCGGCGTGGCGCTCCAGATTGTTCAAGAGATCGCCAAACTG GGCCTGAGCTGGAAAGACGCGCCCAAAAATGTTAGGAAATTCATGGCTGAGCTTCAAGCCCTCAAGTCCACCCTC TCAGAAACGAACTTGAACCTCGCTCTCAACCCCGAATTCGTTCTTGCCTTTCAAGGGCGTCGCTCCGCTGTGCTG TCACAATGGAAGACAGAGACCGCGGCGAATGACACCGACAAGAAAGTGTTAACCTGCAAGGCGGAGCTGGATGGC TTGCTCGGAGAGCTCAAGAAGCGGGCCAACATGAAGGGACAGCGAGCGGCATGGGACAGAGTGAAAGCGGCTTTC CTCTCAGACAAGACGCGGCAGGCCGTTGAAGACCTCCATCGGCAGTGCCAGACCCTCAATAGCTTGGCTGCTATC GACAGTGCCGCCCTCGGGGCCTATACCCTAAATGAGTTCAAAACGGCAAGACAGGAGCATTTAGACCAGGAGCGC GCACGTCAACAGTCCCTTGTCCTCGACTGGCTGAGCTCCGTTGACCATGGGGTTGTACAGTATGATTGCGGCCTA CGACAGCAATCTGGAACTGGTCAGTGGTTCTTGGATGCGCTCGAGTTTCGGACCTGGGTAAAAAGTTGCGGCGAA ACTCTTTTTTGTCCAGGAATCCCAGGAGCGGGAAAAACAATCCTCACGTCGATCATAATTGACGAGTTGCGCAAC CAATTCCACGGCGATCAAGACACCGGACTCGCGTACATCTACTGCAACTTCAAACTACAACATGCCCAAACCGCT ACTCACCTTCTCGCTAGCCTACTCAAGCAGCTGGCTCAACAGCGGCCGTGCTTACCTGAAGGTGTTCAAGCACTA TATAATAAGCATGCACATGGAGCCAGGCAGGGGCGACCATCCCACGAAGACGTGTCAAGAACCCTCCATGAGACG GTTTCGATGTACAAGAGAGTGTTCATTGTCATCGACGCTCTTGATGAATGTTCGAAAATTGACGGCTGTCGAGAG AAATTAGTATCCGAGCTCGTTGAGCTGCAGAGACGAGGTTGCGCCAATCTCCTCGTGACGTCGAGACCTCTCCTG GAAATAAACCGCTTTTTTGAGAGCAGTACCAAAGTCGAGATCCGAGCTGCAGGCGAGGACGTGAGGGCCTACCTC GAGGGTCAGATGTCTCAATCAACTGGACCGCTGAGGCGTAATTGCGAGTTGCAAGAGGAGGTGGTGACCGGGATC GAAGACGCCGTGGACGGCATGTTCTTGCTGGCAAAACTTCACCTCGACGGCTTGAGGGGAAAAGTGTCCCCTAAG GCTGTTCGAACTGCTCTTCTGAAGCTACCCACGGGATCCGATGCCTACGACCTGTCATATCACGATGCCATGGAA CGGATTGAAAGCCAACTAACCGACCAAGCAAACCTCGCAAAGCGGGTCATTTCATGGATAGCCTACTCCAAGCGG CCTCTTACCACAGAAGAACTCCAGCACGCCCTCGCTGTTGAGATCGGTCAGCACGAGTTGGACGAGGACAATATT GCGGACATTGAAGATATTGTTTCAGCGTGCGCCGGCCTCGTCACGGTAGAACAGGAAAGCAGTGTCATCCGGCTG GTTCATTACACGACCCAAGAATACTTTGAACGATCAGGACACAAGTGGTTTCCGGAAGCCAGAGGTGACATTGCT CAAACCTGCCTGACTTATCTGTCTTTCAGTGCATTCCAAAACGGAGCTTGTCGGAAGGGGGGAGAGTTCGAGGCG CGTCTACGGCACCATAAGCTGTACGACTACGCCGCGTGCCACTGGGGCCACCACGCTCGTGATGCCGATACCTCG GTCCAGACAATTGCTGGCTTCTTGGAGTCCGAAGGAAGATTTGAGGCGTCAAGCCAAGCCCTCGTTTTCAAGGGT CGATCGATGAGAAATCCTAGTGGCAGTTTCGGCTGTACAACGCAAGTTACTGGACTCCATGCCGCGGCATATTTC GGGCTGGACAGCCTGGCGCTCTTTCTGGTGAAAGACGGTGAGGCCGACCCGAGAGACAGTGATGGCGAGACGCCC CTTGTATGGGCCATCACGAAGGGTCAAGAGACGTCTGCGCGGCTTCTGATCCAGCAAGGAGCTGACCTAGAGGCA ACGAATCATCGATGGAGCCAAACCCCGCTGCACCTAGCCGTCATTTTCGAGTCGGAGAACTGTATCAAGACCCTC GTTCAGCTGGGGGCCGACCTAGAGGCAAAGGATCGATACGGCCAAACGCCGCTTCACCTGGCCGTGATCTCCGAA TCGGCAATCTGCATTGAAATCCTCGTTCAGCTAGGGGCCCATCTAGAGGCGAAGAATTGGAAGAGCCGGACGCCG CTCCATCTGGCTGTTACTTCCGAATCGGAAATCTGCATCGACACCCTCGCTCGGCGAGGGGCCAATCTAGAGGCA AGAGATCGATACGGCAAAACGCCGCTCCATTTAGCGACTTGTTCCGGGGCCGAAAGCTCCATCAAGGTCCTTGCT CAGCTGGGAGCTGATTTGGAGGCCAAGGATGAAGATGGCTATACGCCCCTTCACCAGGCAGCGAACTACAACCTG GAAGGTTCTGTCAATGCCCTCATTCAGTCAGGGGCCGATCTAGAAACCGAGGCTCGATGTGGGCAAACGCCGCTT CACGTCGCAGCCAGGATCGGAAATGAGGACTCCGTACATCGGCTGCTGATGGACAAGGCCAGCATTGATTCGAGA GATTTCTGCGGCCGCACGTCTCTTATATCTGCAGCCGCATACGGACACAAAAGCATTGTACGGCGCCTTCTTTCG GGGGGATGCGCCGTAAACGTCAGAGATCTCTACGGCCAGACGGCACTATCCTTGGCAGCGAGGCATGGGCATGAG GGTGTGGTGCAGCTGCTCCTGTTTACTGTCCCATTGATCGAGATGGACTCCAAAGACGCTTTCGGACGGTCCCCC CTCTGGTGGAGTACGAGAAATTCGCATATCTCTACCTCGACAAGTTTTCATGAGATTGCCGTCAGGAGAGGAGTG ACACTCTGGGAAGAGGATATCACGGAAACATCCAAGCATAAAGTTTCGGGCTCCGGAGAGCTTTGGGTGTATTGC GACGTTTGCCTGTCGCCAGTTTTGACATCCTCTCAACGCGATTCCCGCTATTGCACTGTTTGTCTCGGCGGGGAC TTTGATATTTGCCCGGAGTGCTTGAGTTTCGGGGCACGTTGCTTGGATGCGTCCCACATATTGACGAGACGAGAA TGTTATTTGGCGCGTATCACGACGAACGTCACGAGCAAGAAGGGACGAAGAGCAATTGCTTAG |
| Transcript | >Hirsu2|2243 ATGATGGCTGACCCATTCAGCATTATTGGCGTCATCGGCGTGGCGCTCCAGATTGTTCAAGAGATCGCCAAACTG GGCCTGAGCTGGAAAGACGCGCCCAAAAATGTTAGGAAATTCATGGCTGAGCTTCAAGCCCTCAAGTCCACCCTC TCAGAAACGAACTTGAACCTCGCTCTCAACCCCGAATTCGTTCTTGCCTTTCAAGGGCGTCGCTCCGCTGTGCTG TCACAATGGAAGACAGAGACCGCGGCGAATGACACCGACAAGAAAGTGTTAACCTGCAAGGCGGAGCTGGATGGC TTGCTCGGAGAGCTCAAGAAGCGGGCCAACATGAAGGGACAGCGAGCGGCATGGGACAGAGTGAAAGCGGCTTTC CTCTCAGACAAGACGCGGCAGGCCGTTGAAGACCTCCATCGGCAGTGCCAGACCCTCAATAGCTTGGCTGCTATC GACAGTGCCGCCCTCGGGGCCTATACCCTAAATGAGTTCAAAACGGCAAGACAGGAGCATTTAGACCAGGAGCGC GCACGTCAACAGTCCCTTGTCCTCGACTGGCTGAGCTCCGTTGACCATGGGGTTGTACAGTATGATTGCGGCCTA CGACAGCAATCTGGAACTGGTCAGTGGTTCTTGGATGCGCTCGAGTTTCGGACCTGGGTAAAAAGTTGCGGCGAA ACTCTTTTTTGTCCAGGAATCCCAGGAGCGGGAAAAACAATCCTCACGTCGATCATAATTGACGAGTTGCGCAAC CAATTCCACGGCGATCAAGACACCGGACTCGCGTACATCTACTGCAACTTCAAACTACAACATGCCCAAACCGCT ACTCACCTTCTCGCTAGCCTACTCAAGCAGCTGGCTCAACAGCGGCCGTGCTTACCTGAAGGTGTTCAAGCACTA TATAATAAGCATGCACATGGAGCCAGGCAGGGGCGACCATCCCACGAAGACGTGTCAAGAACCCTCCATGAGACG GTTTCGATGTACAAGAGAGTGTTCATTGTCATCGACGCTCTTGATGAATGTTCGAAAATTGACGGCTGTCGAGAG AAATTAGTATCCGAGCTCGTTGAGCTGCAGAGACGAGGTTGCGCCAATCTCCTCGTGACGTCGAGACCTCTCCTG GAAATAAACCGCTTTTTTGAGAGCAGTACCAAAGTCGAGATCCGAGCTGCAGGCGAGGACGTGAGGGCCTACCTC GAGGGTCAGATGTCTCAATCAACTGGACCGCTGAGGCGTAATTGCGAGTTGCAAGAGGAGGTGGTGACCGGGATC GAAGACGCCGTGGACGGCATGTTCTTGCTGGCAAAACTTCACCTCGACGGCTTGAGGGGAAAAGTGTCCCCTAAG GCTGTTCGAACTGCTCTTCTGAAGCTACCCACGGGATCCGATGCCTACGACCTGTCATATCACGATGCCATGGAA CGGATTGAAAGCCAACTAACCGACCAAGCAAACCTCGCAAAGCGGGTCATTTCATGGATAGCCTACTCCAAGCGG CCTCTTACCACAGAAGAACTCCAGCACGCCCTCGCTGTTGAGATCGGTCAGCACGAGTTGGACGAGGACAATATT GCGGACATTGAAGATATTGTTTCAGCGTGCGCCGGCCTCGTCACGGTAGAACAGGAAAGCAGTGTCATCCGGCTG GTTCATTACACGACCCAAGAATACTTTGAACGATCAGGACACAAGTGGTTTCCGGAAGCCAGAGGTGACATTGCT CAAACCTGCCTGACTTATCTGTCTTTCAGTGCATTCCAAAACGGAGCTTGTCGGAAGGGGGGAGAGTTCGAGGCG CGTCTACGGCACCATAAGCTGTACGACTACGCCGCGTGCCACTGGGGCCACCACGCTCGTGATGCCGATACCTCG GTCCAGACAATTGCTGGCTTCTTGGAGTCCGAAGGAAGATTTGAGGCGTCAAGCCAAGCCCTCGTTTTCAAGGGT CGATCGATGAGAAATCCTAGTGGCAGTTTCGGCTGTACAACGCAAGTTACTGGACTCCATGCCGCGGCATATTTC GGGCTGGACAGCCTGGCGCTCTTTCTGGTGAAAGACGGTGAGGCCGACCCGAGAGACAGTGATGGCGAGACGCCC CTTGTATGGGCCATCACGAAGGGTCAAGAGACGTCTGCGCGGCTTCTGATCCAGCAAGGAGCTGACCTAGAGGCA ACGAATCATCGATGGAGCCAAACCCCGCTGCACCTAGCCGTCATTTTCGAGTCGGAGAACTGTATCAAGACCCTC GTTCAGCTGGGGGCCGACCTAGAGGCAAAGGATCGATACGGCCAAACGCCGCTTCACCTGGCCGTGATCTCCGAA TCGGCAATCTGCATTGAAATCCTCGTTCAGCTAGGGGCCCATCTAGAGGCGAAGAATTGGAAGAGCCGGACGCCG CTCCATCTGGCTGTTACTTCCGAATCGGAAATCTGCATCGACACCCTCGCTCGGCGAGGGGCCAATCTAGAGGCA AGAGATCGATACGGCAAAACGCCGCTCCATTTAGCGACTTGTTCCGGGGCCGAAAGCTCCATCAAGGTCCTTGCT CAGCTGGGAGCTGATTTGGAGGCCAAGGATGAAGATGGCTATACGCCCCTTCACCAGGCAGCGAACTACAACCTG GAAGGTTCTGTCAATGCCCTCATTCAGTCAGGGGCCGATCTAGAAACCGAGGCTCGATGTGGGCAAACGCCGCTT CACGTCGCAGCCAGGATCGGAAATGAGGACTCCGTACATCGGCTGCTGATGGACAAGGCCAGCATTGATTCGAGA GATTTCTGCGGCCGCACGTCTCTTATATCTGCAGCCGCATACGGACACAAAAGCATTGTACGGCGCCTTCTTTCG GGGGGATGCGCCGTAAACGTCAGAGATCTCTACGGCCAGACGGCACTATCCTTGGCAGCGAGGCATGGGCATGAG GGTGTGGTGCAGCTGCTCCTGTTTACTGTCCCATTGATCGAGATGGACTCCAAAGACGCTTTCGGACGGTCCCCC CTCTGGTGGAGTACGAGAAATTCGCATATCTCTACCTCGACAAGTTTTCATGAGATTGCCGTCAGGAGAGGAGTG ACACTCTGGGAAGAGGATATCACGGAAACATCCAAGCATAAAGTTTCGGGCTCCGGAGAGCTTTGGGTGTATTGC GACGTTTGCCTGTCGCCAGTTTTGACATCCTCTCAACGCGATTCCCGCTATTGCACTGTTTGTCTCGGCGGGGAC TTTGATATTTGCCCGGAGTGCTTGAGTTTCGGGGCACGTTGCTTGGATGCGTCCCACATATTGACGAGACGAGAA TGTTATTTGGCGCGTATCACGACGAACGTCACGAGCAAGAAGGGACGAAGAGCAATTGCTTAG |
| Gene | >Hirsu2|2243 ATGATGGCTGACCCATTCAGCATTATTGGCGTCATCGGCGTGGCGCTCCAGATTGTTCAAGAGATCGCCAAACTG GGCCTGAGCTGGAAAGACGCGCCCAAAAATGTTAGGAAATTCATGGCTGAGCTTCAAGCCCTCAAGTCCACCCTC TCAGAAACGAACTTGAACCTCGCTCTCAACCCCGAATTCGTTCTTGCCTTTCAAGGGCGTCGCTCCGCTGTGCTG TCACAATGGAAGACAGAGACCGCGGCGAATGACACCGACAAGAAAGTGTTAACCTGCAAGGCGGAGCTGGATGGC TTGCTCGGAGAGCTCAAGAAGCGGGCCAACATGAAGGGACAGCGAGCGGCATGGGACAGAGTGAAAGCGGCTTTC CTCTCAGACAAGACGCGGCAGGCCGTTGAAGACCTCCATCGGCAGTGCCAGACCCTCAATAGCTTGGCTGCTATC GACAGTGCCGCCCTCGGGGCCTATACCCTAAATGAGTTCAAAACGGCAAGACAGGAGCATTTAGACCAGGAGCGC GCACGTCAACAGTCCCTTGTCCTCGACTGGCTGAGCTCCGTTGACCATGGGGTTGTACAGTATGATTGCGGCCTA CGACAGCAATCTGGAACTGGTCAGTGGTTCTTGGATGCGCTCGAGTTTCGGACCTGGGTAAAAAGTTGCGGCGAA ACTCTTTTTTGTCCAGGAATCCCAGGAGCGGGAAAAACAATCCTCACGTCGATCATAATTGACGAGTTGCGCAAC CAATTCCACGGCGATCAAGACACCGGACTCGCGTACATCTACTGCAACTTCAAACTACAACATGCCCAAACCGCT ACTCACCTTCTCGCTAGCCTACTCAAGCAGCTGGCTCAACAGCGGCCGTGCTTACCTGAAGGTGTTCAAGCACTA TATAATAAGCATGCACATGGAGCCAGGCAGGGGCGACCATCCCACGAAGACGTGTCAAGAACCCTCCATGAGACG GTTTCGATGTACAAGAGAGTGTTCATTGTCATCGACGCTCTTGATGAATGTTCGAAAATTGACGGCTGTCGAGAG AAATTAGTATCCGAGCTCGTTGAGCTGCAGAGACGAGGTTGCGCCAATCTCCTCGTGACGTCGAGACCTCTCCTG GAAATAAACCGCTTTTTTGAGAGCAGTACCAAAGTCGAGATCCGAGCTGCAGGCGAGGACGTGAGGGCCTACCTC GAGGGTCAGATGTCTCAATCAACTGGACCGCTGAGGCGTAATTGCGAGTTGCAAGAGGAGGTGGTGACCGGGATC GAAGACGCCGTGGACGGCATGTACGTTTCAGCATCAATTATAGCCCCAGGCTTGGGCCGGACTTGGCTAACTCGA AGTGAATAGGTTCTTGCTGGCAAAACTTCACCTCGACGGCTTGAGGGGAAAAGTGTCCCCTAAGGCTGTTCGAAC TGCTCTTCTGAAGCTACCCACGGGATCCGATGCCTACGACCTGTCATATCACGATGCCATGGAACGGATTGAAAG CCAACTAACCGACCAAGCAAACCTCGCAAAGCGGGTCATTTCATGGATAGCCTACTCCAAGCGGCCTCTTACCAC AGAAGAACTCCAGCACGCCCTCGCTGTTGAGATCGGTCAGCACGAGTTGGACGAGGACAATATTGCGGACATTGA AGATATTGTTTCAGCGTGCGCCGGCCTCGTCACGGTAGAACAGGAAAGCAGTGTCATCCGGCTGGTTCATTACAC GACCCAAGAATACTTTGAACGATCAGGACACAAGTGGTTTCCGGAAGCCAGAGGTGACATTGCTCAAACCTGCCT GACTTATCTGTCTTTCAGTGCATTCCAAAACGGAGCTTGTCGGAAGGGGGGAGAGTTCGAGGCGCGTCTACGGCA CCATAAGCTGTACGACTACGCCGCGTGCCACTGGGGCCACCACGCTCGTGATGCCGATACCTCGGTCCAGACAAT TGCTGGCTTCTTGGAGTCCGAAGGAAGATTTGAGGCGTCAAGCCAAGCCCTCGTTTTCAAGGGTCGATCGATGAG AAATCCTAGTGGCAGTTTCGGCTGTACAACGCAAGTTACTGGACTCCATGCCGCGGCATATTTCGGGCTGGACAG CCTGGCGCTCTTTCTGGTGAAAGACGGTGAGGCCGACCCGAGAGACAGTGATGGCGAGACGCCCCTTGTATGGGC CATCACGAAGGGTCAAGAGACGTCTGCGCGGCTTCTGATCCAGCAAGGAGCTGACCTAGAGGCAACGAATCATCG ATGGAGCCAAACCCCGCTGCACCTAGCCGTCATTTTCGAGTCGGAGAACTGTATCAAGACCCTCGTTCAGCTGGG GGCCGACCTAGAGGCAAAGGATCGATACGGCCAAACGCCGCTTCACCTGGCCGTGATCTCCGAATCGGCAATCTG CATTGAAATCCTCGTTCAGCTAGGGGCCCATCTAGAGGCGAAGAATTGGAAGAGCCGGACGCCGCTCCATCTGGC TGTTACTTCCGAATCGGAAATCTGCATCGACACCCTCGCTCGGCGAGGGGCCAATCTAGAGGCAAGAGATCGATA CGGCAAAACGCCGCTCCATTTAGCGACTTGTTCCGGGGCCGAAAGCTCCATCAAGGTCCTTGCTCAGCTGGGAGC TGATTTGGAGGCCAAGGATGAAGATGGCTATACGCCCCTTCACCAGGCAGCGAACTACAACCTGGAAGGTTCTGT CAATGCCCTCATTCAGTCAGGGGCCGATCTAGAAACCGAGGCTCGATGTGGGCAAACGCCGCTTCACGTCGCAGC CAGGATCGGAAATGAGGACTCCGTACATCGGCTGCTGATGGACAAGGCCAGCATTGATTCGAGAGATTTCTGCGG CCGCACGTCTCTTATATCTGCAGCCGCATACGGACACAAAAGCATTGTACGGCGCCTTCTTTCGGGGGGATGCGC CGTAAACGTCAGAGATCTCTACGGCCAGACGGCACTATCCTTGGCAGCGAGGCATGGGCATGAGGGTGTGGTGCA GCTGCTCCTGTTTACTGTCCCATTGATCGAGATGGACTCCAAAGACGCTTTCGGACGGTCCCCCCTCTGGTGGAG TACGAGAAATTCGCATATCTCTACCTCGACAAGTTTTCATGAGATTGCCGTCAGGAGAGGAGTGACACTCTGGGA AGAGGATATCACGGAAACATCCAAGCATAAAGTTTCGGGCTCCGGAGAGCTTTGGGTGTATTGCGACGTTTGCCT GTCGCCAGTTTTGACATCCTCTCAACGCGATTCCCGCTATTGCACTGTTTGTCTCGGCGGGGACTTTGATATTTG CCCGGAGTGCTTGAGTTTCGGGGCACGTTGCTTGGATGCGTCCCACATATTGACGAGACGAGAATGTTATTTGGC GCGTATCACGACGAACGTCACGAGCAAGAAGGGACGAAGAGCAATTGCTTAG |